ADP-ribosylation factor-like protein 6

Overview
NameADP-ribosylation factor-like protein 6
Smed IDSMED30014841
Length (bp)860
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor-like protein 6 (SMED30014841) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 6 (SMED30014841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor-like protein 6 (SMED30014841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 6 (SMED30014841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014841SMESG000054828.1 SmedASXL_012529SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014841SMESG000054828.1 dd_Smed_v4_10812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014841SMESG000054828.1 dd_Smed_v6_10812_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014841SMESG000054828.1 dd_Smed_v4_10812_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Match: ARL6 (ADP ribosylation factor like GTPase 6 [Source:HGNC Symbol;Acc:HGNC:13210])

HSP 1 Score: 224.172 bits (570), Expect = 2.581e-73
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Match: ARL6 (ADP ribosylation factor like GTPase 6 [Source:HGNC Symbol;Acc:HGNC:13210])

HSP 1 Score: 224.172 bits (570), Expect = 2.581e-73
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Match: ARL6 (ADP ribosylation factor like GTPase 6 [Source:HGNC Symbol;Acc:HGNC:13210])

HSP 1 Score: 224.172 bits (570), Expect = 2.581e-73
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Match: ARL6 (ADP ribosylation factor like GTPase 6 [Source:HGNC Symbol;Acc:HGNC:13210])

HSP 1 Score: 224.172 bits (570), Expect = 2.581e-73
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Match: ARL6 (ADP ribosylation factor like GTPase 6 [Source:HGNC Symbol;Acc:HGNC:13210])

HSP 1 Score: 176.407 bits (446), Expect = 5.365e-55
Identity = 88/137 (64.23%), Postives = 112/137 (81.75%), Query Frame = 1
Query:  211 IVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQ 621
            I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL E   Q
Sbjct:    1 ILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQEKTIQ 137          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Match: arl-6 (ADP-ribosylation factor-like protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q18510])

HSP 1 Score: 146.747 bits (369), Expect = 2.116e-43
Identity = 78/190 (41.05%), Postives = 118/190 (62.11%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQS 642
            MG   SL   FG  KK+  I+V+GLDNSGKTTILN++K PE +   IVPT+G  V   ST+ L+   FDM+GQ +YR+ W  Y      +IFV+DSSD+LRM + KDEL +++  K + ++ +PI+  ANKMD   ++T+   +  L L   +   W+I S+ AL+G+GL + +  L     +++ S ++
Sbjct:    1 MGFFSSLSSLFGLGKKDVNIVVVGLDNSGKTTILNQLKTPETRSQQIVPTVGHVVTNFSTQNLSFHAFDMAGQMKYRSTWESYFHSSQGVIFVLDSSDRLRMELLKDELMMVMEHKDVVSRGIPIVILANKMDIPGAMTASDITVALGLNLYRSGTWSIHSTCALTGDGLDKAMQQLSAEITKYMESRRT 190          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Match: arl-3 (ADP-ribosylation factor-like protein 3 [Source:UniProtKB/Swiss-Prot;Acc:O45379])

HSP 1 Score: 129.798 bits (325), Expect = 6.723e-37
Identity = 74/183 (40.44%), Postives = 112/183 (61.20%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKG-LNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            MGL+D L  F   S +E RIL++GLDN+GKTTIL ++   + QH  + PT GFNV+ ++  G + L  +D+ GQ   R  W +Y +  D +IFVIDS+D+ R      EL  LL ++ +  +KVP+L FANK D   + +S   ++ LNL+ L+D  W+I + +AL  EG+  G+ W+  + K
Sbjct:    1 MGLIDVLKSFKSPSGREIRILLLGLDNAGKTTILKQLSSEDVQH--VTPTKGFNVKTVAAMGDIRLNVWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKL--RKVPVLIFANKQDLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNLK 179          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 124.79 bits (312), Expect = 6.866e-35
Identity = 72/176 (40.91%), Postives = 110/176 (62.50%), Query Frame = 1
Query:   79 LLDSLMK-FFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            +  SL K  FG  K+E RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D   ++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:    4 VFGSLFKGLFG--KREMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDEL--RDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 124.79 bits (312), Expect = 6.866e-35
Identity = 72/176 (40.91%), Postives = 110/176 (62.50%), Query Frame = 1
Query:   79 LLDSLMK-FFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            +  SL K  FG  K+E RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D   ++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:    4 VFGSLFKGLFG--KREMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDEL--RDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 124.79 bits (312), Expect = 6.866e-35
Identity = 72/176 (40.91%), Postives = 110/176 (62.50%), Query Frame = 1
Query:   79 LLDSLMK-FFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            +  SL K  FG  K+E RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D   ++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:    4 VFGSLFKGLFG--KREMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDEL--RDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Match: Arl6 (gene:FBgn0034446 transcript:FBtr0340534)

HSP 1 Score: 177.563 bits (449), Expect = 4.601e-55
Identity = 96/194 (49.48%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKI-STKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MG+L +L       K +  ILV+GL+NSGK++I+N  K    Q   +VPT+GF VE+  S  G+++   DMSG  RYRNLW H  K C  II+VIDSSD++R VV KDELDL+L    + N+ VPILF+ NKMD +DSL+SV+ +  L LE++KD PW+I SS+A+SGEGL +GV WLI+  +  +L++++  K
Sbjct:    1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYSMSGVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAK 194          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Match: Arl6 (gene:FBgn0034446 transcript:FBtr0086534)

HSP 1 Score: 177.178 bits (448), Expect = 5.462e-55
Identity = 96/195 (49.23%), Postives = 134/195 (68.72%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEK--ISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MG+L +L       K +  ILV+GL+NSGK++I+N  K    Q   +VPT+GF VE+  I   G+++   DMSG  RYRNLW H  K C  II+VIDSSD++R VV KDELDL+L    + N+ VPILF+ NKMD +DSL+SV+ +  L LE++KD PW+I SS+A+SGEGL +GV WLI+  +  +L++++  K
Sbjct:    1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAK 195          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Match: dnd (gene:FBgn0038916 transcript:FBtr0084151)

HSP 1 Score: 132.494 bits (332), Expect = 8.072e-38
Identity = 69/183 (37.70%), Postives = 112/183 (61.20%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQ 621
            MGLL  L K     +KEARIL++GLDN+GKTTIL ++   +     + PT GFN++ ++  G  L  +D+ GQ + R  W +Y    D +I+VID +D+ R+  A  EL  +L D  +  K+VP+L FANK D  D++++   ++ ++L  L+   W I +  A+ G GL++G+DW+ ++ K+
Sbjct:    1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITT--VTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRL--KQVPVLIFANKQDMPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMKK 179          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 125.561 bits (314), Expect = 3.735e-35
Identity = 68/164 (41.46%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  112 SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
             KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D  +++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDEL--RDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 125.561 bits (314), Expect = 3.735e-35
Identity = 68/164 (41.46%), Postives = 105/164 (64.02%), Query Frame = 1
Query:  112 SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
             KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D  +++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDEL--RDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Match: arl6 (ADP-ribosylation factor-like 6 [Source:NCBI gene;Acc:494134])

