RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30014840
Length (bp)1720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30014840) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30014840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014840SMESG000020677.1 dd_Smed_v4_14052_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014840SMESG000020677.1 dd_Smed_v6_14052_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30014840SMESG000020677.1 dd_Smed_v4_14052_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 8.876e-9
Identity = 110/511 (21.53%), Postives = 198/511 (38.75%), Query Frame = 1
Query:  262 QSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYL-DFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYV-CQTIHVEQK---------NDSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEAT-----IMISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYY-------CEKSLVQTINKNEKYFLK-RCPIMCEKMQFETNIKESKWP-DIVNISQYPYF----------------HVYLEDLVNVSKSHYLPTD----------YLQFKLNHLTDTSDF-ESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLV 1638
            Q S L+ K+  ++V    E+K ++ +  YP V+IC    +SL+         +  + F N S+N    W      +  +   F  ++R   +    D   +SH+    +  C F    C       F D +Y  C T +  Q+         N  S  F + +   + G +      +Y F +N  H+    G  V +   G++P+ + + I I     ++     I+ +   Y Y     D +   N +K          QY Y+  AC+ +  Q++I Q C C S      S L +      T+C  +     +N            ++R +       CE+   + +N +  Y L   C   C +  +  ++  S WP +   +S    F                + YLE L + S+ H    D          Y   +     + SD       RL + + DL     ++  +Y   +L+++IGG LGL++G SV+++ E+IE ++
Sbjct:   84 QLSLLVRKYLQFQVVELSEIKDSMPV-QYPSVSICNIEPISLRT--------IRRMYFNNESQNL-ITWLRFIQKFRFEQDSFMNSIRAFYENLGQDAKKLSHNLEDMLMHCRFNRELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTY-----GVYNFDNNILHSA---GVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDML---NGIK----------QYKYTFFACLQLCKQRLIIQRCGCKS------SALPEVPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVI 557          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A267EAK0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003120g1 PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.322e-24
Identity = 118/518 (22.78%), Postives = 226/518 (43.63%), Query Frame = 1
Query:  145 RHFLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVN-INIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDF-----------NPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYV-CQTIHVEQKNDSSSFFDLLEIRLVDGYFEEV--IAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQN-DKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKR----CPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLV 1638
            + F   T+ HGF+++ +GS ++  I  L++I         S+ LI+ F  +    +N E+      FV+PD++IC T+  SL+  E +     P+I   N     + + ++++     DIR F           N  +  ++K YL   N++      +  C F    CS      + D +Y  C T    +++       LL     DG    +  +  +  F+S  +  ++  G    I  KGT P ++    +      A   + L  Y  +     C ++++   LE V    KV QY YS   C     Q  + ++C C+S    +P++    +R   T+C ++ +E +  +   K+      + +  C  + +  I+K       +    CP+ C   ++E  + ++KWP+  N ++   +    +  ++ ++S    T+ L+  + HL +       F++L +       ++++E  +Y   NL S+IGG+LGL+LG S+IS  E  E  +
