DNA replication ATP-dependent helicase/nuclease DNA2

Overview
NameDNA replication ATP-dependent helicase/nuclease DNA2
Smed IDSMED30014833
Length (bp)3605
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30014833) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30014833) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30014833) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA replication ATP-dependent helicase/nuclease DNA2 (SMED30014833) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014833

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014833h1SMcG0014356 SmedASXL_017139SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30014833h1SMcG0014356 dd_Smed_v4_12638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014833h1SMcG0014356 dd_Smed_v4_12638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014833h1SMcG0014356 dd_Smed_v4_12638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014833h1SMcG0014356 dd_Smed_v4_12638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 403.675 bits (1036), Expect = 1.484e-121
Identity = 318/977 (32.55%), Postives = 492/977 (50.36%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQA---MKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIV------QNSKKSIRN-VTFESSSL-SGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS------ELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQII 3381
            W    V  GDI  +     S+  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+          +++E+A +  ++   L   Y    + +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+ S +   + + GLLLY+K G + +    N       +K+RN++     + I K  + Q T    LP +I   + C+ C  +  C ++SR  +   DCS     M   I++ T HL +   E+F  W  ++ LE  S+ + +N  +NI +      + S   I N +  E   +     +L  F       P    + GD +IVS ++    A+  GYV E   T +  +      +  + T  R+D    N  +  P+ NLS    LM+ + + +KLRD I+  + P F  +++  L    K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V   ++  T   I   K  ++L     L  +  +V  TC+  NH   SR  FD  I+DEA QI+ P+ + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L +  +  ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A I + H  +    LEF+     +       E +  V FLN      P  VE   +  N  EAK+ + L   F+K G   SDIG+I PY QQ ++I ++   S   VE+NT+D+YQGRDKSIV++SFV  +       +     +L D RRLNVAI+RAKHKLI++G +  L+  Y P++ + + L + ++I
Sbjct:   86 WCSVPVEPGDIIHLEGDCTSDT-WIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAIN-NSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNH-QNIWLMPASEMEKSGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQPICLGPLF----FSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQ--NKSAVVQLTVQYRMNSKIMSLSNKLTYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVS-NVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVSFVRSNK------DGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLN-CYPPLEKLLNHLNSEKLI 1039          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 214.157 bits (544), Expect = 1.111e-57
Identity = 170/587 (28.96%), Postives = 277/587 (47.19%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQA---MKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNII------VQNSKKSIRN-VTFESSSL-SGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIR 2259
            W    V  GDI  +     S+  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+          +++E+A +  ++   L   Y    + +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+ S +   + + GLLLY+K G + +    N       +K+RN++     + I K  + Q T    LP +I   + C+ C  +  C ++SR  +   DCS     M   I++ T HL +   E+F  W  ++ LE  S+ + +N  +NI       ++ S   I N +  E   +     +L  F       P    + GD +IVS ++    A+  GYV E   T +  +      +  + T  R+D    N  +  P+ NLS    LM+ + + +KLRD I+  + P F  +++  L    K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++R
Sbjct:   86 WCSVPVEPGDIIHLEGDCTSDT-WIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAIN-NSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNH-QNIWLMPASEMEKSGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVR 663          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 214.157 bits (544), Expect = 1.111e-57
Identity = 170/587 (28.96%), Postives = 277/587 (47.19%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQA---MKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNII------VQNSKKSIRN-VTFESSSL-SGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIR 2259
            W    V  GDI  +     S+  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+          +++E+A +  ++   L   Y    + +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+ S +   + + GLLLY+K G + +    N       +K+RN++     + I K  + Q T    LP +I   + C+ C  +  C ++SR  +   DCS     M   I++ T HL +   E+F  W  ++ LE  S+ + +N  +NI       ++ S   I N +  E   +     +L  F       P    + GD +IVS ++    A+  GYV E   T +  +      +  + T  R+D    N  +  P+ NLS    LM+ + + +KLRD I+  + P F  +++  L    K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++R
Sbjct:   86 WCSVPVEPGDIIHLEGDCTSDT-WIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAIN-NSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNH-QNIWLMPASEMEKSGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVR 663          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 211.075 bits (536), Expect = 1.320e-55
Identity = 169/586 (28.84%), Postives = 276/586 (47.10%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQA---MKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIV------QNSKKSIRN-VTFESSSL-SGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMI 2256
            W    V  GDI  +     S+  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+          +++E+A +  ++   L   Y    + +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+ S +   + + GLLLY+K G + +    N       +K+RN++     + I K  + Q T    LP +I   + C+ C  +  C ++SR  +   DCS     M   I++ T HL +   E+F  W  ++ LE  S+ + +N  +NI +      + S   I N +  E   +     +L  F       P    + GD +IVS ++    A+  GYV E   T +  +      +  + T  R+D    N  +  P+ NLS    LM+ + + +KLRD I+  + P F  +++  L    K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++
Sbjct:   86 WCSVPVEPGDIIHLEGDCTSDT-WIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAIN-NSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNH-QNIWLMPASEMEKSGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLV 662          

HSP 2 Score: 80.1073 bits (196), Expect = 1.995e-14
Identity = 59/136 (43.38%), Postives = 88/136 (64.71%), Query Frame = 1
Query: 2989 NKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
            N  EAK+ + L   F+K G   SDIG+I PY QQ ++I ++   S   VE+NT+D+YQGRDKSIV++SFV  +       +     +L D RRLNVAI+RAKHKLI++G +  L+  Y P++ + + L + ++IS+
Sbjct:  675 NVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVSFVRSNK------DGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLN-CYPPLEKLLNHLNSEKLISL 803          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 179.104 bits (453), Expect = 1.523e-48
Identity = 143/375 (38.13%), Postives = 207/375 (55.20%), Query Frame = 1
Query: 2308 SAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSSEL------DRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            SAV NIL KL   +I FL L     V   ++  T   I   K  ++L     L  +  +V  TC+  NH   SR  FD  I+DEA QI+ P+ + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L +  +  ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A I + H  +    LEF+     +  L      +  V FLN      P  VE   +  N  EAK+ + L   F+K G   SDIG+I PY QQ ++I ++   S   VE+NT+D+YQGRDKSIV++SFV  +   G   E     +L D RRLNVAI+RAKHKLI++G +  L+  Y P++ + + L + ++IS
Sbjct:    2 SAVDNILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQPICLGPLF----FSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQ--NKSAVVQLTVQYRMNSKIMSLSNKLTYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVS-NVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVSFVRSNKD-GTVGE-----LLKDWRRLNVAITRAKHKLILLGCVPSLN-CYPPLEKLLNHLNSEKLIS 362          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: dna-2 (Yeast DNA helicase/endonuclease family [Source:UniProtKB/TrEMBL;Acc:Q9U3F2])