HSP 1 Score: 223.402 bits (568), Expect = 4.336e-73
Identity = 115/190 (60.53%), Postives = 146/190 (76.84%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQS 642
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS D+LRMVVAK+ELD LL+   + ++++P+LFFANKMD +D+L++V+ SQLL LE++KD PW+I +S+A+ GEGL +GVDWL E   Q  LS+QS
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWLQE---QIALSNQS 187          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Match: arl6 (ADP-ribosylation factor-like 6 [Source:NCBI gene;Acc:494134])

HSP 1 Score: 219.164 bits (557), Expect = 2.090e-71
Identity = 109/177 (61.58%), Postives = 139/177 (78.53%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS D+LRMVVAK+ELD LL+   + ++++P+LFFANKMD +D+L++V+ SQLL LE++KD PW+I +S+A+ GEGL +GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Match: arl6 (ADP-ribosylation factor-like 6 [Source:NCBI gene;Acc:494134])

HSP 1 Score: 219.164 bits (557), Expect = 2.090e-71
Identity = 109/177 (61.58%), Postives = 139/177 (78.53%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS D+LRMVVAK+ELD LL+   + ++++P+LFFANKMD +D+L++V+ SQLL LE++KD PW+I +S+A+ GEGL +GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Match: arl6 (ADP-ribosylation factor-like 6 [Source:NCBI gene;Acc:494134])

HSP 1 Score: 219.164 bits (557), Expect = 2.090e-71
Identity = 109/177 (61.58%), Postives = 139/177 (78.53%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS D+LRMVVAK+ELD LL+   + ++++P+LFFANKMD +D+L++V+ SQLL LE++KD PW+I +S+A+ GEGL +GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Match: arl3b (ADP ribosylation factor like GTPase 3b [Source:NCBI gene;Acc:797451])

HSP 1 Score: 133.265 bits (334), Expect = 6.210e-38
Identity = 71/180 (39.44%), Postives = 111/180 (61.67%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIES 612
            MGLL  L K   T  +E RIL++GLDN GKTT+L ++   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R      EL  LL ++ ++   VP+L FANK D   +  +   ++ LNL +++D  W I S +AL+GEG+Q G++W+ +S
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDITH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSG--VPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKS 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Match: clk1 (CDC like kinase 1 [Source:Xenbase;Acc:XB-GENE-6041600])

HSP 1 Score: 229.95 bits (585), Expect = 1.942e-75
Identity = 114/183 (62.30%), Postives = 143/183 (78.14%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQ 621
            MGL D L  + G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+EL+ LL+   + ++++P+LFFANKMD +DSL+SV+ SQLL+LE +KD PW+I +S+ L+GEGLQ+GVDWL +   Q
Sbjct:    1 MGLFDKLAGWLGLKKKEVHVLCLGLDNSGKTTIINKLKPANAQTQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELETLLNHADIKHRRMPVLFFANKMDLRDSLSSVKVSQLLSLEHIKDKPWHICASDGLTGEGLQEGVDWLQDQITQ 183          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Match: clk1 (CDC like kinase 1 [Source:Xenbase;Acc:XB-GENE-6041600])

HSP 1 Score: 229.565 bits (584), Expect = 2.255e-75
Identity = 113/177 (63.84%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+EL+ LL+   + ++++P+LFFANKMD +DSL+SV+ SQLL+LE +KD PW+I +S+ L+GEGLQ+GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVHVLCLGLDNSGKTTIINKLKPANAQTQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELETLLNHADIKHRRMPVLFFANKMDLRDSLSSVKVSQLLSLEHIKDKPWHICASDGLTGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:100492073])

HSP 1 Score: 129.028 bits (323), Expect = 4.221e-36
Identity = 69/179 (38.55%), Postives = 109/179 (60.89%), Query Frame = 1
Query:   67 IPMGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            I  GLL  L K      +E RIL++GLDN+GKTT+L ++   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R      EL  LL ++ ++   VP+L FANK D   +  +   ++ LNL +++D  W I S +AL+GEG+Q G++W+
Sbjct:    4 ICRGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSG--VPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWV 178          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Match: dmrta1 (DMRT like family A1 [Source:Xenbase;Acc:XB-GENE-984361])

HSP 1 Score: 127.487 bits (319), Expect = 1.295e-35
Identity = 74/183 (40.44%), Postives = 111/183 (60.66%), Query Frame = 1
Query:   73 MGLL-DSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            MG+L   + + F  S +E +++++GLDN+GKTTIL +    E  H    PTIG NVE+I         +D+ GQ   R+ W  Y    + +I V+DS+D+ R+ V ++EL  +LS + +  KK  +L FANK D K+ +T    SQ L L S+KDHPW+I +  AL+GEGL QG++W++   K
Sbjct:    1 MGILFAKIWRLF--SHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTS--PTIGSNVEEIVVNNTRFLMWDIGGQESLRSSWNTYYTNTEFVIIVVDSTDRERIAVTREELYKMLSHEDL--KKAGLLVFANKQDVKECMTVAEISQYLKLTSVKDHPWHIQACCALTGEGLCQGLEWMMSRLK 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Match: arf3 (ADP ribosylation factor 3 [Source:NCBI gene;Acc:100145191])

HSP 1 Score: 124.79 bits (312), Expect = 1.466e-34
Identity = 69/169 (40.83%), Postives = 105/169 (62.13%), Query Frame = 1
Query:  112 SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
             KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D  +++ +   +  L L SL+   W I ++ A SG+GL +G+DWL    K
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLK 178          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Match: Arl6 (ADP-ribosylation factor-like 6 [Source:MGI Symbol;Acc:MGI:1927136])

HSP 1 Score: 231.106 bits (588), Expect = 5.054e-76
Identity = 119/193 (61.66%), Postives = 147/193 (76.17%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  +  L+ T FDMSGQGRYRNLW HY K+  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +DS+TSV+ SQLL LES+KD PW+I +S+A+ GEGLQ+GVDWL E   Q   S +  K+
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQEKTVQSDPSCEDVKR 193          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Match: Arl6 (ADP-ribosylation factor-like 6 [Source:MGI Symbol;Acc:MGI:1927136])

HSP 1 Score: 231.106 bits (588), Expect = 5.054e-76
Identity = 119/193 (61.66%), Postives = 147/193 (76.17%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  +  L+ T FDMSGQGRYRNLW HY K+  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +DS+TSV+ SQLL LES+KD PW+I +S+A+ GEGLQ+GVDWL E   Q   S +  K+
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQEKTVQSDPSCEDVKR 193          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Match: Arl6 (ADP-ribosylation factor-like 6 [Source:MGI Symbol;Acc:MGI:1927136])