Sbjct:   42 KQFCESTSAHGFHKIFQGSSILHRIVWLLIIITAFSGF--SAHLISLFSRFNEGPVNTEISVYSTNFVFPDISICATSHFSLRRYERN-----PKIRSLN-----KPIKELVS-----DIRSFWDPNNESDSEINGDLLNSLKSYLHEVNITKQSQEMILHCDFAGTICSYINFTEYIDPNYFSCFTFSPRERH-------LLVGGERDGGLSVIMYVGDMMNFISEEDSLRYSKGFRAVIQEKGTRPEMLEGFYV---QEHACTYVQLG-YTEEVVLRKCAEEESLQPLEFVDRYGKVTQYRYSVRDCQVNLYQNFLNESCRCVSEILPLPAKFRNITRHNITFCHHINEERLKQSRGAKSNDSSSVREKQECHDNAINEIHKQVSAKKTKKDSYCPLKCNNTRYEMRVMQNKWPNDANETRQALWEA-TQRTMHEARSRGDSTEVLEEIMEHLKNDPYALQRFAKLTVYSHSTMGNIVRENWAYLARNLASDIGGILGLWLGVSIISTFEFFELFI 530          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A267G3Q5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003120g3 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 5.536e-24
Identity = 118/518 (22.78%), Postives = 226/518 (43.63%), Query Frame = 1
Query:  145 RHFLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVN-INIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDF-----------NPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYV-CQTIHVEQKNDSSSFFDLLEIRLVDGYFEEV--IAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQN-DKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKR----CPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLV 1638
            + F   T+ HGF+++ +GS ++  I  L++I         S+ LI+ F  +    +N E+      FV+PD++IC T+  SL+  E +     P+I   N     + + ++++     DIR F           N  +  ++K YL   N++      +  C F    CS      + D +Y  C T    +++       LL     DG    +  +  +  F+S  +  ++  G    I  KGT P ++    +      A   + L  Y  +     C ++++   LE V    KV QY YS   C     Q  + ++C C+S    +P++    +R   T+C ++ +E +  +   K+      + +  C  + +  I+K       +    CP+ C   ++E  + ++KWP+  N ++   +    +  ++ ++S    T+ L+  + HL +       F++L +       ++++E  +Y   NL S+IGG+LGL+LG S+IS  E  E  +
Sbjct:   42 KQFCESTSAHGFHKIFQGSSILHRIVWLLIIITAFSGF--SAHLISLFSRFNEGPVNTEISVYSTNFVFPDISICATSHFSLRRYERN-----PKIRSLN-----KPIKELVS-----DIRSFWDPNNESDSEINGDLLNSLKSYLHEVNITKQSQEMILHCDFAGTICSYINFTEYIDPNYFSCFTFSPRERH-------LLVGGERDGGLSVIMYVGDMMNFISEEDSLRYSKGFRAVIHEKGTRPEMLEGFYV---QEHACTYVQLG-YTEEVVLRKCAEEESLQPLEFVDRYGKVTQYRYSVRDCQVNLYQNFLNESCRCVSEILPLPAKFRNITRHNITFCHHINEERLKQSRGAKSNDSSSVREKQECHDNAINEIHKQVSAKKTKKDSYCPLKCNNTRYEMRVMQNKWPNDANETRQALWEA-TQRTMHEARSRGDSTEVLEEIMEHLKNDPYALQRFAKLTVYSHSTMGNIVRENWAYLARNLASDIGGILGLWLGVSIISTFEFFELFI 530          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1I8I9S9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.770e-18
Identity = 128/557 (22.98%), Postives = 242/557 (43.45%), Query Frame = 1
Query:  148 HFLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQ----LSLQLNEPHFS----NYLPEISFENASRNAQKVWQIITNDYT--------KDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYD-YVCQTIHVEQK-----NDSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYE-YQTEKTDCIKKDNAVKLEIVQNDKVIQ-YNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYL------PKEMILNNEQ--------IKNF-----PVHI------YKNRYYCE-KSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHY-------LPTDYLQ-FKLNHLTDTSDFEST---FSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWL 1635
             F + TT HGF  + + S  +R++W L+++    G  +  S L+ K+ +Y   +  E++ +   F +PDVT+C TT+    L++ + +P       + +P +   N        W  + N +T        KD      +  G M+ Y    N+++ +        +     + + ++ ++D + + C T+  + +     ND+        + L+   F++ I      L +     +V G  V++      PNL+ N  I+         +S+++ E  +T K DC +  N + ++++  D  +  Y Y+   C  +E Q+ + + C C+S   L+P++    S  +  YC  L       K++ L N          ++ F     P+ +      ++ ++ C  K+L   +   E      CP  C    ++    ES WP    I QY     + E ++N+ +S Y       LP    + F+      + D+      F+R+ +    LR +  QE  SY    L+S +GG+LGLY+G SVIS+CE +E+L