HSP 1 Score: 342.813 bits (878), Expect = 5.543e-100
Identity = 282/945 (29.84%), Postives = 472/945 (49.95%), Query Frame = 1
Query:  643 LHLDGMWEDTVVHVGDICSIVDPIK-SNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQ-PSQLITFYESGWTDEEILREIEVYFPRILKWINRNL--------SKKPEISK---MQVIDVEENIWSTKYGIKGKIDVTLQTNE--STIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK---KSIRNVTFESSSLSGIN-------------------FLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVE-SPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLF--DCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREI---NFLYLNGNHSVCEKLKNRTLSYILPEKKFENLF-NFHNLIENIDVVGVTCLSANHAAL-SRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEHESINSLEFWK---CQCCSSELDRSVIFLNYQPSF-----VEADE--IYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN-MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIG 3306
            ++L   W +  +  G   +++      +  + +N+  GI+++NP  LV  T+V  + FC RK VL   F      SNKAM++G+ +H IFQ     +   + E  ++ K  +KQ P          +T   +  E++ YF  I  WIN++          ++P  SK   ++V D+EENIW +K G+KGKIDVT++T        LELKTG+++ S EHT QVLLY +M S + E  I  G +LY+KDGA   +    +  ++  ++ RN+L+   + F     +N   LP    + R C  C++ ++C+ + +  +N S  +  MK+  ++   HL +   E+  +WI  I  E+  E       + +  QN     KS++    E + LS ++                   FL   N P      F  GD  ++S  + K +AI    + E S    I+ IS++K +         +D  +S+    + L  L  L+   EIG++LR+ +V   PP+         + A+K   I    N +QR+ ++ A+ ++D+++++G PGSGKT+ I  +I+  V    KVL++++THSAV NIL KL  +E+     L L  + S+ + +K  TL   L  +  E  +     +++   +V  TC       L S   FDVVI+DEA  +  P+ +     +     KF+L GD  QL PLV +  A+  G   S   KL + +HP  +  L  QYRMN EI  L + + Y N++ C  + V+ +++    + I +++       +  S ++  S +FL+ Q +       E  E     N  EAK+  EL +QF+  G    +IGV+  Y +Q + IR  +++ E+E+NTID YQGR+K ++I S    ++   K+       +L D+RR+NVA++RA+ KL+++G
Sbjct:  131 VYLQDHWSEMSIEAGSTINLIGAQAWGDRDFLVNDDVGIVILNPDALVPCTAVASATFCARKTVLNDKFK-FGNASNKAMLLGTIMHEIFQTAITSKKRPVME-NDLMKIWNKQAPKYAEELVALSFTPSCLDAELQPYFSIICGWINKHYPLSNSFFSKREPLPSKSELLEVYDIEENIWDSKLGLKGKIDVTMRTKSRGGMESLELKTGKSSCSSEHTGQVLLYCMMQSSRYEQPIGPGNILYLKDGASHCV-TPRAADLLGVLQQRNKLS---VHFEDPTTSN---LPDPRQDSRFCDKCDHKTMCSFYQKTEENFSKSNDKMKNFAENEMAHLEQNHIEYAANWIRWISAEWKCER------ERMTSQNKDLWLKSVQERVEEGTCLSDLHPVSEEMSNSQKIIISFSRKFLKSSNTPT-----FRPGDVCLLS--NKKHIAIGFALIDEVSDDQQIVKISTDKTIKSRYEAPFHLDKYTSMSTHSTTLGNLVYLLQNDEIGKRLRNILVDLLPPIIMDATGFNLTPAIKKIIIKAKLNNEQRKAVVHALATEDFMMVEGLPGSGKTTLISVLIQCLVATNKKVLLAAFTHSAVDNILTKL-TKEVAAEKILRLGSSSSIKDDIKKMTLKAKLENETSEEYYAAVRKVMKTTPIVACTCHHVPRELLFSYRHFDVVIVDEASMVLEPLLLP----VLATSNKFVLVGDCKQLTPLVVSRKAKQEGAGISTMEKL-QQSHPGVVVSLTSQYRMNREISVLSSKLFYENRLICGNESVSRSSLDRTGDYIVAMDDGSDHIRKALSGDIKDSCVFLDTQSTINSKMQCEDGEGGGMCNDGEAKLISELCQQFVMSGVKPHEIGVMSAYRRQVDHIRGILNSDELEVNTIDSYQGREKRVIIWSLTWTNNSTKKS------ELLKDERRVNVALTRARQKLVVVG 1041          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 117.087 bits (292), Expect = 3.491e-26
Identity = 127/432 (29.40%), Postives = 196/432 (45.37%), Query Frame = 1
Query: 2182 IFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGM---KVLVSSYTHSAVSNILQKL---------------DAREINFLYLNGNHSV-----CEKLKNRTLSYILPEKKFENLFNF--------HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLP---VSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYN----NQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN-MSTM---------EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            + ++   LI+G PG+GKT  +V+   ++ L+      VLV S ++ AV ++ +K+               +  E    YL   H +      E  K   L     E +F++   +        H L+   DV+  TC SA  A LS+++   V+IDE+ Q T P   VSIM  ++      + +L GD  QL P+V    A I GL QSLF +L      P     L++QYRM+  + +  + + Y+    N +T     +        +      FW C   S EL  S                + N+ EA    +LV + +K G     IGVI PY  Q+  I N M T           VEI ++D +QGR+K  +I++ V  +D LG          L+D RRLNVAI+RAK+ L+++GN   L+++
Sbjct:  457 VLTRPLSLIQGPPGTGKT--VVSATIVYHLVQKTEGNVLVCSPSNIAVDHLAEKIHKTGLKVVRLCARSREHSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILVSIMRGVR------QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRP---FRLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHWPKPNKPAFFWHC-SGSEELSASGTS-------------FLNRTEAANVEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSNDILG-------IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARH 856          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 117.087 bits (292), Expect = 3.491e-26
Identity = 127/432 (29.40%), Postives = 196/432 (45.37%), Query Frame = 1
Query: 2182 IFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGM---KVLVSSYTHSAVSNILQKL---------------DAREINFLYLNGNHSV-----CEKLKNRTLSYILPEKKFENLFNF--------HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLP---VSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYN----NQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN-MSTM---------EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            + ++   LI+G PG+GKT  +V+   ++ L+      VLV S ++ AV ++ +K+               +  E    YL   H +      E  K   L     E +F++   +        H L+   DV+  TC SA  A LS+++   V+IDE+ Q T P   VSIM  ++      + +L GD  QL P+V    A I GL QSLF +L      P     L++QYRM+  + +  + + Y+    N +T     +        +      FW C   S EL  S                + N+ EA    +LV + +K G     IGVI PY  Q+  I N M T           VEI ++D +QGR+K  +I++ V  +D LG          L+D RRLNVAI+RAK+ L+++GN   L+++
Sbjct:  457 VLTRPLSLIQGPPGTGKT--VVSATIVYHLVQKTEGNVLVCSPSNIAVDHLAEKIHKTGLKVVRLCARSREHSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILVSIMRGVR------QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRP---FRLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHWPKPNKPAFFWHC-SGSEELSASGTS-------------FLNRTEAANVEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSNDILG-------IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARH 856          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 117.087 bits (292), Expect = 3.491e-26
Identity = 127/432 (29.40%), Postives = 196/432 (45.37%), Query Frame = 1
Query: 2182 IFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGM---KVLVSSYTHSAVSNILQKL---------------DAREINFLYLNGNHSV-----CEKLKNRTLSYILPEKKFENLFNF--------HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLP---VSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYN----NQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN-MSTM---------EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            + ++   LI+G PG+GKT  +V+   ++ L+      VLV S ++ AV ++ +K+               +  E    YL   H +      E  K   L     E +F++   +        H L+   DV+  TC SA  A LS+++   V+IDE+ Q T P   VSIM  ++      + +L GD  QL P+V    A I GL QSLF +L      P     L++QYRM+  + +  + + Y+    N +T     +        +      FW C   S EL  S                + N+ EA    +LV + +K G     IGVI PY  Q+  I N M T           VEI ++D +QGR+K  +I++ V  +D LG          L+D RRLNVAI+RAK+ L+++GN   L+++
Sbjct:  457 VLTRPLSLIQGPPGTGKT--VVSATIVYHLVQKTEGNVLVCSPSNIAVDHLAEKIHKTGLKVVRLCARSREHSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRTRTVLIDESTQATEPEILVSIMRGVR------QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLGIRP---FRLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHWPKPNKPAFFWHC-SGSEELSASGTS-------------FLNRTEAANVEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSNDILG-------IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARH 856          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Match: Y106G6D.5 (pep chromosome:WBcel235:I:10119209:10121815:-1 gene:WBGene00014965.1 transcript:Y106G6D.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y106G6D.5)

HSP 1 Score: 112.849 bits (281), Expect = 2.338e-25
Identity = 129/476 (27.10%), Postives = 211/476 (44.33%), Query Frame = 1
Query: 2122 KIKHIMKICNPDQRRVIMSAIFSKDYLL-IKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNG----------------NHSVCEKLKN-----RTLSYILPEKK---FENLFNFHNLIENIDVVGVTCLSA-NHAALSRLK-----FDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCE-FNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWK-CQCCSSE--LDRSVIFLNYQ----PSFVEADEIYF-NKFEAKITMELVEQFL-KIGALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI*CNFGNICLSSLN 3426
            KI ++ +  NP Q   + +A+ ++  LL I+G PG+GKT  I  ++   +    KVLV + TH AV N +     R I  +                    NH    KL+       T+S   P  K   +E     +++  +I    +   S    +++ +L       DV+I+DEA Q T P + +P+L     K K IL GD  QLP +V +  A       SL  KL E F+  +    L  QYRMN +I+   N + Y NQ+T             H +++ +     C     +  L+  ++ +N +     S  E +   F N  E  +  E V + +  +G     I VI PY  Q E +R      V++NT+D +QG ++ +VI         L +  +      LN+ RRLNVA++RA+ + ++IGN   +  N   +K ++  L++ ++I     FG   L + N
Sbjct:  123 KIGNLPETLNPSQVAAVSAAMNTQRNLLCIQGPPGTGKTRVIAEIVHQLMKKKKKVLVCAPTHVAVRNAMDATTGRMIEEMPEEKAEQQLCLLANTKDEFQNHKSASKLEEIKKQLSTMSTSDPLYKKMSYEYYLIRNSIFRSIFYPKLAVFSTLGTSSIQKLPEYHWNADVMIVDEAAQCTEPATWVPVLTTPSCK-KLILVGDQKQLPAVVLSDKAMKGNFKLSLMEKLAEEFSSNNINILLNEQYRMNKKIMNWSNEVFYENQLTA------------HSTVSDITLRDICPNLPEDHVLNNPIMMINMENVKDRSHEEFESHSFTNTDELNLVTEYVNRLVVDLGINPKAIAVISPYYAQIEKLRRSIPFRVDVNTVDAFQGHERQVVIFC-------LVRDNDEGQIGFLNETRRLNVAVTRARRQFVLIGNGRMMKGNKHLLK-LYKHLQSEKVI-----FGPSILETFN 572          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: CG2990 (gene:FBgn0030170 transcript:FBtr0071415)

