Flotillin-1

Overview
NameFlotillin-1
Smed IDSMED30014844
Length (bp)1695
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Flotillin-1 (SMED30014844) t-SNE clustered cells

Violin plots show distribution of expression levels for Flotillin-1 (SMED30014844) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flotillin-1 (SMED30014844) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flotillin-1 (SMED30014844) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30014844SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014844SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014844SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014844SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014844SMESG000004975.1 OX_Smed_1.0.12578ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30014844SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 94.3597 bits (233), Expect = 8.715e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 94.3597 bits (233), Expect = 8.715e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 94.3597 bits (233), Expect = 8.715e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 94.3597 bits (233), Expect = 8.715e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 94.3597 bits (233), Expect = 8.715e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087352)

HSP 1 Score: 111.694 bits (278), Expect = 4.328e-26
Identity = 50/74 (67.57%), Postives = 61/74 (82.43%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEA+V+SG  Y KP L+ GGRAFV P+ Q+V RISLN MTL++ESP +YT  GVPI+VTG+AQ+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQV 74          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087351)

HSP 1 Score: 111.694 bits (278), Expect = 4.415e-26
Identity = 50/74 (67.57%), Postives = 61/74 (82.43%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEA+V+SG  Y KP L+ GGRAFV P+ Q+V RISLN MTL++ESP +YT  GVPI+VTG+AQ+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQV 74          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 60.8474 bits (146), Expect = 1.509e-9
Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYG--KPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ 242
            T GPNEA+++SG   G  K   I GG A+   L+  V R+SLN+MTL      + T  GVP+TVTGVAQ
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQ 74          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330214)