Sbjct:   40 EFFVTTTAHGFLHIVQNSIYLRIVWALLIVIAFGGFGLHLSTLVEKYLSYP--LTTEIRYSEVEFEFPDVTVCLTTKYRHCLNIDVRDPRIGLVTNSTVPSLGNYN-------FWSALNNTFTFWKQAYGLKDDLLIKYSTVG-MRSYTYEINITNRRTDIATGIEYKQKALNLDNVVAYDDPELFRCATVRPKNRAINSVNDA--------MGLILSIFDQYIGNKTTPLIDRA---WVAGVRVTLSEPNARPNLI-NSFIVPPGTIKHTKVSMTRQEKRKTPKQDCYESSNDLPIQVLNPDGTLSSYRYTQSDCRELELQKYVMRKCGCVSNFKLVPAEFKSLSGSL-KYCLDLDPTILKAKKIFLANSSSNGSQTLLVEKFDSSVVPMELILAQTGFRAQHECHLKALGDFVASAET-----CPPSCVAYTYQAYSSESLWP--FQIDQY-----FAERILNLFQSAYNYSLEKGLPVPLFKCFEAGATITSRDYWKMIGYFNRVVISSNSLRGTQYQEKESYPLAGLFSNMGGILGLYVGVSVISVCEFLEFL 561          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1I8IIE8 (RRM domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.361e-18
Identity = 120/517 (23.21%), Postives = 213/517 (41.20%), Query Frame = 1
Query:  145 RHFLLYTTGHGFYRVCEGSK--LVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTT---QLSLQLNEPHFSNYLPE--ISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYV-CQTIHVEQKNDSSSFFDLLEIRLVDGYFEEV--IAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQN-DKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILN--NEQIKNFPV------HIYKNRYYCEKSLVQTINKNEKYFLKR-CPIMCEKMQFETNIKESKWPDIVN-ISQYPYFHVYLEDLVNVSKSHYLPTDY-LQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIE 1629
            R F   T+ HGF+++ E  +  L R  WL I++    G       L +++    VN    +      FV+PDVTIC T+   +L  Q N P     +P   IS      + +  W    N  T      N  V  ++K YL   N++  +   +  C F    CS     L+ D +Y  C T    +++       L+     DG    +  +  +  F++  E   +  G    I   GT P L+     + ++    + +    Y  +    +C    N   ++ V   +++ +Y Y+   C+    Q  +   C C+S    +P+ L   S     +C  + +E ++   ++Q               ++R  C  S+V  I+K         CP+ C+ +++E    +++WP   N  SQ     V     +   +   L T   +Q +++       F  +F++L +       SV++E+ +Y   NL S+IGG+LGL+LG S+IS  E +E
Sbjct:   28 RQFCDSTSAHGFHKIVENGEGALHRAAWLFIILAAGAGFTAHLFALFSRYLERPVNTETSVYGTK--FVFPDVTICATSHFSRLRYQQNPP-----VPSLNISTHELLHHIRTFWDPGENADTNI--SINADVMHSIKSYLRELNITKQRQEMILHCDFAGDSCSYRNFSLYVDPNYFSCYTFAPTERH-------LIVGGERDGGLNVIMYVGDVKNFITGEESLSYSEGFRAVIHEPGTRPELLEG-FYVQRDTSTYVQLG---YTEEVVLKNCSLDANFQTVKFVDRYNRITEYRYTIRDCLVNTYQTYLRTNCSCVSEALPLPANL--NSNLSVPFCHSISRESLMESIDQQAATEAEAAIERNQAAEHRRACHDSVVSEIHKKTSGLAPDVCPLRCKNVRYEMRFTQNRWPSACNETSQALAEAVERTIALAAEQGDDLTTLVEIQRRMSDEHREPAFRESFAKLTIYTHSTMGSVMRESWAYPDRNLASDIGGILGLWLGVSIISTFEFLE 522          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1I8I5M1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.079e-14
Identity = 70/251 (27.89%), Postives = 115/251 (45.82%), Query Frame = 1
Query: 1021 CINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILN-----NEQIKNFPVHIYKNR---YY----------------CEKSL------VQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLR-LRILDLRP-----SVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSIYILILG 1665
            C+    Q     TC C+     +PS LL      T  C  LP+EM++N          NF  +I KN+   YY                  +SL      V   +K +    K CP+ C  +++  +   + WP  VN++         ++L  +S      TD L+ +L H+ D  ++  TF+ ++ L +LDL P     SV  E+ +Y   NL+S++GG+LGL++G SV++L E +E L+    ++  G
Sbjct:   54 CVIRRMQTDYKSTCGCLGTHLPLPSDLLNG----TGVCHRLPEEMLINYNINYRTNKNNFTEYIIKNKTHSYYPLTDYLQANWETLDFNLSRSLFKCYHRVLRRHKTQGVSDKHCPVRCTNVRYRDHTTVTSWPTDVNLASEIVRGYVKDNLDQISG-----TDLLKDRLQHMYDNPNY--TFNEVQSLSVLDLYPMSVKTSVFTESFAYPLRNLFSDLGGILGLWIGVSVVTLIEFLELLIQMAQLITKG 293          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO36191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB5])