HSP 1 Score: 380.563 bits (976), Expect = 3.684e-113
Identity = 301/986 (30.53%), Postives = 478/986 (48.48%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIV---DPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKP------EISKMQV---IDVEENIWSTKYGIKGKIDVTLQT-----NESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCL-----PSVITNIRLCQSCEYLSLCTMFSRLSQNDSDC----SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLE------------FLSESSNENPIKNIIVQNSK-KSIRNVTFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVV--ESPGTDILIIS------SEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGN---HSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNY------------------------QPSFVE-ADEI-----------YFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMST---MEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIK 3345
            W    + VGD  S++   DP  S G + ++  +G  V +P +L+S T+VTGSLFC+RK VLQ  F G+    N  MVIG+ +H + Q+  R +  D   ++   + +    S     Y S     E+   +  +   I+ ++ + +  +P      E+ + Q+    D+EEN+W  + G+KGK+DV+++       E  IPLELKTGR +FS EH  Q+LLY LM S +   +   GLLLY+K+G  R + +  +      + +RN+L  ++ +  +   +  D L     P  + +   C +C Y ++C+ F+   Q DS      S  +K L+     HL E D+ +  HW  L+ LE            F ++   E   + I +++ K    + V  E         L +   P +      F  G+ +++SS    ++A+  G++V  E+   D+ +        SE+  I        ID + S      N + LG L+ + E  Q+LRD IV  KPP     + K +  K   I+   N  Q+   + A+ +  +LLIKG PG+GKT  +VA++R+  L+G  VL+++ THSAV N++ +L    +  + L      H   E++    L+     K  + +      +    +VGVTCL   H    R +FD  I+DEA Q+  P  + PL+       KF+L GD  QLPP+VR+  AR  G D++LF +L   +   +   L LQYRMN  I +L N ++Y   + CA+D+V+ A   E E +N    W  +  ++ L+++V  +N                         + SF E  DEI           Y N  EA I M L+   LK G   S IGVI PY  Q E+ + +++    ++E NT+DQ+QGRDK+++I S             +    IL DQRRL VAI+RAK+KLI++G++  L Q Y P +
Sbjct:  111 WNCMPMQVGDTVSLLGKWDP--SAGCYVVDKEQGYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGLDS-GNSVMVIGTLVHELLQKVLRQKLFDKKHIQSALQEMLASSSLAHLLYASNLIQVEMEDHLMKFIDPIVSFVAQYVKGEPPSVLLPEVYRGQIHEICDIEENLWVPQLGLKGKVDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQLMHSAQGR-DTQSGLLLYLKEGLLREVASGRNEQR-DLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEPVYHHSACGNCAYNTICSSFA---QKDSSLQLSDSHPLKKLMPQLLEHLSEADHAYVQHWCGLLALEEQHNRQSSHVRSFWTKDPAEREKEGIAIRHLKLVKGQEVILEEGRYRQTLELGEEADPSRDLSLSGFDLGEYVVISSTS--RLAVAAGFIVSIEARRLDLRLERDLSQRYSEETFI--------IDKHDSQSFATFNFTNLGMLLSEGERFQELRDIIVAKKPPEQHKVLPKIILTKGAPILLNLNKVQQNAALRALTTSSHLLIKGLPGTGKTQTLVALVRLLHLLGKSVLITAQTHSAVDNLIMRLLPFGLPMMRLGSGSRIHKQLEEISEERLT-----KDCKTVEELEKALGQPSIVGVTCLGCGHPLFQRRQFDYCIVDEATQVLQPTVLRPLIHC----SKFVLVGDPEQLPPIVRSKEARQRGADETLFQRL---DSEKATAVLSLQYRMNKTITRLANELTYGGDLKCASDEVSGARF-EVELLNEAPRWVQRALTTHLEQAVTLINTGDCLERCQEFVYASQRLVDTCSSIEQSFSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYLLKSGYEASRIGVIAPYRAQVELFKKLASKLDTDLECNTVDQFQGRDKNLIIYSCSKTGGDFSDMERSREAEILEDQRRLTVAITRAKNKLILLGDIKCLEQ-YGPFR 1064          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: CG2990 (gene:FBgn0030170 transcript:FBtr0112971)

HSP 1 Score: 380.563 bits (976), Expect = 3.804e-113
Identity = 301/986 (30.53%), Postives = 479/986 (48.58%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIV---DPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKP------EISKMQV---IDVEENIWSTKYGIKGKIDVTLQT-----NESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCL-----PSVITNIRLCQSCEYLSLCTMFSRLSQNDSDC----SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLE------------FLSESSNENPIKNIIVQNSK-KSIRNVTFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVV--ESPGTDILIIS------SEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGN---HSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNY------------------------QPSFVE-ADEI-----------YFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMST---MEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIK 3345
            W    + VGD  S++   DP  S G + ++  +G  V +P +L+S T+VTGSLFC+RK VLQ  F G+   S  +MVIG+ +H + Q+  R +  D   ++   + +    S     Y S     E+   +  +   I+ ++ + +  +P      E+ + Q+    D+EEN+W  + G+KGK+DV+++       E  IPLELKTGR +FS EH  Q+LLY LM S +   +   GLLLY+K+G  R + +  +      + +RN+L  ++ +  +   +  D L     P  + +   C +C Y ++C+ F+   Q DS      S  +K L+     HL E D+ +  HW  L+ LE            F ++   E   + I +++ K    + V  E         L +   P +      F  G+ +++SS    ++A+  G++V  E+   D+ +        SE+  I        ID + S      N + LG L+ + E  Q+LRD IV  KPP     + K +  K   I+   N  Q+   + A+ +  +LLIKG PG+GKT  +VA++R+  L+G  VL+++ THSAV N++ +L    +  + L      H   E++    L+     K  + +      +    +VGVTCL   H    R +FD  I+DEA Q+  P  + PL+       KF+L GD  QLPP+VR+  AR  G D++LF +L   +   +   L LQYRMN  I +L N ++Y   + CA+D+V+ A   E E +N    W  +  ++ L+++V  +N                         + SF E  DEI           Y N  EA I M L+   LK G   S IGVI PY  Q E+ + +++    ++E NT+DQ+QGRDK+++I S             +    IL DQRRL VAI+RAK+KLI++G++  L Q Y P +
Sbjct:  111 WNCMPMQVGDTVSLLGKWDP--SAGCYVVDKEQGYCVSHPDFLISGTTVTGSLFCKRKSVLQERFRGLD--SGNSMVIGTLVHELLQKVLRQKLFDKKHIQSALQEMLASSSLAHLLYASNLIQVEMEDHLMKFIDPIVSFVAQYVKGEPPSVLLPEVYRGQIHEICDIEENLWVPQLGLKGKVDVSVKVKNQRQREEIIPLELKTGRASFSMEHKGQLLLYQLMHSAQGR-DTQSGLLLYLKEGLLREVASGRNEQR-DLLMLRNDLAYWLTREVAIPASKEDPLEQLPLPEPVYHHSACGNCAYNTICSSFA---QKDSSLQLSDSHPLKKLMPQLLEHLSEADHAYVQHWCGLLALEEQHNRQSSHVRSFWTKDPAEREKEGIAIRHLKLVKGQEVILEEGRYRQTLELGEEADPSRDLSLSGFDLGEYVVISSTS--RLAVAAGFIVSIEARRLDLRLERDLSQRYSEETFI--------IDKHDSQSFATFNFTNLGMLLSEGERFQELRDIIVAKKPPEQHKVLPKIILTKGAPILLNLNKVQQNAALRALTTSSHLLIKGLPGTGKTQTLVALVRLLHLLGKSVLITAQTHSAVDNLIMRLLPFGLPMMRLGSGSRIHKQLEEISEERLT-----KDCKTVEELEKALGQPSIVGVTCLGCGHPLFQRRQFDYCIVDEATQVLQPTVLRPLIHC----SKFVLVGDPEQLPPIVRSKEARQRGADETLFQRL---DSEKATAVLSLQYRMNKTITRLANELTYGGDLKCASDEVSGARF-EVELLNEAPRWVQRALTTHLEQAVTLINTGDCLERCQEFVYASQRLVDTCSSIEQSFSEDKDEIRKLTSKKRVSKYTNYCEAGIVMHLLRYLLKSGYEASRIGVIAPYRAQVELFKKLASKLDTDLECNTVDQFQGRDKNLIIYSCSKTGGDFSDMERSREAEILEDQRRLTVAITRAKNKLILLGDIKCLEQ-YGPFR 1063          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: Upf1 (gene:FBgn0030354 transcript:FBtr0342744)