HSP 1 Score: 228.794 bits (582), Expect = 3.744e-75
Identity = 115/177 (64.97%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  +  L+ T FDMSGQGRYRNLW HY K+  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +DS+TSV+ SQLL LES+KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Match: Arl6 (ADP-ribosylation factor-like 6 [Source:MGI Symbol;Acc:MGI:1927136])

HSP 1 Score: 183.341 bits (464), Expect = 2.685e-57
Identity = 104/194 (53.61%), Postives = 125/194 (64.43%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMA-----------------------------------NKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNI 549
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  +  L+ T FDMSGQGRYRNLW HY K+  AIIFVIDSSD+LRMVVAK+ELD LL+   M                                    ++++PILFFANKMD +DS+TSV+ SQLL LES+KD PW+I
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPGMQKPTKAIRMCQSFWNWRFGQFGTPDQFIFKCCLDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHI 194          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Match: Arl5c (ADP-ribosylation factor-like 5C [Source:MGI Symbol;Acc:MGI:3028577])

HSP 1 Score: 130.183 bits (326), Expect = 7.944e-37
Identity = 72/179 (40.22%), Postives = 110/179 (61.45%), Query Frame = 1
Query:   79 LLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESA 615
            L+  LM+ FG+  +E +++++GLDN+GKTTIL +    E  H     TIG NVE+I  +  +   +D+ GQ   R+ W  Y    + +I VIDS+D+ R++  ++EL  +L+ +++ N  V  L FANK D KDS+T+   SQ L L ++KDHPW+I    AL+GEGL  G+ W+   A
Sbjct:    4 LIAKLMRIFGS--QEHKVIIVGLDNAGKTTILYQFLTNEVVH--TCSTIGSNVEEIVLRKTHFLMWDLGGQEALRSTWDTYYSNAEFVILVIDSTDRNRLLTTREELYKMLAHEALQNASV--LIFANKQDVKDSMTTAEISQFLTLSAIKDHPWHIQGCCALTGEGLPAGLQWMQAQA 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Match: sp|O88848|ARL6_MOUSE (ADP-ribosylation factor-like protein 6 OS=Mus musculus OX=10090 GN=Arl6 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.619e-74
Identity = 115/177 (64.97%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF++EK  +  L+ T FDMSGQGRYRNLW HY K+  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +DS+TSV+ SQLL LES+KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Match: sp|Q0IIM2|ARL6_BOVIN (ADP-ribosylation factor-like protein 6 OS=Bos taurus OX=9913 GN=ARL6 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.962e-74
Identity = 116/185 (62.70%), Postives = 143/185 (77.30%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL---IESAK 618
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGF+++K  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+EL  LL+   + ++++PILFFANKMD +D+LTSV+ SQLL LE +KD PW+I +S+A+ GEGLQ+GVDWL   I+S K
Sbjct:    1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIQKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELRTLLNHPDIKHRRIPILFFANKMDLRDALTSVKVSQLLCLEDIKDKPWHICASDAIKGEGLQEGVDWLQDQIQSVK 185          
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Match: sp|Q9H0F7|ARL6_HUMAN (ADP-ribosylation factor-like protein 6 OS=Homo sapiens OX=9606 GN=ARL6 PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.239e-72
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Match: sp|Q5R4G5|ARL6_PONAB (ADP-ribosylation factor-like protein 6 OS=Pongo abelii OX=9601 GN=ARL6 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.627e-72
Identity = 112/177 (63.28%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L    G  KKE  +L +GLDNSGKTTI+NK+KP   Q  +I+PTIGF++EK  +  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D++TSV+ SQLL LE++KD PW+I +S+A+ GEGLQ+GVDWL
Sbjct:    1 MGLLDRLSILLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Match: sp|Q5M9P8|ARL6_DANRE (ADP-ribosylation factor-like protein 6 OS=Danio rerio OX=7955 GN=arl6 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.578e-70
Identity = 109/177 (61.58%), Postives = 139/177 (78.53%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS D+LRMVVAK+ELD LL+   + ++++P+LFFANKMD +D+L++V+ SQLL LE++KD PW+I +S+A+ GEGL +GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Match: A0A433TXA5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006015 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.015e-79
Identity = 122/193 (63.21%), Postives = 154/193 (79.79%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MGL DSL ++ G  KKE  +LV+GLDNSGK+TI+N  KPPE ++H+IVPT+GFNVEK  +K L  T  DMSGQGRYRNLW  Y KECD IIFVIDSSD+LR VVAKDELDLLL    + +K++P+LFFANKMDA+DS++SV+CS L+ LE+L+D PW+I +SNAL+G+GL +GVDWL +  K  +L  +SRKK
Sbjct:    1 MGLFDSLAQWLGVKKKEVNVLVVGLDNSGKSTIINHFKPPELKNHEIVPTVGFNVEKFKSKALAFTALDMSGQGRYRNLWEQYYKECDGIIFVIDSSDKLRFVVAKDELDLLLQHPELKDKRIPVLFFANKMDARDSVSSVKCSYLMGLETLRDKPWHICASNALTGDGLHEGVDWLTDQLKD-VLEKKSRKK 192          
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Match: A0A2T7NTD9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14888 PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.914e-76
Identity = 113/189 (59.79%), Postives = 149/189 (78.84%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQ 639
            MG  D+L ++ G  K+E  +LV+GLDNSGK+TI+N  KP + ++HDIVPT+GFNVE+  +K L  T FDMSGQGRYRNLW HY +EC  IIFVIDSSD+LRMVVAKDELD LL    + N+++PILFFANKMD ++S++SV+CS L+ LE+L+D PW+I +SNA++GEGL +GVDWL +  K  I+S +
Sbjct:    1 MGFFDTLAQWLGVKKREVNVLVVGLDNSGKSTIINHFKPNDAKNHDIVPTVGFNVERFKSKSLAFTAFDMSGQGRYRNLWEHYYRECHGIIFVIDSSDKLRMVVAKDELDALLQHPDLKNRRIPILFFANKMDLRESVSSVKCSSLMGLENLRDKPWHICASNAVTGEGLSEGVDWLTDQIKDLIVSRK 189          
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Match: V3ZX09 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_204362 PE=3 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.662e-75
Identity = 115/185 (62.16%), Postives = 147/185 (79.46%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFI 627
            MGLLD L ++ G  KKEA +LV+GLDNSGKTTILN +KP E + HDIVPT+GF+VEK +   L  T FDMSGQGRYRNLW HY +EC  IIFV+DSSD+LRMVVAKDELD LLS + + N+++PILFFANKMD +DS++SV+CS L+ LE ++D  W+I +SNA++GEGL +GV+WL +  K  +
Sbjct:    1 MGLLDRLARWLGMKKKEANVLVVGLDNSGKTTILNYLKPEECKSHDIVPTVGFSVEKFANSSLQFTAFDMSGQGRYRNLWEHYYRECHGIIFVVDSSDKLRMVVAKDELDQLLSHQDIKNRRIPILFFANKMDLRDSVSSVKCSSLMGLELIRDKAWHICASNAMTGEGLHEGVEWLTDQIKDLV 185          
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Match: A0A2C9K2P1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078925 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 7.504e-75
Identity = 114/182 (62.64%), Postives = 144/182 (79.12%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            M   D+L ++ G  KKE  ++V+GLDNSGKTTI+N  K PE ++HDIVPT+GFNVEK  +K L  T FDMSGQGRYRNLW  Y KECD IIFVIDSSD+LRMVVAK+EL+LLL +  + N+ +PILF+ANKMDA+D+++SV+CS LL L+SL + PW I +SNAL+GEGL +GVDWL +  K
Sbjct:    1 MPFFDALARWLGMKKKEVNVMVVGLDNSGKTTIINHFKSPETKNHDIVPTVGFNVEKFKSKSLAFTAFDMSGQGRYRNLWEQYYKECDGIIFVIDSSDKLRMVVAKEELNLLLENPELKNRSIPILFYANKMDARDAVSSVKCSHLLELQSLSNKPWFICASNALTGEGLHEGVDWLTDQLK 182          
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Match: K1PBA9 (ADP-ribosylation factor-like protein 6 OS=Crassostrea gigas OX=29159 GN=CGI_10004657 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.828e-75
Identity = 112/185 (60.54%), Postives = 146/185 (78.92%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFI 627
            MG+ DSL K+ G  KKEA +LV+GLDNSGKTTI+N++KP E + HDIVPTIGF VEK S K L+ T FDMSGQGRYRNLW HY KEC  IIFVIDSSD+LRMVVA++EL+ LL+   +  K++PILF+ANKMD +D+L++V+ + LLNL+ +   PW+I +SNAL+GEGL +GV+W+    K+ +
Sbjct:    1 MGIFDSLAKWLGLKKKEANVLVVGLDNSGKTTIINQLKPAESKSHDIVPTIGFTVEKFSGKSLSFTAFDMSGQGRYRNLWEHYYKECQGIIFVIDSSDRLRMVVAQEELEQLLNHPDIVGKRIPILFYANKMDMRDALSAVKVAHLLNLDKISTKPWHICASNALTGEGLSEGVEWITGQLKEIV 185          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Match: arl6 (ADP ribosylation factor like GTPase 6 [Source:NCBI gene;Acc:103045441])