HSP 1 Score: 53.5286 bits (127), Expect = 1.542e-7
Identity = 39/139 (28.06%), Postives = 61/139 (43.88%), Query Frame = 1
Query: 1267 KRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSIYIL---ILGKTR 1674
            K CP  C    F   I +++W D         +    + LV  S   +          N + D S     F R++L   +L    +  +LSY   NL  ++GG LGL++G SVI+  E ++ LV   + L   + GKT+
Sbjct:  346 KSCPQPCTHYSFRRTISQTQWSD--------SYEKTFQRLVRKSDRGFA---------NKMNDASILRKNFLRVKLYYEELNRETITYSLSYPVENLLGDVGGQLGLWIGVSVITCAEFLKLLVDLAWYLASKMSGKTK 467          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 51.2174 bits (121), Expect = 8.445e-7
Identity = 30/123 (24.39%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 1267 KRCPIMCEKMQFETNIKESKWPD-IVNISQYPYF-HVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIE 1629
            + CP  C ++ F+  +  ++WP     +++Y YF  V + + +  S S Y                       +++ +   +L   ++QETL+Y  ++L S+IGG +G+++G S ++  E+IE
Sbjct:  377 RECPPSCSEVSFDLTVSSARWPARSFEVTKYAYFLRVRVLNKIASSSSKYFVNS----------------ENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIE 483          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO37667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF92])

HSP 1 Score: 50.8322 bits (120), Expect = 9.429e-7
Identity = 34/136 (25.00%), Postives = 64/136 (47.06%), Query Frame = 1
Query: 1267 KRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSIYILILGKTR 1674
            ++C   C +  F+ +I  ++WP          +  +  D +   K   LP +            +D  + F +L++   +L   V++E  SY+ +N  S+IGG LGL++G S ++  E++E L+     L+   TR
Sbjct:  118 EKCRPPCNEEVFKLSISSARWP-------TDDYEAHFLDELKEDKGFVLPAN------------ADARAYFVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLIVIALHLLRKVTR 234          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO37452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR0])

HSP 1 Score: 49.6766 bits (117), Expect = 3.036e-6
Identity = 31/124 (25.00%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 1267 KRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLV 1638
            ++C   C +  F+ +I  ++WP          +  +  D +   K   LP +            +D  + F +L++   +L   V++E  SY+ +N  S+IGG LGL++G S ++  E++E L+
Sbjct: 1011 EKCRPPCNEEVFKLSISSARWP-------TDDYEAHFLDELKEDKGFVLPAN------------ADARAYFVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLI 1115          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000020676.1 (SMESG000020676.1)

HSP 1 Score: 459.144 bits (1180), Expect = 4.662e-161
Identity = 239/241 (99.17%), Postives = 239/241 (99.17%), Query Frame = 1
Query:  130 MISPTRHFLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYVCQTIHVEQKNDSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLM 852
            MISPTRHFLLYTTGHGFYRVCEGSKLVRVIWLLILIGCIIGCVIQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETI LFNDYDYVCQTIHVEQK DSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLM
Sbjct:    1 MISPTRHFLLYTTGHGFYRVCEGSKLVRVIWLLILIGCIIGCVIQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFFGPYECSTETITLFNDYDYVCQTIHVEQKKDSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLM 241          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000020677.1 (SMESG000020677.1)

HSP 1 Score: 392.119 bits (1006), Expect = 3.061e-135