HSP 1 Score: 129.028 bits (323), Expect = 9.734e-30
Identity = 132/443 (29.80%), Postives = 208/443 (46.95%), Query Frame = 1
Query: 2152 PDQRRVIMSAI---FSKDYLLIKGYPGSGKTSCIVAMIRIFV-LMGMKVLVSSYTHSAVSNILQKL------------DARE-----INFLYL---------NGNHSVCEKLKNRT--LSYILPEKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            PD  R  + A+     +   LI+G PG+GKT     ++   V L G  VLV + +++AV  + +K+             +RE     ++FL L         N      ++LK+ T  LS    EK++ NL     + L+E  DV+  TC+ A    LSR+KF  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+ E+ +  +   Y   +    CA D+              L+F W       + +R + FL    Q     +   + N+ EA    ++  +FLK G     IG+I PY  Q+  +++ M            E+EI ++D +QGR+K I+I+S V       ++ E      LND RRLNVA++RAK  +I++GN   L++
Sbjct:  450 PDLNRSQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQLVKLHGGTVLVCAPSNTAVDQLTEKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSSA-DEKRYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRP---FRLEVQYRMHPELSQFPSNFFYEGSLQNGVCAEDRRL-----------KLDFPW------PQPERPMFFLVTQGQEEIAGSGTSFLNRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQRAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCV-------RSNERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLAK 861          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: Upf1 (gene:FBgn0030354 transcript:FBtr0073596)

HSP 1 Score: 129.028 bits (323), Expect = 9.734e-30
Identity = 132/443 (29.80%), Postives = 208/443 (46.95%), Query Frame = 1
Query: 2152 PDQRRVIMSAI---FSKDYLLIKGYPGSGKTSCIVAMIRIFV-LMGMKVLVSSYTHSAVSNILQKL------------DARE-----INFLYL---------NGNHSVCEKLKNRT--LSYILPEKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            PD  R  + A+     +   LI+G PG+GKT     ++   V L G  VLV + +++AV  + +K+             +RE     ++FL L         N      ++LK+ T  LS    EK++ NL     + L+E  DV+  TC+ A    LSR+KF  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+ E+ +  +   Y   +    CA D+              L+F W       + +R + FL    Q     +   + N+ EA    ++  +FLK G     IG+I PY  Q+  +++ M            E+EI ++D +QGR+K I+I+S V       ++ E      LND RRLNVA++RAK  +I++GN   L++
Sbjct:  450 PDLNRSQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQLVKLHGGTVLVCAPSNTAVDQLTEKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSSA-DEKRYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRP---FRLEVQYRMHPELSQFPSNFFYEGSLQNGVCAEDRRL-----------KLDFPW------PQPERPMFFLVTQGQEEIAGSGTSFLNRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQRAYLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCV-------RSNERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLAK 861          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Match: CG6967 (gene:FBgn0034187 transcript:FBtr0300276)

HSP 1 Score: 74.7146 bits (182), Expect = 3.442e-13
Identity = 107/437 (24.49%), Postives = 193/437 (44.16%), Query Frame = 1
Query: 2161 RRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLM--GMKVLVSSYTHSAVSNILQKLDAREINFLYLNGN-----HSVCEKLKN------RTLSYILPEKKFENLFNF-----------HNLIENIDVVGVTCLSANHAALSRLKFDV---------VIIDEAGQITLPVSIMPLLKMDQNKG-KFILTGDLLQLPPLVRNSTARINGLDQSLFSKLC--------EFNHPDSICELKL--QYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSF-----VEADEIYFNKFEAKITMELVEQFLKIGAL-ESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGN 3309
            +R++        Y+L  G PG+GKT+ IV  I    L     ++LV++ ++SA   I  KL        Y+  N     H   +KL        R  S  + EK F ++ +            ++ I+   +V    + A    ++RL  D          + IDEAG  T P +++ ++ + Q      IL+GD  QL  +++++ A   GL +SL  +L         E  + D   +++L   YR + +I++L N + YN ++       A A  M+   +N    W      S L      + +Q +       +     +N  EA++    V++ +    + + D+G++ PY  Q +++  +        VE+ +++ YQGR+K+I+I S V     +G          + + RR+NV +SRAK  LI++GN
Sbjct:  259 QRIVAGPSTQGPYILF-GPPGTGKTTTIVEAILQLRLQQPQSRILVTAGSNSACDTIALKLCE------YIESNIRLQEHFAQQKLPEPDHQLIRVYSRSIYEKGFASVPSLLLKNSNCSKSIYDHIKASRIVKYGIIVATLCTVARLVTDTLGRYNFFTHIFIDEAGASTEPEALIGIMGIKQTADCHVILSGDHKQLGAVIKSNRAASLGLSRSLMERLLQSDCYKSDENGNYDRNRQMRLCRNYRSHPQIVRLFNELYYNGELK------AQAPAMD---VNLAANW------SVLTNPQFPIIFQATHGVTNREQNSTSSYNNLEAEVICWYVKRLINDRVVGQEDVGIVAPYTAQGKLVTKLLQSKGYPNVEVGSVETYQGREKTIIIASLVKSFTNMG---------FMCNPRRVNVLLSRAKALLILVGN 664          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: dna2 (DNA replication helicase/nuclease 2 [Source:ZFIN;Acc:ZDB-GENE-090313-71])

HSP 1 Score: 433.721 bits (1114), Expect = 3.017e-130
Identity = 326/1010 (32.28%), Postives = 494/1010 (48.91%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT-----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQND--SDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNS--KKSIRNVTFESSSLSGINFL----IKFNLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLI-CSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP-------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQC-------CSSELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K LT+T     +      L   WE T+V VGDI  +     S GLWTI+     L++ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H IFQ+          +++  A    + P+ L   Y    T  ++ +E+E Y P I +W  + L   P+  + Q+                        +D+EENIW  ++G+KGKIDVT             E  +PLELKTG+ + S EH  QV+LY LM S +   + + G L+Y+K G+   +   N       IKIRN L      N I     SQ+     LP+++++ + C+ C     C +++R  + D    CS+  +  ++  + HL +   ++F HW+ L  LE L+   N+   +NI +Q +  ++ I           G++ L     K +  +K         + GD I+VS  D   + +  GYV E    + +  S +K L   S  T  R+D +       ++L  L  LM+ +   ++LR+ IV  +PP F   ++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V  +        ILP        K  + L     L     +V  TC+   H   SR +FD  I+DEA QI+ PV I PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +H D++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +      ++   LE + CQ         + E +  V FL+      P  VE   I  N  EA +   LV   LK G    DIGVI PY QQ ++I ++    +   +E+NT+D+YQGRDKS++I+SFV  +       E N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++ +   L+   +IS
Sbjct:  381 KHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVS-GLWTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGS-KQMLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTLMSSAR-RCDPEAGFLVYLKTGSLHPVVG-NHMDRRELIKIRNSLAHHIGNNLIKVDGKSQMAQ---LPAIVSDQQTCKYCPQKRNCAIYNRAVERDPVEKCSENPQAFVQSESEHLSQVHLQYFSHWLLLCSLEALT-MENKGGRRNIWLQTAQQREKIGGCAGNMRLAGGVSILSDGVYKHSFERKEGEQTLTGLIVGDRIVVSDQDSVLIGLSTGYVTEI-AVNRVTCSLDKNLSKYSSNTVFRLDQDEGAGGLSTHLGNLSMLMENTPTSERLRELIVEFRPPQFIDSLSSVLPRDAKDIVSNILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKRFKIGFLRLGRPQKVHHE--------ILPFTEEACRAKGIQTLEELEQLYSRELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCIGPLFYAQ----RFVLVGDHQQLPPIVQNAEARSLGMDESLFKRL--EHHRDAVVQLNVQYRMNSAIMSLSNALMYEGRLECGSEKTANAVLQLPSRAQAEEELELYVCQPQYSAWVQAALEPNSPVCFLDTSEVPAPETVEKSGIS-NHTEAVLVQGLVTLLLKAGCRACDIGVIAPYRQQLKVISSLLQGDAFKALEVNTVDKYQGRDKSVIIVSFVRSNA------EGNLGELLQDWRRLNVAITRAKHKLLMLGSAPTL-RRYAPLEKLLCHLQQEDMIS 1359          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: dna2 (DNA replication helicase/nuclease 2 [Source:ZFIN;Acc:ZDB-GENE-090313-71])