HSP 1 Score: 229.18 bits (583), Expect = 1.970e-75
Identity = 118/190 (62.11%), Postives = 147/190 (77.37%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQS 642
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +++L+SV+ SQLL LE++KD PW+I +SNA+ GEGLQ+GVDWL E   Q  LS Q+
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPTNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLREALSSVKVSQLLCLENIKDKPWHICASNAVQGEGLQEGVDWLQE---QIALSDQN 187          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Match: arl6 (ADP ribosylation factor like GTPase 6 [Source:NCBI gene;Acc:103045441])

HSP 1 Score: 227.639 bits (579), Expect = 1.373e-74
Identity = 115/186 (61.83%), Postives = 145/186 (77.96%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFIL 630
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +++L+SV+ SQLL LE++KD PW+I +SNA+ GEGLQ+GVDWL  +  +F L
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPTNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLREALSSVKVSQLLCLENIKDKPWHICASNAVQGEGLQEGVDWLQGTHYKFYL 186          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Match: arl6 (ADP ribosylation factor like GTPase 6 [Source:NCBI gene;Acc:103045441])

HSP 1 Score: 226.483 bits (576), Expect = 2.256e-74
Identity = 113/177 (63.84%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L  + G  KKE  +L +GLDNSGKTTI+N++KP   Q  DIVPTIGF++EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDSSD+LRMVVAK+ELD LL+   + ++++PILFFANKMD +++L+SV+ SQLL LE++KD PW+I +SNA+ GEGLQ+GVDWL
Sbjct:    1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPTNAQAQDIVPTIGFSIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLREALSSVKVSQLLCLENIKDKPWHICASNAVQGEGLQEGVDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Match: arl3b (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:103024595])

HSP 1 Score: 132.88 bits (333), Expect = 6.806e-38
Identity = 71/180 (39.44%), Postives = 111/180 (61.67%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIES 612
            MGLL  L K   T  +E RIL++GLDN GKTT+L ++   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R      EL  LL ++ ++   VP+L FANK D   +  +   ++ LNL +++D  W I S +AL+GEG+Q G++W+ +S
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSG--VPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKS 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Match: arl3b (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:103024595])

HSP 1 Score: 130.954 bits (328), Expect = 3.537e-37
Identity = 71/183 (38.80%), Postives = 112/183 (61.20%), Query Frame = 1
Query:   64 SIPMGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIES 612
            S+  GLL  L K   T  +E RIL++GLDN GKTT+L ++   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R      EL  LL ++ ++   VP+L FANK D   +  +   ++ LNL +++D  W I S +AL+GEG+Q G++W+ +S
Sbjct:    1 SLFQGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSG--VPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKS 179          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Match: arl8 (ADP-ribosylation factor-like 8 [Source:ZFIN;Acc:ZDB-GENE-030131-5762])

HSP 1 Score: 128.257 bits (321), Expect = 6.228e-37
Identity = 72/173 (41.62%), Postives = 105/173 (60.69%), Query Frame = 1
Query:  100 FFGTSKK-----EARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            FF  +KK     E +++V+GLDN+GKTTIL +    E  H    PTIG NVE+I  K  +   +D+ GQ   R  W  Y    + +I VIDS+D+ R+ + K+EL  +L+ + +  +K  +L FANK D K  +++   SQ L L S KDHPW+I +  AL+GEGL QG++W+
Sbjct:    4 FFSRTKKRFPKYEHKVIVVGLDNAGKTTILYQFLMNEVVHTS--PTIGSNVEEIVVKNTHFIVWDIGGQESLRTSWNTYYTNTEFVIVVIDSTDRERLAITKEELYRMLAHEDL--RKASVLIFANKQDMKGCMSAAEISQYLKLTSFKDHPWHIQACCALTGEGLYQGLEWM 172          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Match: arl3b (ADP ribosylation factor like GTPase 3b [Source:NCBI gene;Acc:797451])

HSP 1 Score: 127.487 bits (319), Expect = 1.737e-36
Identity = 65/177 (36.72%), Postives = 104/177 (58.76%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLL  L K      +E RIL++GLDN+GKTT+L  +   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R    +   +L    +      VP+L FANK D   +  +   ++ LNL +++D  W I + +AL+GEG+Q G++W+
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKTLASEDITH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRF--EETGQELAELLEEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQACSALTGEGVQDGMNWV 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Match: arl1 (ADP-ribosylation factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-040718-175])