Identity = 191/192 (99.48%), Postives = 192/192 (100.00%), Query Frame = 1
Query:  895 MISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFE 1470
            MISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLK+CPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFE
Sbjct:    1 MISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKKCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFE 192          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000013072.1 (SMESG000013072.1)

HSP 1 Score: 110.538 bits (275), Expect = 2.386e-25
Identity = 126/543 (23.20%), Postives = 242/543 (44.57%), Query Frame = 1
Query:  151 FLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNY------------LPEISFENASRNAQKVWQIIT--NDYTKDIR--------DFNPTVRGT----MKPYLDFSNVSHHQYSFMAKCFFGPYECSTETIMLFNDYDYVCQTIHVEQKNDSSSFFDLLEIRLV--DGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQ-------IKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSIYILILGKTR 1674
            F L T  HGF++V E +K++R+IW+ I+   + G +     L+ +  A  +N  +E+KS  + F  PDVTICP  +     +E   +NY            L  ISF      +  +W I+    D  K  R        + N  +RG     +K      NVS +++ F+ +     + C     ++F   D   +T+     N+    F ++ I ++  D  +E +      F S++E  Q   G+ + I    T+P     ++I+ ++N   + I  ++Y        C  ++N   L I Q++K+ ++ Y+   C+N+  Q  IY+ C+C+S    +P ++     +    C  +  E+I N+ +       ++       +  + C    + + N + +  +  CP+ C+ + F  ++      DIV   Q   F    E +   + S  +PT  ++   N      +F      + L     + ++++ETL YQ    +S++GG +GL++GF++I+L +++E L+  +  LI    R
Sbjct:   39 FCLKTNAHGFFKVIEDTKIMRIIWICIMCVTVSGLLALIVVLLERLLASNLNAEVEIKSKHE-FSMPDVTICPKQRFFF-YDEKLLTNYIIPAFTPSDIAVLNNISFYQYFIQSSLIWNILGFEADANKLGRYSILQISQNLN-LLRGPNDILVKTNYLTRNVSSNEFHFLMRP--DGFRC-----LIFRPNDRNIKTL-----NEIPDLFLIILIPMIGNDDIYESI------FQSSSEVEQMRSGSSIFIHPPMTLPEFETQELIVPRDNLLQLAIERNEYYLYEINNKC--QNNNSPLRIRQSEKISEFLYTQSGCLNLRKQLYIYRNCNCVSEILFLPEEI----PETVIPCHQISVELISNSFKDNYTAWLVQQPSARSLQLNHQCHDKFLLSFNSDNE--INNCPVPCDSVTFTYDVSLLNIKDIVPQFQPLIFEAASEVIAKFANST-VPTGQVENLYN-----IEFSMKLGFMSLLPKSFKITIMKETLVYQLGQFFSDVGGSMGLFVGFTIITLFDLMELLIFILEFLIFDFRR 546          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000019202.1 (SMESG000019202.1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.924e-20
Identity = 129/535 (24.11%), Postives = 240/535 (44.86%), Query Frame = 1
Query:  145 RHFLLYTTGHGFYRVCEGSKLVRXXXXXXXXXXXXXXXXQSSFLINKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYL-PEIS-------FENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCF----------------FGPYECSTETIMLFNDYD-YVCQTIHVEQKNDSSSFFDLLEIRLVDGYFEEVIAQIY-KFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMI--LNNEQIKNFP------VHIYKNRYYCEKSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTFSRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSI 1647
            + F  +T+GHGF ++ E ++LVR+IW+LI++   IG V+    LI ++F Y VN +     +  L V PD+TICP  +     + P F++ L P+ +       F         +W  IT +                      S++++ +YS M + +                F   + S + +     +D +VC T     +  +S       + + + ++   + Q   +  S NE T   PG+ + +    T+PN   +  ++ ++       + +K   +   + C  K N + ++    +++  Y YS   C+  +  ++IY+TC+C S + LI S ++    D  ++C  +   +   LNN  I   P      +   K  Y C K+ +  + +NEK F + C   C +  +   +  SK    + I     ++  + +++ + +      + ++   N+   T DF+ T S+   + L +   V +E+LSY   NL S+IGG+LGLYLGFSV+S+ E+ E  V  I