HSP 1 Score: 433.335 bits (1113), Expect = 4.029e-130
Identity = 324/997 (32.50%), Postives = 488/997 (48.95%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT-----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQND--SDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNS--KKSIRNVTFESSSLSGINFL----IKFNLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLI-CSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP-------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS-------ELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIK 3345
            K LT+T     +      L   WE T+V VGDI  +     S GLWTI+     L++ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H IFQ+          +++  A    + P+ L   Y    T  ++ +E+E Y P I +W  + L   P+  + Q+                        +D+EENIW  ++G+KGKIDVT             E  +PLELKTG+ + S EH  QV+LY LM S +   + + G L+Y+K G+   +   N       IKIRN L      N I     SQ+     LP+++++ + C+ C     C +++R  + D    CS+  +  ++  + HL +   ++F HW+ L  LE L+   N+   +NI +Q +  ++ I           G++ L     K +  +K         + GD I+VS  D   + +  GYV E    + +  S +K L   S  T  R+D +       ++L  L  LM+ +   ++LR+ IV  +PP F   ++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V  +        ILP        K  + L     L     +V  TC+   H   SR +FD  I+DEA QI+ PV I PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +H D++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +      ++   LE + CQ   S       E +  V FL+      P  VE   I  N  EA +   LV   LK G    DIGVI PY QQ ++I ++    +   +E+NT+D+YQGRDKS++I+SFV  +       E N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++
Sbjct:  381 KHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVS-GLWTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGS-KQMLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTLMSSAR-RCDPEAGFLVYLKTGSLHPVVG-NHMDRRELIKIRNSLAHHIGNNLIKVDGKSQMAQ---LPAIVSDQQTCKYCPQKRNCAIYNRAVERDPVEKCSENPQAFVQSESEHLSQVHLQYFSHWLLLCSLEALT-MENKGGRRNIWLQTAQQREKIGGCAGNMRLAGGVSILSDGVYKHSFERKEGEQTLTGLIVGDRIVVSDQDSVLIGLSTGYVTEI-AVNRVTCSLDKNLSKYSSNTVFRLDQDEGAGGLSTHLGNLSMLMENTPTSERLRELIVEFRPPQFIDSLSSVLPRDAKDIVSNILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKRFKIGFLRLGRPQKVHHE--------ILPFTEEACRAKGIQTLEELEQLYSRELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCIGPLFYAQ----RFVLVGDHQQLPPIVQNAEARSLGMDESLFKRL--EHHRDAVVQLNVQYRMNSAIMSLSNALMYEGRLECGSEKTANAVLQLPSRAQAEEELELYVCQPQYSAWVQAALEPNSPVCFLDTSEVPAPETVEKSGIS-NHTEAVLVQGLVTLLLKAGCRACDIGVIAPYRQQLKVISSLLQGDAFKALEVNTVDKYQGRDKSVIIVSFVRSNA------EGNLGELLQDWRRLNVAITRAKHKLLMLGSAPTL-RRYAPLE 1346          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX530068.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 432.565 bits (1111), Expect = 6.571e-130
Identity = 327/1010 (32.38%), Postives = 494/1010 (48.91%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT-----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQND--SDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNS--KKSIRNVTFESSSLSGINFL----IKFNLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLI-CSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP-------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS-------ELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K LT+T     +      L   WE T+V VGDI  +     S GLWTI+     L++ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H IFQ+          +++  A    + P+ L   Y    T  ++ +E+E Y P I +W  + L   P+  + Q+                        +D+EENIW  ++G+KGKIDVT             E  +PLELKTG+ + S EH  QV+LY LM S +   + + G L+Y+K G+   +   N       IKIRN L      N I     SQ+     LP+++++ + C+ C     C +++R  + D    CS+  +  ++  + HL +   ++F HW+ L  LE L+   N+   +NI +Q +  ++ I           G++ L     K +  +K         + GD I+VS  D   + +  GYV E    + +  S +K L   S  T  R+D +       ++L  L  LM+ +   ++LR+ IV  +PP F   ++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V  +        ILP        K  + L     L     +V  TC+   H   SR +FD  I+DEA QI+ PV I PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +H D++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +      ++   LE + CQ   S       E +  V FL+      P  VE   I  N  EA +   LV   LK G    DIGVI PY QQ ++I ++    +   +E+NT+D+YQGRDKS++I+SFV  +       E N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++ +   L+   +IS
Sbjct:  378 KHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVS-GLWTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGS-KQMLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTLMSSAR-RCDPEAGFLVYLKTGSLHPVVG-NHMDRRELIKIRNSLAHHIGNNLIKVDGKSQMAQ---LPAIVSDQQTCKYCPQKRNCAIYNRSVERDPVEKCSENPQAFVQSESEHLSQVHLQYFSHWLLLCSLEALT-MENKGGRRNIWLQTAQQREKIGGCAGNMRLAGGVSILSDGVYKHSFERKEGEQTLTGLIVGDRIVVSDQDSVLIGLSTGYVTEI-AVNRVTCSLDKNLSKYSSNTVFRLDQDEGAGGLSTHLGNLSMLMENTPTSERLRELIVEFRPPQFIDSLSSVLPRDAKDIVSNILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKRFKIGFLRLGRPQKVHHE--------ILPFTEEACRAKGIQTLEELEQLYSRELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCIGPLFYAQ----RFVLVGDHQQLPPIVQNAEARSLGMDESLFKRL--EHHRDAVVQLNVQYRMNSAIMSLSNALMYEGRLECGSEKTANAVLQLPSRAQAEEELELYVCQPQYSAWVQAALEPNSPVCFLDTSEVPAPETVEKSGIS-NHTEAVLVQGLVTLLLKAGCRACDIGVIAPYRQQLKVISSLLQGDAFKALEVNTVDKYQGRDKSVIIVSFVRSNA------EGNLGELLQDWRRLNVAITRAKHKLLMLGSAPTL-RRYAPLEKLLCHLQQEDMIS 1356          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX530068.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 432.18 bits (1110), Expect = 8.271e-130
Identity = 327/1010 (32.38%), Postives = 494/1010 (48.91%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT-----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQND--SDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNS--KKSIRNVTFESSSLSGINFL----IKFNLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLI-CSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP-------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS-------ELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K LT+T     +      L   WE T+V VGDI  +     S GLWTI+     L++ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H IFQ+          +++  A    + P+ L   Y    T  ++ +E+E Y P I +W  + L   P+  + Q+                        +D+EENIW  ++G+KGKIDVT             E  +PLELKTG+ + S EH  QV+LY LM S +   + + G L+Y+K G+   +   N       IKIRN L      N I     SQ+     LP+++++ + C+ C     C +++R  + D    CS+  +  ++  + HL +   ++F HW+ L  LE L+   N+   +NI +Q +  ++ I           G++ L     K +  +K         + GD I+VS  D   + +  GYV E    + +  S +K L   S  T  R+D +       ++L  L  LM+ +   ++LR+ IV  +PP F   ++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V  +        ILP        K  + L     L     +V  TC+   H   SR +FD  I+DEA QI+ PV I PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +H D++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +      ++   LE + CQ   S       E +  V FL+      P  VE   I  N  EA +   LV   LK G    DIGVI PY QQ ++I ++    +   +E+NT+D+YQGRDKS++I+SFV  +       E N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++ +   L+   +IS
Sbjct:  378 KHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVS-GLWTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGS-KQMLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTLMSSAR-RCDPEAGFLVYLKTGSLHPVVG-NHMDRRELIKIRNSLAHHIGNNLIKVDGKSQMAQ---LPAIVSDQQTCKYCPQKRNCAIYNRSVERDPVEKCSENPQAFVQSESEHLSQVHLQYFSHWLLLCSLEALT-MENKGGRRNIWLQTAQQREKIGGCAGNMRLAGGVSILSDGVYKHSFERKEGEQTLTGLIVGDRIVVSDQDSVLIGLSTGYVTEI-AVNRVTCSLDKNLSKYSSNTVFRLDQDEGAGGLSTHLGNLSMLMENTPTSERLRELIVEFRPPQFIDSLSSVLPRDAKDIVSNILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKRFKIGFLRLGRPQKVHHE--------ILPFTEEACRAKGIQTLEELEQLYSRELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCIGPLFYAQ----RFVLVGDHQQLPPIVQNAEARSLGMDESLFKRL--EHHRDAVVQLNVQYRMNSAIMSLSNALMYEGRLECGSEKTANAVLQLPSRAQAEEELELYVCQPQYSAWVQAALEPNSPVCFLDTSEVPAPETVEKSGIS-NHTEAVLVQGLVTLLLKAGCRACDIGVIAPYRQQLKVISSLLQGDAFKALEVNTVDKYQGRDKSVIIVSFVRSNA------EGNLGELLQDWRRLNVAITRAKHKLLMLGSAPTL-RRYAPLEKLLCHLQQEDMIS 1356          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Match: BX890597.2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:559535])