HSP 1 Score: 126.331 bits (316), Expect = 3.682e-36
Identity = 71/176 (40.34%), Postives = 107/176 (60.80%), Query Frame = 1
Query:   91 LMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            L K FG+  +E RIL++GLD +GKTTIL +++  E      +PTIGFNVE ++ K L    +D+ GQ   R  W  Y    DAII+V+DS D+ RM ++K EL  +L ++ +  KK  ++ FANK D + ++T    +  L L +LKD  W I  ++A  G GL + ++WL+E+ K
Sbjct:    9 LAKLFGS--REMRILILGLDGAGKTTILYRLQVGEVVTT--IPTIGFNVETVTYKNLRFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSCDRDRMGISKSELVAMLEEEEL--KKAILVVFANKQDMEQAMTPTEVANSLGLSALKDRKWQIFKTSATKGTGLDEAMEWLVEALK 178          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 125.946 bits (315), Expect = 5.525e-36
Identity = 72/175 (41.14%), Postives = 109/175 (62.29%), Query Frame = 1
Query:   79 LLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            L D+L+      KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  + N    +L FANK D  +++ +   +  L L SL+   W I ++ A SG+GL +G+DWL
Sbjct:    8 LFDTLV-----GKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRN--AVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 124.405 bits (311), Expect = 2.040e-35
Identity = 73/177 (41.24%), Postives = 110/177 (62.15%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MG L S+ K     KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D  +++ +   +  L L SL+   W I ++ A SG+GL +G+DWL
Sbjct:    1 MGSLFSVFKDL-LGKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWL 172          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 134.42 bits (337), Expect = 2.272e-39
Identity = 74/184 (40.22%), Postives = 116/184 (63.04%), Query Frame = 1
Query:   73 MGLLDSLM--KFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            MGL  S +    FG   KE RIL++GLD +GKTT+L K+K  E      +PTIGFNVE +  K ++ T +D+ GQ R R+LW HY +  + +IFV+DS+D+ R+  A++ +  +L++  + N     L FANK D  +++++   ++ L L S+++ PW I ++ A SGEGL +G++WL  S K
Sbjct:    1 MGLFASKLFSNLFG--NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRN--AAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLK 178          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 133.265 bits (334), Expect = 6.422e-39
Identity = 74/179 (41.34%), Postives = 114/179 (63.69%), Query Frame = 1
Query:   73 MGLLDSLM--KFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL  S +    FG   KE RIL++GLD +GKTT+L K+K  E      +PTIGFNVE +  K ++ T +D+ GQ R R+LW HY +  + +IFVIDS+D+ R+  A++ +  +L++  + N     L FANK D  +++++   ++ L L S+++ PW I S+ A SGEGL +G++WL
Sbjct:    1 MGLYASKLFSNLFGN--KEMRILMVGLDGAGKTTVLYKLKLGEV--ITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRN--AVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 132.109 bits (331), Expect = 1.942e-38
Identity = 77/175 (44.00%), Postives = 111/175 (63.43%), Query Frame = 1
Query:   97 KFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQ 621
            K +G S KE RIL++GLD +GKTTIL +++  E       PTIGFNVE +S K L L  +D+ GQ   R  W  Y  +  A+IFV+DS+D+ RM  A  EL L+L ++ + +    +L FANK D   +L++   S+ LNL  LKD  W+I +S+A+ GEG+ +G+DWLI+  K+
Sbjct:   11 KLWG-SNKELRILILGLDGAGKTTILYRLQIGEVVTTK--PTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQD--AALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKE 180          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 130.568 bits (327), Expect = 6.938e-38
Identity = 79/172 (45.93%), Postives = 110/172 (63.95%), Query Frame = 1
Query:   91 LMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLE-SLKDHPWNISSSNALSGEGLQQGVDWL 603
            L K FG+  KE +IL++GLD +GKTTIL K+K  + +     PT+GFNVE ++ K +    +D+ GQ R R LW HY     A+IFVIDSS + RM  AK+EL  ++ +K M N  V +L +ANK D KD++     S  L LE +LK+ PW +  SNALSG+GL +G+ W+
Sbjct:    9 LGKLFGS--KEMKILMLGLDKAGKTTILYKLKLNKIKTS--TPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMEN--VVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWI 174          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Match: ARL3 (ARF-like small GTPase of the RAS superfamily; required for recruitment of Arl1p, a GTPase that regulates membrane traffic, to the Golgi apparatus; NatC-catalyzed N-terminal acetylation regulates Golgi membrane association mediated by interaction with membrane receptor, Sys1p; similar to ADP-ribosylation factor and orthologous to mammalian ARFRP1 [Source:SGD;Acc:S000005972])

HSP 1 Score: 87.0409 bits (214), Expect = 3.397e-21
Identity = 57/171 (33.33%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  115 KKEARILVIGLDNSGKTTILNKIKPP---EFQH-HDIVPTIGFNVEKISTKGLNLTCF-DMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLN--LESLKDHPWNISSSNALSGEGLQQGVDWLI 606
            K++  IL++GLDN+GKTT L  +K      F+    I PT+G NV  I      +  F D+ GQ   R++W  Y   C  IIF++DSSD+ R+      L  ++ D+ +    VPIL  ANK D +D +      ++ N   E +      +   +AL+GEG++  ++W+I
Sbjct:   15 KEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEG--VPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMI 183          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Match: EDO33866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR08])

HSP 1 Score: 212.231 bits (539), Expect = 2.335e-69
Identity = 106/179 (59.22%), Postives = 138/179 (77.09%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIE 609
            MGLLD L  + G  KKE  I+ +GLDNSGK+TI+N +KP + Q  +I PTIGF  EK +++ LN   FDMSGQG+YRNLW  Y K+  AIIFVIDSSD+LRM VAKDELD LLS   + +K++P+LFFANKMD +D+L+S++C+ LL LE++KD PW+I +SNAL+ EGL +GV+WL E
Sbjct:    1 MGLLDKLQGWLGMKKKEVSIVCVGLDNSGKSTIINHLKPAKSQATEIAPTIGFTCEKFTSQRLNFAVFDMSGQGKYRNLWEPYYKDAQAIIFVIDSSDKLRMCVAKDELDALLSHPDIKSKRIPVLFFANKMDLRDALSSIKCTNLLGLEAIKDKPWHICASNALTREGLDEGVEWLTE 179          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Match: EDO48392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK4])