HSP 1 Score: 60.8474 bits (146), Expect = 1.744e-9
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYG--KPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQLYTKRTLSI 269
            T GPNEA+++SG   G  K   I GG A+   L+  V R+SLN+MTL      + T  GVP+TVTGVAQ    + +++
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIMKMMNV 83          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 60.4622 bits (145), Expect = 1.773e-9
Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYG--KPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ 242
            T GPNEA+++SG   G  K   I GG A+   L+  V R+SLN+MTL      + T  GVP+TVTGVAQ
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQ 74          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 96.6709 bits (239), Expect = 6.380e-21
Identity = 41/70 (58.57%), Postives = 55/70 (78.57%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +ISGGR FV P +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 71          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 96.2857 bits (238), Expect = 6.696e-21
Identity = 41/70 (58.57%), Postives = 55/70 (78.57%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +ISGGR FV P +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 71          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 93.5893 bits (231), Expect = 5.467e-20
Identity = 40/70 (57.14%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +I+GGR FV+P IQ++ RI+LN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVIPCIQQIQRITLNTLTLNVKSDKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 51.6026 bits (122), Expect = 3.574e-8
Identity = 32/70 (45.71%), Postives = 42/70 (60.00%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYG---KPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ 242
            T GPNEA+V+SG   G   K + + GG A+   LI  + ++SL IMT+      I T  GVP+ VTGVAQ
Sbjct:    6 TVGPNEALVVSGGCCGSDGKTYTV-GGWAWAWWLITDIQKLSLEIMTILCRCENIETSEGVPLDVTGVAQ 74          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 56.6102 bits (135), Expect = 4.745e-8
Identity = 33/70 (47.14%), Postives = 42/70 (60.00%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKPH--LISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            T GPNEA+V+SG   G      + GG A+   LI    RI+L IMTL+ +   + T  GV ITVTGVAQ+
Sbjct:    6 TVGPNEALVVSGACCGSDAKTYVVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVTGVAQV 75          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 96.2857 bits (238), Expect = 7.738e-21
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +I+GGR FVLP +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    3 FYTCGPNEAMVVSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 72          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 72.4034 bits (176), Expect = 6.655e-13
Identity = 31/58 (53.45%), Postives = 45/58 (77.59%), Query Frame = 3
Query:   72 SGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            SG     P +I+GGR FVLP +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 75          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 72.4034 bits (176), Expect = 6.830e-13
Identity = 31/58 (53.45%), Postives = 45/58 (77.59%), Query Frame = 3
Query:   72 SGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            SG     P +I+GGR FVLP +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 75          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 72.4034 bits (176), Expect = 6.917e-13
Identity = 31/58 (53.45%), Postives = 45/58 (77.59%), Query Frame = 3
Query:   72 SGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            SG     P +I+GGR FVLP +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:   18 SGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 75          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 71.2478 bits (173), Expect = 1.627e-12
Identity = 29/51 (56.86%), Postives = 43/51 (84.31%), Query Frame = 3
Query:   93 PHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            P +I+GGR FVLP +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:   11 PVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 61          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 94.7449 bits (234), Expect = 6.142e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 94.7449 bits (234), Expect = 6.142e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 94.7449 bits (234), Expect = 6.508e-22
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 96.2857 bits (238), Expect = 5.118e-21
Identity = 43/75 (57.33%), Postives = 58/75 (77.33%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ-LYTKR 257
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ +Y  R
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQEIYKDR 76          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 95.9005 bits (237), Expect = 1.020e-20
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O61491|FLOT1_DROME (Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.425e-25
Identity = 50/74 (67.57%), Postives = 61/74 (82.43%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEA+V+SG  Y KP L+ GGRAFV P+ Q+V RISLN MTL++ESP +YT  GVPI+VTG+AQ+
Sbjct:    1 MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQV 74          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q767L6|FLOT1_PIG (Flotillin-1 OS=Sus scrofa OX=9823 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.884e-20
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O75955|FLOT1_HUMAN (Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 7.075e-20
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q08DN8|FLOT1_BOVIN (Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.075e-20
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O08917|FLOT1_MOUSE (Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.135e-20