HSP 1 Score: 431.024 bits (1107), Expect = 2.532e-129
Identity = 321/1009 (31.81%), Postives = 492/1009 (48.76%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT-----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQND--SDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNS--KKSIRNVTFESSSLSGINFL----IKFNLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLI-CSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP-------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYF----------NKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K LT+T     +      L   WE T+V VGDI  +     S GLWTI+     L++ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H IFQ+          +++  A    + P+ L   Y    T  ++ +E+E Y P I +W  + L   P+  + Q+                        +D+EENIW  ++G+KGKIDVT             E  +PLELKTG+ + S EH  QV+LY LM S +   + + G L+Y+K G+   +   N       IKIRN L      N I     SQ+     LP+++++ + C+ C     C +++R  + D    CS+  +  ++  + HL +   ++F HW+ L  LE L+    +   +NI +Q +  ++ I           G++ L     K +  +K         + GD I+VS  D   + +  GYV E    + +  S +K L   S  T  R+D +       ++L  L  LM+ +   ++LR+ IV  +PP F   ++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V  +        ILP        K  + L     L     +V  TC+   H   SR +FD  I+DEA QI+ PV I PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +H D++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +      ++   LE + CQ   S   ++ +  N    F++  E+            N  EA +   LV   LK G    DIGVI PY QQ ++I ++    +   +E+NT+D+YQGRDKS++I+SFV  +       E N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++ +   L+   +IS
Sbjct:  378 KHLTITCSKTSQATETCILKDGWESTLVTVGDIIHLEGKCVS-GLWTIDRDSAFLILLPDLLISGTSIASSIRCMRRGVLGEMFKAFDGGS-KQMLNGTIVHDIFQKAAMSSDFSSEKIQTFATEALRSPNYLGQMYSLKLTQADMRQEVEEYLPSISEWAKQYLHTSPQAGQKQLTLKLPSDGALSKQDASSSVMVTDFVDIEENIWCPRFGLKGKIDVTAGVKIHRRGRKPMERIVPLELKTGKESNSIEHRSQVILYTLMSSAR-RCDPEAGFLVYLKTGSLHPVVG-NHMDRRELIKIRNSLAHHIGNNLIKVDGKSQMAQ---LPAIVSDQQTCKYCPQKRNCAIYNRSVERDPVEKCSENPQAFVQSESEHLSQVHLQYFSHWLLLCSLEALT-MEKKGGRRNIWLQTAQQREKIGGCAGNMRLAGGVSILSDGVYKHSFERKEGEQTLTGLIVGDRIVVSDQDSVLIGLSTGYVTEI-AVNRVTCSLDKNLSKYSSNTVFRLDQDEGAGGLSTHLGNLSMLMENTPTSERLRELIVEFRPPQFIDSLSSVLPRDAKDIVANILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKRFKIGFLRLGRPQKVHHE--------ILPFTEEACRAKGIQTLEELEQLYSRELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCIGPLFYAQ----RFVLVGDHQQLPPIVQNAEARSLGMDESLFKRL--EHHRDAVVQLNVQYRMNSAIMSLSNALMYEGRLECGSEKTANAVLQLPSRAQAEEELELYVCQPQYSAWVQAALEPNSPVCFLDTSEVAAPETVEKSGISNHTEAVLVQGLVTLLLKAGCRACDIGVIAPYRQQLKVISSLLQGDAFKALEVNTVDKYQGRDKSVIIVSFVRSNA------EGNLGELLQDWRRLNVAITRAKHKLLMLGSAPTL-RRYAPLEKLLCHLQQEDMIS 1356          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 403.29 bits (1035), Expect = 6.625e-122
Identity = 310/943 (32.87%), Postives = 483/943 (51.22%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW--------INRNLSKKPEISKMQVIDVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK------KSIRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS-----ELDRSVIFLNYQ--PSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+IG+ +H IFQ        D + ++E+A      P  L   Y+      +++ E++ Y P   KW        +N++     ++S  + +D+EENIWS ++G+KGKIDVT +        ++   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S ++T A  LP++I + + C+ C  +  C ++SR + Q   +C     M  +++  T HL +   ++F  W  +  LE  S+ S     KNI + +S       + I N+  T    ++S    L  F       P    + GD ++VS +D K +A+  GY+ E    +I  I         +    R+D         S+L  L  LM+ S +  KLR  I+    P F  H++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q         E    V FLN +  P+   E      N  EAK+   L + FLK G   SDIG+I PY QQ ++I N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  LS+
Sbjct:   79 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLIGTMLHDIFQRATTRGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINATKVS--EFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYSVPGNRLDRRELLKIRNELSYYLTNVVHKSDNGSKEITLAS-LPALIADRQACKFCSQMRNCALYSRSVEQQIENCYIPAEMIPVVQKETEHLNKDHLQYFRLWYLMCTLEGNSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGPVQTISDGQHLHSFQRKSGTVPATNLMSGDRVVVSGED-KFLALSSGYIKEVKHNNITCILDRSLGKLPEDLLFRLDHEEGGGGLESHLGNLSRLMENSPVSDKLRKLIIDFSKPNFVQHLSSVLPSDAKDIVANILKGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGYSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVQSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSQIMALSNKLVYEGRLECASDRVSNAVVKLPHIKTLLLELEFRESQESMWIKDVLEPSNPVCFLNTEKIPALETEEKGGISNWIEAKLVFCLTKLFLKAGCRPSDIGIIAPYRQQLKVISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLSR 1000          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 402.905 bits (1034), Expect = 1.937e-121
Identity = 312/952 (32.77%), Postives = 484/952 (50.84%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW---------------INRNLSKKP-EISKM-QVIDVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK------KSIRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS-----ELDRSVIFLNYQ--PSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+IG+ +H IFQ        D + ++E+A      P  L   Y+      +++ E++ Y P   KW               + R  +  P E +K+ + +D+EENIWS ++G+KGKIDVT +        ++   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S ++T A  LP++I + + C+ C  +  C ++SR + Q   +C     M  +++  T HL +   ++F  W  +  LE  S+ S     KNI + +S       + I N+  T    ++S    L  F       P    + GD ++VS +D K +A+  GY+ E    +I  I         +    R+D         S+L  L  LM+ S +  KLR  I+    P F  H++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q         E    V FLN +  P+   E      N  EAK+   L + FLK G   SDIG+I PY QQ ++I N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  LS+
Sbjct:   91 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLIGTMLHDIFQRATTRGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRPTAGDPTEATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYSVPGNRLDRRELLKIRNELSYYLTNVVHKSDNGSKEITLAS-LPALIADRQACKFCSQMRNCALYSRSVEQQIENCYIPAEMIPVVQKETEHLNKDHLQYFRLWYLMCTLEGNSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGPVQTISDGQHLHSFQRKSGTVPATNLMSGDRVVVSGED-KFLALSSGYIKEVKHNNITCILDRSLGKLPEDLLFRLDHEEGGGGLESHLGNLSRLMENSPVSDKLRKLIIDFSKPNFVQHLSSVLPSDAKDIVANILKGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGYSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVQSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSQIMALSNKLVYEGRLECASDRVSNAVVKLPHIKTLLLELEFRESQESMWIKDVLEPSNPVCFLNTEKIPALETEEKGGISNWIEAKLVFCLTKLFLKAGCRPSDIGIIAPYRQQLKVISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLSR 1023          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 402.134 bits (1032), Expect = 2.256e-121
Identity = 310/951 (32.60%), Postives = 483/951 (50.79%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW---------------INRNLSKKPEISKM-QVIDVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK------KSIRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS-----ELDRSVIFLNYQ--PSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+IG+ +H IFQ        D + ++E+A      P  L   Y+      +++ E++ Y P   KW               + R+   +   +K+ + +D+EENIWS ++G+KGKIDVT +        ++   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S ++T A  LP++I + + C+ C  +  C ++SR + Q   +C     M  +++  T HL +   ++F  W  +  LE  S+ S     KNI + +S       + I N+  T    ++S    L  F       P    + GD ++VS +D K +A+  GY+ E    +I  I         +    R+D         S+L  L  LM+ S +  KLR  I+    P F  H++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q         E    V FLN +  P+   E      N  EAK+   L + FLK G   SDIG+I PY QQ ++I N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  LS+
Sbjct:   79 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLIGTMLHDIFQRATTRGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRDGGNESGATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYSVPGNRLDRRELLKIRNELSYYLTNVVHKSDNGSKEITLAS-LPALIADRQACKFCSQMRNCALYSRSVEQQIENCYIPAEMIPVVQKETEHLNKDHLQYFRLWYLMCTLEGNSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGPVQTISDGQHLHSFQRKSGTVPATNLMSGDRVVVSGED-KFLALSSGYIKEVKHNNITCILDRSLGKLPEDLLFRLDHEEGGGGLESHLGNLSRLMENSPVSDKLRKLIIDFSKPNFVQHLSSVLPSDAKDIVANILKGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGYSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVQSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSQIMALSNKLVYEGRLECASDRVSNAVVKLPHIKTLLLELEFRESQESMWIKDVLEPSNPVCFLNTEKIPALETEEKGGISNWIEAKLVFCLTKLFLKAGCRPSDIGIIAPYRQQLKVISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLSR 1010          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 402.905 bits (1034), Expect = 5.414e-121
Identity = 312/952 (32.77%), Postives = 484/952 (50.84%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW---------------INRNLSKKP-EISKM-QVIDVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK------KSIRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS-----ELDRSVIFLNYQ--PSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+IG+ +H IFQ        D + ++E+A      P  L   Y+      +++ E++ Y P   KW               + R  +  P E +K+ + +D+EENIWS ++G+KGKIDVT +        ++   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S ++T A  LP++I + + C+ C  +  C ++SR + Q   +C     M  +++  T HL +   ++F  W  +  LE  S+ S     KNI + +S       + I N+  T    ++S    L  F       P    + GD ++VS +D K +A+  GY+ E    +I  I         +    R+D         S+L  L  LM+ S +  KLR  I+    P F  H++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q         E    V FLN +  P+   E      N  EAK+   L + FLK G   SDIG+I PY QQ ++I N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  LS+
Sbjct:  147 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLIGTMLHDIFQRATTRGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINVTRPTAGDPTEATKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYSVPGNRLDRRELLKIRNELSYYLTNVVHKSDNGSKEITLAS-LPALIADRQACKFCSQMRNCALYSRSVEQQIENCYIPAEMIPVVQKETEHLNKDHLQYFRLWYLMCTLEGNSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGPVQTISDGQHLHSFQRKSGTVPATNLMSGDRVVVSGED-KFLALSSGYIKEVKHNNITCILDRSLGKLPEDLLFRLDHEEGGGGLESHLGNLSRLMENSPVSDKLRKLIIDFSKPNFVQHLSSVLPSDAKDIVANILKGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGYSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVQSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSQIMALSNKLVYEGRLECASDRVSNAVVKLPHIKTLLLELEFRESQESMWIKDVLEPSNPVCFLNTEKIPALETEEKGGISNWIEAKLVFCLTKLFLKAGCRPSDIGIIAPYRQQLKVISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLSR 1079          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:100170166])