HSP 1 Score: 127.872 bits (320), Expect = 2.604e-36
Identity = 69/163 (42.33%), Postives = 108/163 (66.26%), Query Frame = 1
Query:  115 KKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            K+E RIL+IGLDN+GKTTIL ++K  E      VPT+GFNVE ++ K ++ T +D+ GQ + R LW  Y + C  IIFV+DS+D+ R   A++EL  LL+++ +  ++V +L  ANK D  +++T+    + L L  ++  PW + S+ A+ GEGL +G+DW+
Sbjct:   15 KEEVRILMIGLDNAGKTTILYRLKLEEV--VSTVPTLGFNVETVTYKNISFTVWDIGGQDKIRALWRVYYQGCQGIIFVVDSADRERAEEARNELHKLLAEEEL--QQVILLVIANKQDMANAMTASEIREKLKLNEIRGRPWFVQSACAVKGEGLFEGLDWM 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 125.176 bits (313), Expect = 2.145e-35
Identity = 68/164 (41.46%), Postives = 106/164 (64.63%), Query Frame = 1
Query:  112 SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
             KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL+ +L++  +  +   +L FANK D  +++ +   +  L L SL++  W I ++ A SG+GL +G+DWL
Sbjct:   14 GKKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRNRQWYIQATCATSGDGLYEGLDWL 173          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Match: EDO28892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG88])

HSP 1 Score: 124.79 bits (312), Expect = 2.716e-35
Identity = 73/178 (41.01%), Postives = 111/178 (62.36%), Query Frame = 1
Query:   73 MGLLDSLMKFFGT-SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLL    KFF   S +E +++++GLDN+GKTTIL +    E  H    PTIG NVE+I  K ++   +D+ GQ   R+ W  Y    + +I VIDS+D+ R+ ++K EL  +L+++ +  K+  +L  ANK D K S++    S+ LNL  +KDH W+I +  AL+GEGL QG++W+
Sbjct:    1 MGLL--FAKFFSWFSNEEHKVIIVGLDNAGKTTILYQFLMNEVVHTS--PTIGSNVEEIVWKNIHFIMWDIGGQESLRSAWNTYYTNTEFLILVIDSTDRERLAISKAELYQMLANEEL--KQAALLILANKQDIKGSMSVAEISEQLNLACIKDHGWHIQACCALTGEGLYQGLEWI 172          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Match: EDO37270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG88])

HSP 1 Score: 124.79 bits (312), Expect = 2.716e-35
Identity = 73/178 (41.01%), Postives = 111/178 (62.36%), Query Frame = 1
Query:   73 MGLLDSLMKFFGT-SKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLL    KFF   S +E +++++GLDN+GKTTIL +    E  H    PTIG NVE+I  K ++   +D+ GQ   R+ W  Y    + +I VIDS+D+ R+ ++K EL  +L+++ +  K+  +L  ANK D K S++    S+ LNL  +KDH W+I +  AL+GEGL QG++W+
Sbjct:    1 MGLL--FAKFFSWFSNEEHKVIIVGLDNAGKTTILYQFLMNEVVHTS--PTIGSNVEEIVWKNIHFIMWDIGGQESLRSAWNTYYTNTEFLILVIDSTDRERLAISKAELYQMLANEEL--KQAALLILANKQDIKGSMSVAEISEQLNLACIKDHGWHIQACCALTGEGLYQGLEWI 172          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Match: ARL6 (ADP-ribosylation factor-like protein 6 [Source:NCBI gene;Acc:101171562])

HSP 1 Score: 225.328 bits (573), Expect = 6.106e-74
Identity = 115/183 (62.84%), Postives = 144/183 (78.69%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQ 621
            MGL D L+ + G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGFN+EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS+D+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D+L+SV+ SQLL L+ +KD PW+I +++AL GEGLQ+GVDWL +  KQ
Sbjct:    1 MGLFDKLVGWLGL-KKEVNVLCLGLDNSGKTTIINKLKPSNAQVQDIVPTIGFNIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSADKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDVRDALSSVKVSQLLCLDYIKDKPWHICATDALKGEGLQEGVDWLQDQIKQ 182          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Match: ARL6 (ADP-ribosylation factor-like protein 6 [Source:NCBI gene;Acc:101171562])

HSP 1 Score: 224.557 bits (571), Expect = 1.478e-73
Identity = 117/192 (60.94%), Postives = 149/192 (77.60%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRK 648
            MGL D L+ + G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGFN+EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS+D+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D+L+SV+ SQLL L+ +KD PW+I +++AL GEGLQ+GVDWL +   Q I S+Q+ +
Sbjct:    1 MGLFDKLVGWLGL-KKEVNVLCLGLDNSGKTTIINKLKPSNAQVQDIVPTIGFNIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSADKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDVRDALSSVKVSQLLCLDYIKDKPWHICATDALKGEGLQEGVDWLQD---QIIQSNQTNE 188          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Match: ARL6 (ADP-ribosylation factor-like protein 6 [Source:NCBI gene;Acc:101171562])

HSP 1 Score: 221.861 bits (564), Expect = 1.554e-72
Identity = 113/177 (63.84%), Postives = 141/177 (79.66%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGL D L+ + G  KKE  +L +GLDNSGKTTI+NK+KP   Q  DIVPTIGFN+EK  T  L+ T FDMSGQGRYRNLW HY KE  AIIFVIDS+D+LRMVVAK+ELD LL+   + ++++PILFFANKMD +D+L+SV+ SQLL L+ +KD PW+I +++AL GEGLQ+GVDWL
Sbjct:    1 MGLFDKLVGWLGL-KKEVNVLCLGLDNSGKTTIINKLKPSNAQVQDIVPTIGFNIEKFKTSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSADKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDVRDALSSVKVSQLLCLDYIKDKPWHICATDALKGEGLQEGVDWL 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Match: ENSORLT00000019518.2 (ADP-ribosylation factor-like protein 6 [Source:NCBI gene;Acc:101165359])

HSP 1 Score: 215.698 bits (548), Expect = 6.809e-70
Identity = 105/177 (59.32%), Postives = 139/177 (78.53%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWL 603
            MGLLD L  + G  KKE  +L +GLDNSGK+TI+N++KP   Q  +IVPTIGF++EK  +  L+ T FDMSGQ RYR+LW HY KE  AIIFVIDSSD+LRMVV K+ELD  L+ + +  K++P+LFFANKMD +D+++SV+ SQ+L LE++KD PW+I +SNA+ GEGLQ+G+DWL
Sbjct:    1 MGLLDKLSGWLGLRKKEVNVLCLGLDNSGKSTIINQLKPANTQAQEIVPTIGFSIEKFKSSSLSFTVFDMSGQSRYRSLWEHYYKESHAIIFVIDSSDKLRMVVTKEELDTFLNHEDIRGKRIPVLFFANKMDLQDAMSSVKVSQMLCLENIKDKPWHICASNAVRGEGLQEGLDWL 177          
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Match: arl3b (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:101172287])