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +++GGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A0X3NHP1 (Flotillin-1 OS=Schistocephalus solidus OX=70667 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.473e-30
Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEAMV+SG  +G+PH ++GGR FVLP IQR+DRISLNIMTL IESPRIYTQ GVPITVTGVAQ+
Sbjct:    1 MTWGFVTCGPNEAMVVSGCCHGRPHYVTGGRIFVLPFIQRLDRISLNIMTLIIESPRIYTQKGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A3P7LVZ5 (PHB domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6212 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 7.405e-28
Identity = 56/74 (75.68%), Postives = 64/74 (86.49%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEAMV+SG  +  P+ ++GGR F+LP IQR+DRISLNIMTL IESPRIYTQ GVPITVTGVAQ+
Sbjct:    1 MTWGFVTCGPNEAMVVSGCCHRSPYYVTGGRIFLLPFIQRLDRISLNIMTLIIESPRIYTQKGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A504YR55 (Flotillin OS=Fasciola gigantica OX=46835 GN=FGIG_10908 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.917e-27
Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEAMV+SG F+ +P L+ GGR FV P IQR+DR+ LN MTL IESPRIYTQLGVPITVTGVAQ+
Sbjct:    1 MTWGFNTCGPNEAMVVSGCFHRRPLLVPGGRVFVWPGIQRIDRMPLNTMTLLIESPRIYTQLGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A4E0QWI1 (Flotillin OS=Fasciola hepatica OX=6192 GN=D915_009836 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.917e-27
Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGF TCGPNEAMV+SG F+ +P L+ GGR FV P IQR+DR+ LN MTL IESPRIYTQLGVPITVTGVAQ+
Sbjct:    1 MTWGFNTCGPNEAMVVSGCFHRRPLLVPGGRVFVWPGIQRIDRMPLNTMTLLIESPRIYTQLGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A158QH57 (PHB domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1527 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.382e-27
Identity = 55/74 (74.32%), Postives = 63/74 (85.14%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            M WGF TCGPNEA+V+SG  Y KP+ + GGR FVLP +QR+DRISLNIMTL IESPRIYT+ GVPITVTGVAQ+
Sbjct:    1 MGWGFYTCGPNEALVVSGCCYNKPYYVPGGRVFVLPFVQRIDRISLNIMTLIIESPRIYTRNGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 97.0561 bits (240), Expect = 3.623e-21
Identity = 41/70 (58.57%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +ISGGR FV+P +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 71          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 97.0561 bits (240), Expect = 3.721e-21
Identity = 43/70 (61.43%), Postives = 56/70 (80.00%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +ISGGR FVLP IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGCGRSPPIMISGGRVFVLPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQV 71          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 70.4774 bits (171), Expect = 1.368e-12
Identity = 28/49 (57.14%), Postives = 42/49 (85.71%), Query Frame = 3
Query:   99 LISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            +ISGGR FV+P +Q++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    1 MISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 49          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 53.1434 bits (126), Expect = 4.588e-7
Identity = 32/70 (45.71%), Postives = 41/70 (58.57%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKPHLI--SGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            T GPNEA+V+SG   G    I   GG A+    +    RI+L IMTL+ +   + T  GV ITVTGVAQ+
Sbjct:    6 TVGPNEALVVSGGCTGSDEKIYVVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVTGVAQV 75          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 53.1434 bits (126), Expect = 4.889e-7
Identity = 32/70 (45.71%), Postives = 41/70 (58.57%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKPHLI--SGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            T GPNEA+V+SG   G    I   GG A+    +    RI+L IMTL+ +   + T  GV ITVTGVAQ+
Sbjct:    6 TVGPNEALVVSGGCTGSDEKIYVVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVTGVAQV 75          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 68.1662 bits (165), Expect = 1.688e-12
Identity = 30/51 (58.82%), Postives = 41/51 (80.39%), Query Frame = 3
Query:   93 PHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            P  I+GGR FV P+IQ++ RISLN MTL + S ++YT+ GVPI+VTG+AQ+
Sbjct:   12 PITITGGRVFVWPIIQQLQRISLNTMTLNVRSEKVYTRQGVPISVTGIAQV 62          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 59.6918 bits (143), Expect = 7.167e-10
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 3
Query:   39 KTCGPNEAMVISGMFYG--KPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            +T GPNEA+V+SG + G  +   ++GG ++V  L+ +  RISL IMTL      + T  GV +TVTGVAQ+
Sbjct:    5 ETVGPNEALVVSGGWCGADEKKYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVTGVAQV 75          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 110.538 bits (275), Expect = 3.999e-26
Identity = 46/70 (65.71%), Postives = 59/70 (84.29%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG F+ +P L+SGGR FV P+ Q++ RISLN MTL +ESPR+YT+ GVPI+VTG+AQ+
Sbjct:    4 FNTCGPNEAMVVSGCFHARPALVSGGRIFVWPVFQKLQRISLNTMTLNVESPRVYTRHGVPISVTGIAQV 73          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 53.5286 bits (127), Expect = 1.199e-7
Identity = 31/70 (44.29%), Postives = 39/70 (55.71%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKP--HLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            T GPNEA+V+SG   G      + GG AF    +  V  ISL +MTL      + T  GV +TVTGVAQ+
Sbjct:    6 TVGPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVTGVAQV 75          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 95.9005 bits (237), Expect = 8.587e-21
Identity = 41/70 (58.57%), Postives = 55/70 (78.57%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +I+GGR FV P IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPLMIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 71          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1b (flotillin-1 [Source:NCBI gene;Acc:101157726])