Sbjct:   40 KSFCKHTSGHGFAKIVESTRLVRLIWILIMMLTFIGLVVHFILLILRYFDYGVNSSFYTTPDNQL-VMPDITICPNQRFYFFESSPLFNSSLTPDTTEIYKGTTFAELFSRYVDIWTPITGN---------------------ISSITYARYSIMRQAYSIKRLRGKNDIIIKINFKKIQISVDKLFATPTFDSFVCVTFKPPSRVLNSLSDSDATVIITNMFYVGALDQFENQMKSPNEITD--PGSTLYMHSPNTMPNFKSDGHMVYRSLVKQFSFNQAKIIRENSGSVCFDKPNDIVIKGYGLNEMNTYTYSQSLCVETKKSEMIYKTCNCRS-ELLIASSVIP---DSASFCHEISSLLSTKLNNSFIMLNPKDNTDVIANLKKNYLCHKTQISLL-ENEK-FPETCLPACVESTYRYEVSSSKLERQL-IGFKGVYNESINEIIPLLQQENKSVEVIKAAANYELLT-DFKFTVSKFIPKQLTVE--VTEESLSYPIENLLSDIGGILGLYLGFSVMSMLEIAELFVQLI 540          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000053471.1 (SMESG000053471.1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.833e-10
Identity = 105/460 (22.83%), Postives = 182/460 (39.57%), Query Frame = 1
Query:  307 INIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLP----EISFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYSFMAKCFF-GPYECSTETIMLFNDYDYVCQTIHVEQKNDSSSFFDLLEIRLVDGYFEEVIAQIYKFLSNNEHTQFVP-GTLVSIDLK--GTIPNLMRNKIIITKNNEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACINIETQQIIYQTCDCISRKYLIPSQLLK-KSRDITTYCQYLPKEMILNNEQIKNFPVHIYKNRYYCEKSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKWPDIVNI-SQYPYFHVYLEDLVNVSKSHYLPTDYLQ-FKLNHLTDTSDFESTFSRLRLRILDLRPSVL--QETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIEWLVSSI 1647
            I+ ++K +  +  YP +TIC      +Q    +FSN +P    +++F        + W    N       D       ++ P  D + V       + KCF    Y+C      +F   +  C + +V     +S               +  I   Y FL       F+   T +++ L   GT PN +  + +    N+  + I+   YE    +  C      +K+    ND+++ + YS   C  I TQ+II+ TC+CIS    IP+        ++  YC  +   ++       N  V     R  C   L+  ++ +       CP  C         + S+      +   +   + YL+   N +K      D    FKL  L D +    T + L++ I D  P VL  +   ++  +   SEIGG++GLY+G+S I++ E+I + V  I
Sbjct:   62 ISTKIKYDFQIDTYPSITICYNMPFFIQ----NFSNPVPRFNSKMNFSVVDMLTMEFWDRNLNLINVPYGDLFKIYFHSIIPLADKAAVLVDPRIPLVKCFMDNEYDCRVSFSKVFIYENRPCISGNVSMPKITS--------------IKIAIFWPYSFLYPINSNPFINYNTFLAVYLHPLGTYPNGLALEAV---KNQYFLNIN---YELSYNRLVCNDVFEDIKVLSRLNDEILTFTYSKSLCDQISTQRIIFATCNCISETLPIPNDFYGIVYNNVDNYCHAIWGGLL----DASNSTVESIIERVKCHDKLINNMSYS-------CPQKCNYYDVSVFSQYSQLKTTTEVLKNFVNLYNYLKSTNNTNKKQRQFFDSQSYFKL--LNDLNINSPTEAFLQIGI-DYSPEVLMFESRNAFDKMAFLSEIGGIMGLYMGWSAITVIEIIVFFVELI 483          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP8.876e-921.53FMRFamide-activated amiloride-sensitive sodium cha... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EAK04.322e-2422.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G3Q55.536e-2422.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I9S91.770e-1822.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IIE82.361e-1823.21RRM domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8I5M13.079e-1427.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO361911.542e-728.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421378.445e-724.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376679.429e-725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374523.036e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020676.14.662e-16199.17SMESG000020676.1[more]
SMESG000020677.13.061e-13599.48SMESG000020677.1[more]
SMESG000013072.12.386e-2523.20SMESG000013072.1[more]
SMESG000019202.12.924e-2024.11SMESG000019202.1[more]
SMESG000053471.14.833e-1022.83SMESG000053471.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014840 ID=SMED30014840|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1720bp