HSP 1 Score: 134.42 bits (337), Expect = 1.610e-38
Identity = 71/180 (39.44%), Postives = 112/180 (62.22%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIES 612
            MGLL  L K   T  +E RIL++GLDN GKTT+L ++   +  H  I PT GFN++ + ++G  L  +D+ GQ + R  W +Y +  D +I+VIDS+D+ R      EL  LL ++ ++   VP+L FANK D   +  +   ++ LNL +++D  W I S +AL+GEG+Q+G++W+ +S
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISH--ITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSG--VPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGIQEGMNWVCKS 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Match: SMESG000054828.1 (SMESG000054828.1)

HSP 1 Score: 366.311 bits (939), Expect = 1.157e-129
Identity = 192/193 (99.48%), Postives = 192/193 (99.48%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK 651
            MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAKDELDLLLSDKSMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFI SSQSRKK
Sbjct:    1 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAKDELDLLLSDKSMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFIQSSQSRKK 193          
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Match: SMESG000074427.1 (SMESG000074427.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.177e-38
Identity = 76/180 (42.22%), Postives = 109/180 (60.56%), Query Frame = 1
Query:   73 MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIES 612
            MGLLD L K    S +E RIL +GLDN+GKTT+L  +   E   + I PT GFNV+ + TKG  L  +D+ GQ R R  W +Y    D +I+VIDS+D+ R     +EL+ LL +  +A   VP+L +ANK D  ++  +   S  L+L S++D  W I   +A +GEG+QQG++W + S
Sbjct:    1 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEI--NQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAG--VPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSS 176          
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Match: SMESG000000945.1 (SMESG000000945.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.068e-35
Identity = 74/178 (41.57%), Postives = 113/178 (63.48%), Query Frame = 1
Query:  115 KKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRK 648
            KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  AK+EL  +L++  +  +   +L FANK D  +++ +   ++ L L SL+   W I S+ A SG+GL +G+DWL +     IL ++S+K
Sbjct:   15 KKEMRILMVGLDAAGKTTILYKLKLGEIVT--TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDEL--RGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQ-----ILKNRSKK 183          
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Match: SMESG000000928.1 (SMESG000000928.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.068e-35
Identity = 74/178 (41.57%), Postives = 113/178 (63.48%), Query Frame = 1
Query:  115 KKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRK 648
            KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  AK+EL  +L++  +  +   +L FANK D  +++ +   ++ L L SL+   W I S+ A SG+GL +G+DWL +     IL ++S+K
Sbjct:   15 KKEMRILMVGLDAAGKTTILYKLKLGEIVT--TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDEL--RGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQ-----ILKNRSKK 183          
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Match: SMESG000067743.1 (SMESG000067743.1)