HSP 1 Score: 95.1301 bits (235), Expect = 2.223e-20
Identity = 41/70 (58.57%), Postives = 55/70 (78.57%), Query Frame = 3
Query:   36 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            F TCGPNEAMV+SG     P +I+GGR FV P IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:   40 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVFPCIQKIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQV 109          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 69.3218 bits (168), Expect = 2.942e-12
Identity = 28/49 (57.14%), Postives = 41/49 (83.67%), Query Frame = 3
Query:   99 LISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            +I+GGR FV P IQ++ RISLN +TL ++S ++YT+ GVPI+VTG+AQ+
Sbjct:    1 MIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQM 49          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 58.151 bits (139), Expect = 1.396e-8
Identity = 36/78 (46.15%), Postives = 47/78 (60.26%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKPH--LISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQLY--TKRTL 263
            T GPNEA+V+SG   G      + GG A+   LI  + RI+L IMTL+ +   + T  GV ITVTGVAQ+   T+R L
Sbjct:    6 TVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTEREL 83          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 56.225 bits (134), Expect = 4.536e-8
Identity = 34/78 (43.59%), Postives = 45/78 (57.69%), Query Frame = 3
Query:   42 TCGPNEAMVISGMFYGKPH--LISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ--LYTKRTL 263
            T GPNEA+V+SG   G      + GG A+   LI  + R+SL +MT+      I T  GVP+ VTGVAQ  + T+R L
Sbjct:    6 TVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVTGVAQVKVMTEREL 83          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 162.54 bits (410), Expect = 3.966e-44
Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 3
Query:   24 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQL 245
            MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQ+
Sbjct:    1 MTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQV 74          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000042225.1 (SMESG000042225.1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.585e-37
Identity = 57/106 (53.77%), Postives = 70/106 (66.04%), Query Frame = 1
Query:  430 LSLASLGPEITL*SKSEVSGSRSLNKVPHSCKYLPKTSLGLTYRVAPGPKTSTLFPPNISPSTNRLNSQIDLLRLGMPRVELEHKGDGQIETAAVSNTT--RVTYY 741
            +SLA L PE+TL SK EVS SRSL KVPH   YLPKTS GL YR A G K ST + PN S ST   ++++DL R G  R+E E++G+ QIET  V N    + T+Y
Sbjct:   57 ISLAFLEPEMTLSSKLEVSESRSLKKVPHFDGYLPKTSSGLVYRAAAGHKISTSYQPNTSLSTKCRSNRMDLPRGGQSRLEQEYRGEDQIETVVVVNGAAPKQTFY 162          