HSP 1 Score: 384.8 bits (987), Expect = 1.597e-115
Identity = 306/944 (32.42%), Postives = 479/944 (50.74%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW--------INR---NLSKKP-EISKMQVI-----DVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSK------KSIRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+IG+ +H IFQ        D + ++E+A      P  L   Y+      +++ E++ Y P   KW        +N+   N+ K P  ++K  +I     D+EENIWS ++G+KGKIDVT +        ++   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S ++T A  LP++I + + C+ C  +  C ++SR + Q   +C     M  +++  T HL +   ++F  W  +  LE  S+ S     KNI + +S       + I N+  T    ++S    L  F       P    + GD ++VS +D K +A+  GY+ E    +I  I         +    R+D         S+L  L  LM+ S +  KLR  I+    P F  H++  L    K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q   S   + V+    +PS    + + F   E            K G   SDIG+I PY QQ ++I N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  LS+
Sbjct:   55 WVALHIKPGDIIHLEGNCAFDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLIGTMLHDIFQRATTRGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQTDVMGEVQEYLPSFAKWAIDFMTHPLNQHQINIPKMPFPLNKTGIIFSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKSHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYSVPGNRLDRRELLKIRNELSYYLTNVVHKSDNGSKEITLAS-LPALIADRQACKFCSQMRNCALYSRSVEQQIENCYIPAEMIPVVQKETEHLNKDHLQYFRLWYLMCTLEGNSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGPVQTISDGQHLHSFQRKSGTVPATNLMSGDRVVVSGED-KFLALSSGYIKEVKHNNITCILDRSLGKLPEDLLFRLDHEEGGGGLESHLGNLSRLMENSPVSDKLRKLIIDFSKPNFVQHLSSVLPSDAKDIVANILKGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGYSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVQSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSQIMALSNKLVYEGRLECASDRVSNAVVKLPHIKTLLLELEFRESQ--ESMWIKDVL----EPS----NPVCFLNTE------------KAGCRPSDIGIIAPYRQQLKVISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLSR 957          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Dna2 (DNA replication helicase/nuclease 2 [Source:MGI Symbol;Acc:MGI:2443732])

HSP 1 Score: 421.394 bits (1082), Expect = 2.518e-128
Identity = 325/1010 (32.18%), Postives = 503/1010 (49.80%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECC-------RLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKP--EISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADC----LPSVITNIRLCQSCEYLSLCTMFSRLSQ---NDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNII-------VQNSKKSIRNV--TFESSSLSGINFLIKF---NLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS------ELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFN-ILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQII 3381
            K+L VT   + + +V   L   W    V  GDI  +     S   W I++  G  ++ P  ++S TSV  S+ C R+ VL   F G S  + + M+IG+ +H +FQ+         RL+ L L  +RE+          L   Y    + +EIL E+E Y P   KW    + K P  E  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +     +PLELKTG+ + S EH  QV+LY L+  ++ E + + G LLY+K G + +    N       +K+RN L   +L   S      +     LP +I   + C+ C  +  C ++SR  +   +D+   +AM   I++ T HL     ++F  W  ++ LE  S+S +       I       ++ S   + N+  T   S +    +L  F   N P  P    + GD II+S ++ K  A+  GYV +     +  +           T  R+D    +  +  P+ NLS    LM+ ++  ++LR+ I+  + P F  +++  L    K    +I+K  N  QR+ +   + SKDY LI G PG+GKT+ I A++RI    G  VL++SYTHSAV NIL KL   ++ FL L  +H V   ++  T   I   +   +L +   L  +  +V  TC+  NH   SR  FD  I+DEA QI+ PV + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L E N   ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A +      ++  SL+ +     S       E D  V FLN      P  VE   +  N  EA++ + L   F+K G   SDIGVI PY QQ  +I ++    S   VE+NT+D+YQGRDKS++++SFV       ++ E+ +   +L D RRLNVA++RAKHKLI++G++  L + + P+  + D L A Q+I
Sbjct:   65 KRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDCTSEP-WIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISESFAPERLQELALQTLREV--------RHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGWLLYLKTG-QMYPVPANHLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNCALYSRAVEEQGDDASIPEAMLSKIQEETRHLQLAHLKYFSLWCLMLTLE--SQSKDNRKTHQSIWLTPASELEESGNCVGNLVRTEPVSRVCDGQYLHNFQRKNGPM-PATNLMAGDRIILSGEERKLFALSKGYVKKMNKAAVTCLLDRNLSTLPATTVFRLDREERHGDISTPLGNLS---KLMESTDPSKRLRELIIDFREPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKRVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKVGFLRLGQSHKVHPDIQKFTEEEICRSRSIASLAHLEELYNSHPIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLF----FSRRFVLVGDHQQLPPLVVNREARALGMSESLFKRL-ERNE-SAVVQLTVQYRMNRKIMSLSNKLTYAGKLECGSDRVANAVLALPNLKDARLSLQLYADYSDSPWLAGVLEPDNPVCFLNTDKVPAPEQVENGGVS-NVTEARLIVFLTSTFIKAGCSPSDIGVIAPYRQQLRIISDLLARSSVGMVEVNTVDKYQGRDKSLILVSFV-------RSNEDGTLGELLKDWRRLNVALTRAKHKLILLGSVSSL-KRFPPLGTLFDHLNAEQLI 1041          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Dna2 (DNA replication helicase/nuclease 2 [Source:MGI Symbol;Acc:MGI:2443732])