HSP 1 Score: 125.946 bits (315), Expect = 2.071e-35
Identity = 72/176 (40.91%), Postives = 110/176 (62.50%), Query Frame = 1
Query:   91 LMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPTIGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQLRMVVAXXXXXXXXXXXXMANKKVPILFFANKMDAKDSLTSVRCSQLLNLESLKDHPWNISSSNALSGEGLQQGVDWLIESAK 618
            L + FG  KKE RIL++GLD +GKTTIL K+K  E      +PTIGFNVE +  K ++ T +D+ GQ + R LW HY +    +IFV+DS+D+ R+  A++EL  +L++  +  +   +L FANK D  +++     +  L L SL++  W I ++ A SG+GL +G+DWL  + K
Sbjct:    9 LDRLFG--KKEMRILMVGLDAAGKTTILYKLKLGEIV--TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDEL--RDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLK 178          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL62.581e-7363.28ADP ribosylation factor like GTPase 6 [Source:HGNC... [more]
ARL62.581e-7363.28ADP ribosylation factor like GTPase 6 [Source:HGNC... [more]
ARL62.581e-7363.28ADP ribosylation factor like GTPase 6 [Source:HGNC... [more]
ARL62.581e-7363.28ADP ribosylation factor like GTPase 6 [Source:HGNC... [more]
ARL65.365e-5564.23ADP ribosylation factor like GTPase 6 [Source:HGNC... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl-62.116e-4341.05ADP-ribosylation factor-like protein 6 [Source:Un... [more]
arl-36.723e-3740.44ADP-ribosylation factor-like protein 3 [Source:Un... [more]
arf-1.26.866e-3540.91ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.866e-3540.91ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.26.866e-3540.91ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl64.601e-5549.48gene:FBgn0034446 transcript:FBtr0340534[more]
Arl65.462e-5549.23gene:FBgn0034446 transcript:FBtr0086534[more]
dnd8.072e-3837.70gene:FBgn0038916 transcript:FBtr0084151[more]
Arf79F3.735e-3541.46gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F3.735e-3541.46gene:FBgn0010348 transcript:FBtr0078573[more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl64.336e-7360.53ADP-ribosylation factor-like 6 [Source:NCBI gene;A... [more]
arl62.090e-7161.58ADP-ribosylation factor-like 6 [Source:NCBI gene;A... [more]
arl62.090e-7161.58ADP-ribosylation factor-like 6 [Source:NCBI gene;A... [more]
arl62.090e-7161.58ADP-ribosylation factor-like 6 [Source:NCBI gene;A... [more]
arl3b6.210e-3839.44ADP ribosylation factor like GTPase 3b [Source:NCB... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clk11.942e-7562.30CDC like kinase 1 [Source:Xenbase;Acc:XB-GENE-6041... [more]
clk12.255e-7563.84CDC like kinase 1 [Source:Xenbase;Acc:XB-GENE-6041... [more]
ARL34.221e-3638.55ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
dmrta11.295e-3540.44DMRT like family A1 [Source:Xenbase;Acc:XB-GENE-98... [more]
arf31.466e-3440.83ADP ribosylation factor 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl65.054e-7661.66ADP-ribosylation factor-like 6 [Source:MGI Symbol;... [more]
Arl65.054e-7661.66ADP-ribosylation factor-like 6 [Source:MGI Symbol;... [more]
Arl63.744e-7564.97ADP-ribosylation factor-like 6 [Source:MGI Symbol;... [more]
Arl62.685e-5753.61ADP-ribosylation factor-like 6 [Source:MGI Symbol;... [more]
Arl5c7.944e-3740.22ADP-ribosylation factor-like 5C [Source:MGI Symbol... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88848|ARL6_MOUSE2.619e-7464.97ADP-ribosylation factor-like protein 6 OS=Mus musc... [more]
sp|Q0IIM2|ARL6_BOVIN3.962e-7462.70ADP-ribosylation factor-like protein 6 OS=Bos taur... [more]
sp|Q9H0F7|ARL6_HUMAN1.239e-7263.28ADP-ribosylation factor-like protein 6 OS=Homo sap... [more]
sp|Q5R4G5|ARL6_PONAB1.627e-7263.28ADP-ribosylation factor-like protein 6 OS=Pongo ab... [more]
sp|Q5M9P8|ARL6_DANRE1.578e-7061.58ADP-ribosylation factor-like protein 6 OS=Danio re... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433TXA51.015e-7963.21Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2T7NTD94.914e-7659.79Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V3ZX092.662e-7562.16Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9K2P17.504e-7562.64Uncharacterized protein OS=Biomphalaria glabrata O... [more]
K1PBA98.828e-7560.54ADP-ribosylation factor-like protein 6 OS=Crassost... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl61.970e-7562.11ADP ribosylation factor like GTPase 6 [Source:NCBI... [more]
arl61.373e-7461.83ADP ribosylation factor like GTPase 6 [Source:NCBI... [more]
arl62.256e-7463.84ADP ribosylation factor like GTPase 6 [Source:NCBI... [more]
arl3b6.806e-3839.44ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
arl3b3.537e-3738.80ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl86.228e-3741.62ADP-ribosylation factor-like 8 [Source:ZFIN;Acc:ZD... [more]
arl3b1.737e-3636.72ADP ribosylation factor like GTPase 3b [Source:NCB... [more]
arl13.682e-3640.34ADP-ribosylation factor-like 1 [Source:ZFIN;Acc:ZD... [more]
arf2a5.525e-3641.14ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf12.040e-3541.24ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF12.272e-3940.22ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF26.422e-3941.34ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARL11.942e-3844.00Soluble GTPase with a role in regulation of membra... [more]
ARF36.938e-3845.93Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL33.397e-2133.33ARF-like small GTPase of the RAS superfamily; requ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO338662.335e-6959.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483922.604e-3642.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421562.145e-3541.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288922.716e-3541.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372702.716e-3541.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL66.106e-7462.84ADP-ribosylation factor-like protein 6 [Source:NCB... [more]
ARL61.478e-7360.94ADP-ribosylation factor-like protein 6 [Source:NCB... [more]
ARL61.554e-7263.84ADP-ribosylation factor-like protein 6 [Source:NCB... [more]
ENSORLT00000019518.26.809e-7059.32ADP-ribosylation factor-like protein 6 [Source:NCB... [more]
arl3b1.610e-3839.44ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054828.11.157e-12999.48SMESG000054828.1[more]
SMESG000074427.11.177e-3842.22SMESG000074427.1[more]
SMESG000000945.11.068e-3541.57SMESG000000945.1[more]
SMESG000000928.11.068e-3541.57SMESG000000928.1[more]
SMESG000067743.12.071e-3540.91SMESG000067743.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014841 ID=SMED30014841|Name=ADP-ribosylation factor-like protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=860bp
CGTCAACCGATTTAAAAGTAGAAAAAATTTTCAAATTGTATTTTACTATT
GTCAAGTTTTTATTCAATTCCAATGGGTTTACTAGATTCCCTTATGAAAT
TTTTTGGAACTTCTAAAAAAGAGGCACGAATATTAGTTATTGGATTGGAC
AATAGTGGAAAAACGACGATTTTAAATAAAATTAAACCACCAGAATTTCA
ACACCATGATATTGTACCAACAATCGGTTTTAATGTTGAAAAAATCAGTA
CTAAGGGTCTTAATCTAACATGTTTTGACATGAGTGGACAAGGACGTTAC
CGTAATTTATGGGGACATTATCTAAAAGAATGTGATGCCATTATTTTTGT
CATTGATAGTTCAGATCAATTGAGAATGGTAGTAGCAAAAGACGAATTAG
ACTTGTTATTATCAGATAAAAGCATGGCAAACAAAAAAGTTCCGATTTTA
TTTTTTGCTAACAAAATGGACGCTAAAGACTCATTGACAAGTGTTCGATG
TTCACAATTATTAAATCTCGAGTCCTTAAAAGATCATCCTTGGAATATAT
CTTCGAGTAATGCTTTATCCGGTGAGGGCTTGCAACAAGGTGTTGATTGG
TTAATTGAAAGCGCGAAGCAATTCATTCTGAGCAGTCAGTCCCGCAAAAA
GTAATGGTGAAATCCTCACCGCAAATGTCTTGTTGGTGAGACAGAAATAA
TATGAATTATTTTTGATTTCATTCCTCGTATTCCGATCACATGTATATAA
TGATTTTGATAATAATAATATTCATTAAGTAAACAAATTTTATATCTGAC
TGTCAAAATTTCCAGCTCCAGATTTTGACAATGAAATAAATTTCTTTATT
TCTAGCCTGG
back to top

protein sequence of SMED30014841-orf-1

>SMED30014841-orf-1 ID=SMED30014841-orf-1|Name=SMED30014841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MGLLDSLMKFFGTSKKEARILVIGLDNSGKTTILNKIKPPEFQHHDIVPT
IGFNVEKISTKGLNLTCFDMSGQGRYRNLWGHYLKECDAIIFVIDSSDQL
RMVVAKDELDLLLSDKSMANKKVPILFFANKMDAKDSLTSVRCSQLLNLE
SLKDHPWNISSSNALSGEGLQQGVDWLIESAKQFILSSQSRKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0005543phospholipid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR041839Arl6
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006471protein ADP-ribosylation
GO:0006612protein targeting to membrane
GO:0006810transport
GO:0007265Ras protein signal transduction
GO:0007420brain development
GO:0008589regulation of smoothened signaling pathway
GO:0010842retina layer formation
GO:0015031protein transport
GO:0016055Wnt signaling pathway
GO:0030030cell projection organization
GO:0045444fat cell differentiation
GO:0046909intermembrane transport
GO:0051258protein polymerization
GO:0060271cilium morphogenesis
GO:0061512protein localization to cilium
GO:0097499protein localization to non-motile cilium
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005879axonemal microtubule
GO:0005886plasma membrane
GO:0005929cilium
GO:0005930axoneme
GO:0016020membrane
GO:0030117membrane coat
GO:0042995cell projection
GO:0060170ciliary membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 155..179
score: 18.35
coord: 76..101
score: 31.9
coord: 19..42
score: 48.04
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 6..180
e-value: 6.7E-54
score: 182.0
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 1..185
e-value: 3.0E-12
score: 56.7
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..185
e-value: 2.9E-41
score: 153.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 18..180
e-value: 5.4E-52
score: 177.7
NoneNo IPR availablePANTHERPTHR11711:SF21ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 6coord: 8..183
NoneNo IPR availablePANTHERPTHR11711ADP RIBOSYLATION FACTOR-RELATEDcoord: 8..183
NoneNo IPR availablePROSITEPS51417ARFcoord: 11..181
score: 18.919
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 16..148
e-value: 1.9E-20
score: 71.3
IPR041839ADP-ribosylation factor-like protein 6CDDcd04157Arl6coord: 20..179
e-value: 2.44411E-89
score: 256.972
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 14..182