HSP 2 Score: 78.5666 bits (192), Expect = 9.585e-37
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 2
Query:  278 M*NSSSLPQIHRLSPSAIATR*KLDQLERDHATLQAKYKKIKGIWSSPETTFLS 439
            M N S+LP+I  LSPS IATR KLDQLE+DHATLQAKY+KIKG WSSPE T + 
Sbjct:    1 MSNLSNLPRIPGLSPSTIATRQKLDQLEKDHATLQAKYRKIKGTWSSPEATAVC 54          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000061686.1 (SMESG000061686.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.834e-33
Identity = 46/58 (79.31%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  426 QPFSRLSRARDYLIIEI*SQRITIAEQSTALLQIFTENELRTHLPSRTWAQNINIIPA 599
            Q  SRLSRARD LIIE  SQRITIAEQS AL  IFTENELRT LPS +WAQ+INIIPA
Sbjct:   56 QKVSRLSRARDDLIIETRSQRITIAEQSAALRPIFTENELRTRLPSCSWAQDINIIPA 113          

HSP 2 Score: 75.8702 bits (185), Expect = 1.834e-33
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 2
Query:  278 M*NSSSLPQIHRLSPSAIATR*KLDQLERDHATLQAKYKKIKGIWSSPE 424
            M N S+LP+I RLS SAIATR KLDQLERDHA LQAKY+ IKG WSSPE
Sbjct:    1 MSNLSNLPRIPRLSSSAIATRQKLDQLERDHAILQAKYRNIKGTWSSPE 49          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000046818.1 (SMESG000046818.1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.790e-32
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 3
Query:  426 QPFSRLSRARDYLIIEI*SQRITIAEQSTALLQIFTENELRTHLPSRTWAQNINIIPA 599
            Q  SRL RARD LIIE  SQRITIAEQS AL +IFTENE+R+ LPS  WAQ+INIIPA
Sbjct:  193 QKISRLFRARDDLIIETRSQRITIAEQSAALRRIFTENEVRSRLPSCGWAQDINIIPA 250          

HSP 2 Score: 76.6406 bits (187), Expect = 2.790e-32
Identity = 39/52 (75.00%), Postives = 43/52 (82.69%), Query Frame = 2
Query:  275 KM*NSSSLPQIHRLSPSAIATR*KLDQLERDHATLQAKYKKIKGIWSSPETT 430
            +M N S+LP+I RLS S IATR KLDQLERDHA LQAKY+KIKG WSSPE T
Sbjct:  137 EMSNLSNLPRIPRLSSSTIATRQKLDQLERDHALLQAKYEKIKGTWSSPEAT 188          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000044636.1 (SMESG000044636.1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.256e-31
Identity = 58/83 (69.88%), Postives = 64/83 (77.11%), Query Frame = 3
Query:  426 QPFSRLSRARDYLIIEI*SQRITIAEQSTALLQIFTENELRTHLPSRTWAQNINIIPAXXXXXXXXXXXXXXXXXTGNAESGT 674
            Q  SRL RARD LIIE  SQRITI+EQS AL QIFTEN+LRT LPSR WAQ I+IIPAQ LPL    +  N PPP+GNAE+GT
Sbjct:   56 QKISRLFRARDDLIIENRSQRITISEQSAALRQIFTENDLRTRLPSRRWAQEIDIIPAQQLPLPSMARPANGPPPSGNAENGT 138          