TTACAAAGTTTTTATTAAAAACATATTTTGACATTTAAATATTTATTTAA
AATGTCTGAAAACTGACTGGATATGTATGACTATTTATGGGGTATTTAAA
ATTTTACATCTATTAGTTTTTAGGCCAAAATGATTTCTCCAACTAGACAT
TTTTTACTCTACACTACGGGACATGGGTTTTATAGGGTTTGTGAAGGTTC
AAAATTGGTCCGAGTCATTTGGTTATTAATTTTGATCGGTTGCATAATCG
GTTGCGTTATCCAAAGTTCTTTTTTAATCAACAAATTTTTCGCCTATAAA
GTTAACATAAACATTGAATTAAAAAGCAATTTGGATTTGTTTGTTTATCC
GGACGTGACAATCTGTCCGACAACTCAATTGAGCCTACAATTAAATGAAC
CGCATTTTTCCAATTATTTGCCAGAAATATCATTTGAAAATGCTTCGAGA
AATGCACAGAAGGTTTGGCAGATTATTACAAATGATTACACGAAAGACAT
AAGGGATTTCAATCCGACAGTTCGAGGTACAATGAAACCCTACCTTGACT
TTTCTAATGTGTCTCATCACCAGTATAGTTTCATGGCAAAATGTTTTTTC
GGCCCCTACGAATGTTCAACGGAAACAATCATGTTATTCAATGATTATGA
TTATGTCTGTCAAACAATACATGTTGAACAGAAAAATGATTCTTCATCCT
TTTTTGATCTTTTAGAAATCAGACTTGTTGATGGGTACTTTGAAGAAGTT
ATTGCTCAAATATATAAATTCTTAAGTAACAATGAGCATACTCAATTTGT
TCCTGGAACATTGGTGAGCATAGATTTAAAAGGAACGATTCCAAATTTAA
TGAGAAATAAGATAATTATTACCAAAAATAATGAAGCAACAATCATGATT
AGCCTCAGTAAATATGAATATCAAACAGAAAAAACCGATTGTATTAAAAA
AGATAATGCTGTGAAATTAGAAATTGTTCAAAACGATAAAGTAATTCAAT
ATAATTATTCTGATGATGCTTGCATAAATATCGAAACTCAACAAATCATT
TATCAAACATGCGATTGTATTTCTAGAAAATATTTAATCCCATCGCAATT
ATTAAAGAAATCACGAGATATTACAACTTATTGTCAATATCTTCCAAAGG
AAATGATTTTAAATAATGAACAAATTAAAAATTTCCCGGTACATATTTAC
AAGAATCGATACTATTGTGAAAAGTCTCTAGTGCAAACTATTAATAAAAA
TGAAAAATATTTTTTGAAGAGGTGTCCAATAATGTGTGAAAAAATGCAGT
TTGAAACTAATATAAAAGAATCAAAATGGCCGGATATAGTGAACATAAGT
CAATATCCATATTTTCATGTTTATTTAGAGGATTTGGTAAATGTTTCTAA
ATCGCATTATTTGCCAACGGATTATTTACAGTTCAAATTAAATCATTTAA
CTGATACCAGTGATTTTGAAAGTACGTTTTCCAGATTGCGTCTTCGAATT
TTGGATTTAAGACCCTCGGTTTTGCAGGAAACGCTTTCCTATCAACCAAT
TAATTTGTGGTCTGAAATCGGTGGTCTTTTGGGATTATATTTGGGATTTA
GTGTTATAAGTTTGTGTGAAGTTATTGAATGGCTTGTAAGTTCTATTTAT
ATTTTAATACTAGGAAAGACTCGTTGATAAACTTGAGAAAAAAAATCTTC
AATTGATGTTGATATGTGGC
back to top

protein sequence of SMED30014840-orf-1

>SMED30014840-orf-1 ID=SMED30014840-orf-1|Name=SMED30014840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MISPTRHFLLYTTGHGFYRVCEGSKLVRVIWLLILIGCIIGCVIQSSFLI
NKFFAYKVNINIELKSNLDLFVYPDVTICPTTQLSLQLNEPHFSNYLPEI
SFENASRNAQKVWQIITNDYTKDIRDFNPTVRGTMKPYLDFSNVSHHQYS
FMAKCFFGPYECSTETIMLFNDYDYVCQTIHVEQKNDSSSFFDLLEIRLV
DGYFEEVIAQIYKFLSNNEHTQFVPGTLVSIDLKGTIPNLMRNKIIITKN
NEATIMISLSKYEYQTEKTDCIKKDNAVKLEIVQNDKVIQYNYSDDACIN
IETQQIIYQTCDCISRKYLIPSQLLKKSRDITTYCQYLPKEMILNNEQIK
NFPVHIYKNRYYCEKSLVQTINKNEKYFLKRCPIMCEKMQFETNIKESKW
PDIVNISQYPYFHVYLEDLVNVSKSHYLPTDYLQFKLNHLTDTSDFESTF
SRLRLRILDLRPSVLQETLSYQPINLWSEIGGLLGLYLGFSVISLCEVIE
WLVSSIYILILGKTR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0005272sodium channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
IPR011528NERD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 467..481
score: 31.2
coord: 152..163
score: 30.33
coord: 481..497
score: 50.59
coord: 69..85
score: 28.47
coord: 28..45
score: 21.33
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 8..500
e-value: 2.5E-51
score: 175.1
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 11..506
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 264..386
e-value: 1.4E-37
score: 131.6
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 82..226
e-value: 1.4E-37
score: 131.6
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 58..469
e-value: 1.4E-37
score: 131.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 28..499
e-value: 1.4E-37
score: 131.6
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 489..511