HSP 2 Score: 64.3142 bits (155), Expect = 4.256e-31
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = 2
Query:  278 M*NSSSLPQIHRLSPSAIATR*KLDQLERDHATLQAKYKKIKGIWSSPET 427
            M N SSLP+I R+SPS + T  KLD+LERD++TL AKY+K+KG WSS ET
Sbjct:    1 MSNLSSLPRIPRISPSMLGTMQKLDKLERDYSTLPAKYQKVKGTWSSLET 50          
The following BLAST results are available for this feature:
BLAST of Flotillin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT18.715e-2258.57flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT18.715e-2258.57flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT18.715e-2258.57flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT18.715e-2258.57flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT18.715e-2258.57flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo14.328e-2667.57gene:FBgn0024754 transcript:FBtr0087352[more]
Flo14.415e-2667.57gene:FBgn0024754 transcript:FBtr0087351[more]
Flo21.509e-949.28gene:FBgn0264078 transcript:FBtr0330217[more]
Flo21.744e-943.59gene:FBgn0264078 transcript:FBtr0330214[more]
Flo21.773e-949.28gene:FBgn0264078 transcript:FBtr0073952[more]
back to top
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a6.380e-2158.57flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a6.696e-2158.57flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1b5.467e-2057.14flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a3.574e-845.71flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot2b4.745e-847.14flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot17.738e-2158.57flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot16.655e-1353.45flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot16.830e-1353.45flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot16.917e-1353.45flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot11.627e-1256.86flotillin 1 [Source:NCBI gene;Acc:733927][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot16.142e-2258.57flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot16.142e-2258.57flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot16.508e-2258.57flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot15.118e-2157.33flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot11.020e-2058.57flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
back to top
BLAST of Flotillin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61491|FLOT1_DROME4.425e-2567.57Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|Q767L6|FLOT1_PIG6.884e-2058.57Flotillin-1 OS=Sus scrofa OX=9823 GN=FLOT1 PE=3 SV... [more]
sp|O75955|FLOT1_HUMAN7.075e-2058.57Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 ... [more]
sp|Q08DN8|FLOT1_BOVIN7.075e-2058.57Flotillin-1 OS=Bos taurus OX=9913 GN=FLOT1 PE=2 SV... [more]
sp|O08917|FLOT1_MOUSE7.135e-2058.57Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1... [more]
back to top
BLAST of Flotillin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NHP12.473e-3079.73Flotillin-1 OS=Schistocephalus solidus OX=70667 GN... [more]
A0A3P7LVZ57.405e-2875.68PHB domain-containing protein OS=Dibothriocephalus... [more]
A0A504YR552.917e-2775.68Flotillin OS=Fasciola gigantica OX=46835 GN=FGIG_1... [more]
A0A4E0QWI12.917e-2775.68Flotillin OS=Fasciola hepatica OX=6192 GN=D915_009... [more]
A0A158QH577.382e-2774.32PHB domain-containing protein OS=Rodentolepis nana... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a3.623e-2158.57flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot1b3.721e-2161.43flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
flot1a1.368e-1257.14flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot2b4.588e-745.71flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
flot2b4.889e-745.71flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot1b1.688e-1258.82flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a7.167e-1045.07flotillin 2a [Source:NCBI gene;Acc:245698][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471823.999e-2665.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376881.199e-744.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a8.587e-2158.57flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1b2.223e-2058.57flotillin-1 [Source:NCBI gene;Acc:101157726][more]
flot1a2.942e-1257.14flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot2a1.396e-846.15flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a4.536e-843.59flotillin 2 [Source:NCBI gene;Acc:101169802][more]
back to top
BLAST of Flotillin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004975.13.966e-4498.65SMESG000004975.1[more]
SMESG000042225.19.585e-3753.77SMESG000042225.1[more]
SMESG000061686.11.834e-3379.31SMESG000061686.1[more]
SMESG000046818.12.790e-3274.14SMESG000046818.1[more]
SMESG000044636.14.256e-3169.88SMESG000044636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014844 ID=SMED30014844|Name=Flotillin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1695bp
TTCCGATCTCATATTTAGAAAGAATGACTTGGGGATTTAAAACTTGTGGC
CCAAATGAAGCAATGGTTATTTCGGGTATGTTTTATGGAAAACCTCATTT
AATATCTGGAGGGCGAGCTTTTGTTCTACCATTGATTCAACGAGTTGACA
GAATATCTCTTAACATTATGACTTTAAAAATTGAAAGTCCTAGAATTTAT
ACTCAGCTTGGTGTGCCCATTACTGTCACAGGAGTAGCACAGTTATACAC
CAAGAGAACCCTATCGATTTCAAGAAAATGTAGAATTCATCAAGTCTTCC
CCAGATACACCGGCTTTCCCCATCGGCGATAGCCACCCGGTAGAAGCTTG
ATCAGTTAGAGAGGGATCACGCCACTCTACAGGCGAAATATAAGAAAATC
AAGGGCATTTGGAGTTCACCCGAGACAACCTTTCTCTCGCCTCTCTCGGG
CCAGAGATTACCTTATAATCGAAATCTGAAGTCAGCGGATCACGATCGCT
GAACAAAGTACCGCACTCCTGCAAATATTTACCGAAAACGAGCTTAGGAC
TCACCTACCGAGTCGCACCTGGGCCCAAAACATCAACATTATTCCCGCCC
AACATCTCCCCCTCAACCAATCGCCTCAACAGCCAAATAGACCTCCTCCG
ACTGGGAATGCCGAGAGTGGAACTGGAGCACAAAGGCGACGGCCAAATCG
AAACCGCCGCCGTTTCCAACACAACACGTGTAACATATTATCTAACTGTG
TTGAATACATTCTTCCACTTTATTGTTTCTTATTCTTATTATATGAGAAT
AATAATAACCAAAAAATTACTCAAATTCTCTCACAGCCGAAGAGACATAC
ATTTAAAGATGATCTGGATAAATATATTTTCAATAATTCAATTAGAGAAC
AGTCAAAGAAACGTAATGGTTCGATCATATTTGGATGAAAATTTTCGCAA
CAAATTTAACACAGTTCCCAACGAAGATTTTATGAAAAGACTAAAATTGG
CTTTTGTGTAAAATCAAAATTTAGTTAAGAATCTAGAGAATTGGCTATTT
ATCTAAATAAATGATGTAGGAACTTTAAAAAAGATGCAGAAAAGTAATCA
AGAAACAACATCCAATCGTTTTATTGCCAACAATATTGAGATTAATAAAT
TTCAAGGTTTACAGCTATTTTTATATGTAGTTATATAAAATTAAAAAAAA
TCATTTTACCACCGCTGAGAGACTTCTATTATTCTCGCATTGAAATGATA
AATGTCTTCAATAAAATTCTACATAATAGTTTGTATTTTCGTTATGACCT
TGTCCTTAAATATAATTTTATATTTGTTTTTAATTATTTTCTAAGCTTTC
ATAACTTTCCCCCTAATAAATATTAATTTTTCTGCATTTGAATTTACTGT
ACTCATTTATATAAACCACAGGTTTGTATTGCCTACTTACTGCAAAATAA
ATAATTTCCTTAGAATATATAGTATTTACTTTAACAAATGTACCAAAATG
TATTTTTTACTAATTTTATGAATCATTGTAATTAACGAGATTGACTCTGC
CATCTTCCAACAATTTTTTTATGCTTTTCGACAAACATTGCTTATCAAAT
CACTTACACAAGGTGCAACGTAACGTATATTGGGGAAACACACAGGACAT
TCCAAACACGACTCAATGAATACATCAAAAACAAAACCAGTAATT
back to top

protein sequence of SMED30014844-orf-1

>SMED30014844-orf-1 ID=SMED30014844-orf-1|Name=SMED30014844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
PISYLERMTWGFKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDR
ISLNIMTLKIESPRIYTQLGVPITVTGVAQLYTKRTLSISRKCRIHQVFP
RYTGFPHRR*
back to top

protein sequence of SMED30014844-orf-2

>SMED30014844-orf-2 ID=SMED30014844-orf-2|Name=SMED30014844-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MPRVELEHKGDGQIETAAVSNTTRVTYYLTVLNTFFHFIVSYSYYMRIII
TKKLLKFSHSRRDIHLKMIWINIFSIIQLENSQRNVMVRSYLDENFRNKF
NTVPNEDFMKRLKLAFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
GO:0016600flotillin complex
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 5..78
NoneNo IPR availablePANTHERPTHR13806:SF16FLOTILLIN-1coord: 5..78
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 39..79