HSP 1 Score: 350.517 bits (898), Expect = 2.871e-103
Identity = 274/897 (30.55%), Postives = 428/897 (47.71%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECC-------RLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKP--EISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADC----LPSVITNIRLCQSCEYLSLCTMFSRLSQ---NDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNII-------VQNSKKSIRNV--TFESSSLSGINFLIKF---NLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS------ELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALES 3057
            K+L VT   + + +V   L   W    V  GDI  +     S   W I++  G  ++ P  ++S TSV  S+ C R+ VL   F G S  + + M+IG+ +H +FQ+         RL+ L L  +RE+          L   Y    + +EIL E+E Y P   KW    + K P  E  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +     +PLELKTG+ + S EH  QV+LY L+  ++ E + + G LLY+K G + +    N       +K+RN L   +L   S      +     LP +I   + C+ C  +  C ++SR  +   +D+   +AM   I++ T HL     ++F  W  ++ LE  S+S +       I       ++ S   + N+  T   S +    +L  F   N P  P    + GD II+S ++ K  A+  GYV +     +  +           T  R+D    +  +  P+ NLS    LM+ ++  ++LR+ I+  + P F  +++  L    K    +I+K  N  QR+ +   + SKDY LI G PG+GKT+ I A++RI    G  VL++SYTHSAV NIL KL   ++ FL L  +H V   ++  T   I   +   +L +   L  +  +V  TC+  NH   SR  FD  I+DEA QI+ PV + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L E N   ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A +      ++  SL+ +     S       E D  V FLN      P  VE   +  N  EA++ + L   F+K  A ++
Sbjct:   65 KRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDCTSEP-WIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISESFAPERLQELALQTLREV--------RHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGWLLYLKTG-QMYPVPANHLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNCALYSRAVEEQGDDASIPEAMLSKIQEETRHLQLAHLKYFSLWCLMLTLE--SQSKDNRKTHQSIWLTPASELEESGNCVGNLVRTEPVSRVCDGQYLHNFQRKNGPM-PATNLMAGDRIILSGEERKLFALSKGYVKKMNKAAVTCLLDRNLSTLPATTVFRLDREERHGDISTPLGNLS---KLMESTDPSKRLRELIIDFREPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKRVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKVGFLRLGQSHKVHPDIQKFTEEEICRSRSIASLAHLEELYNSHPIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLF----FSRRFVLVGDHQQLPPLVVNREARALGMSESLFKRL-ERNE-SAVVQLTVQYRMNRKIMSLSNKLTYAGKLECGSDRVANAVLALPNLKDARLSLQLYADYSDSPWLAGVLEPDNPVCFLNTDKVPAPEQVENGGVS-NVTEARLIVFLTSTFIKAAAPQT 936          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Upf1 (UPF1 regulator of nonsense transcripts homolog (yeast) [Source:MGI Symbol;Acc:MGI:107995])

HSP 1 Score: 123.635 bits (309), Expect = 6.519e-28
Identity = 155/584 (26.54%), Postives = 258/584 (44.18%), Query Frame = 1
Query: 1759 LSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLK-IPISNLSVLGSLMDKSEIGQKLRDFIVHCKPP-------LFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG-MKVLVSSYTHSAVSNILQKL------------DARE-----INFLYLNGN----HSVCE-----KLKNRT--LSYILPEKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
            + G    +++     P +K + G  I V  + G ++AI L   V +P   + +  + +     K T     + S+LK   +   SV G +  K  +G ++ D ++ C+ P       L D + ++  AVK                   +  +   LI+G PG+GKT     ++      G   VLV + ++ AV  + +K+             +RE     ++FL L+       S+ E     +LK+ T  LS    EK++  L       L+ N DV+  TC+ A    L++++F  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +     A D+V              +F W       + D+ + F     Q     +   Y N+ EA    ++  + LK GA    IG+I PY  Q+  +++ M            EVEI ++D +QGR+K  +I+S V       +A E+     LND RRLNVA++RA++ +I++GN   LS+  QP+
Sbjct:  352 MQGDEICLRYKGDLAPLWKGI-GHVIKVPDNYGDEIAIELRSSVGAP---VEVTHNFQVDFVWKSTSFD-RMQSALKTFAVDETSVSGYIYHKL-LGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKT------------------VLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSA-DEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRP---IRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVK----------KGFDFQW------PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCV-------RANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSK--QPL 879          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Upf1 (UPF1 regulator of nonsense transcripts homolog (yeast) [Source:MGI Symbol;Acc:MGI:107995])

HSP 1 Score: 123.25 bits (308), Expect = 9.334e-28
Identity = 155/584 (26.54%), Postives = 258/584 (44.18%), Query Frame = 1
Query: 1759 LSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLK-IPISNLSVLGSLMDKSEIGQKLRDFIVHCKPP-------LFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG-MKVLVSSYTHSAVSNILQKL------------DARE-----INFLYLNGN----HSVCE-----KLKNRT--LSYILPEKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
            + G    +++     P +K + G  I V  + G ++AI L   V +P   + +  + +     K T     + S+LK   +   SV G +  K  +G ++ D ++ C+ P       L D + ++  AVK                   +  +   LI+G PG+GKT     ++      G   VLV + ++ AV  + +K+             +RE     ++FL L+       S+ E     +LK+ T  LS    EK++  L       L+ N DV+  TC+ A    L++++F  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +     A D+V              +F W       + D+ + F     Q     +   Y N+ EA    ++  + LK GA    IG+I PY  Q+  +++ M            EVEI ++D +QGR+K  +I+S V       +A E+     LND RRLNVA++RA++ +I++GN   LS+  QP+
Sbjct:  363 MQGDEICLRYKGDLAPLWKGI-GHVIKVPDNYGDEIAIELRSSVGAP---VEVTHNFQVDFVWKSTSFD-RMQSALKTFAVDETSVSGYIYHKL-LGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKT------------------VLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSA-DEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRP---IRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVK----------KGFDFQW------PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCV-------RANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSK--QPL 890          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Match: Zgrf1 (zinc finger, GRF-type containing 1 [Source:MGI Symbol;Acc:MGI:1918893])

HSP 1 Score: 114.39 bits (285), Expect = 6.571e-25
Identity = 93/308 (30.19%), Postives = 147/308 (47.73%), Query Frame = 1
Query: 2464 LIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNS-TARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---------STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIH 3354
            L++ + VVGVTC +     L+ LKF VV++DE  Q+T P S++P+ +      K IL GD  QLPP ++ S  A  NGL+Q+LF +LC   H   +  L+ QYR +  I  + N + Y   +           I E E    LE+    C          F N   +  VE +  + N  EA  T++L++  +  G     IGVI  Y  Q   I N+             V+++T+D +QG +K I I+S V                 ++ ++R+NVA++R +  L+++G+L  L +N    +VI 
Sbjct: 1540 LLKQVRVVGVTCAACAFPCLNDLKFPVVVLDECSQMTEPASLLPIARFQCE--KLILVGDPKQLPPTIQGSDAAHENGLEQTLFDRLCLMGHKPVL--LRTQYRCHPAISAIANDLFYEGSLVNG--------ISERERSPVLEWLPTLC----------FYNVTGAEQVERENSFVNVAEATFTLKLIQSLMASGVESCMIGVITLYKSQMYKICNLLSAVDVGHPDVKAVQVSTVDAFQGAEKEITILSCV----------RTRQVGFIDSEKRMNVALTRGRRHLLIVGSLSCLRKNRLWGRVIQ 1815          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|Q6ZQJ5|DNA2_MOUSE (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus OX=10090 GN=Dna2 PE=1 SV=2)

HSP 1 Score: 421.394 bits (1082), Expect = 1.762e-127
Identity = 325/1010 (32.18%), Postives = 503/1010 (49.80%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECC-------RLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKP--EISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADC----LPSVITNIRLCQSCEYLSLCTMFSRLSQ---NDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNII-------VQNSKKSIRNV--TFESSSLSGINFLIKF---NLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQCCSS------ELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFN-ILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQII 3381
            K+L VT   + + +V   L   W    V  GDI  +     S   W I++  G  ++ P  ++S TSV  S+ C R+ VL   F G S  + + M+IG+ +H +FQ+         RL+ L L  +RE+          L   Y    + +EIL E+E Y P   KW    + K P  E  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +     +PLELKTG+ + S EH  QV+LY L+  ++ E + + G LLY+K G + +    N       +K+RN L   +L   S      +     LP +I   + C+ C  +  C ++SR  +   +D+   +AM   I++ T HL     ++F  W  ++ LE  S+S +       I       ++ S   + N+  T   S +    +L  F   N P  P    + GD II+S ++ K  A+  GYV +     +  +           T  R+D    +  +  P+ NLS    LM+ ++  ++LR+ I+  + P F  +++  L    K    +I+K  N  QR+ +   + SKDY LI G PG+GKT+ I A++RI    G  VL++SYTHSAV NIL KL   ++ FL L  +H V   ++  T   I   +   +L +   L  +  +V  TC+  NH   SR  FD  I+DEA QI+ PV + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L E N   ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A +      ++  SL+ +     S       E D  V FLN      P  VE   +  N  EA++ + L   F+K G   SDIGVI PY QQ  +I ++    S   VE+NT+D+YQGRDKS++++SFV       ++ E+ +   +L D RRLNVA++RAKHKLI++G++  L + + P+  + D L A Q+I
Sbjct:   65 KRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDCTSEP-WIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRG-SDPATRQMLIGTILHEVFQKAISESFAPERLQELALQTLREV--------RHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGWLLYLKTG-QMYPVPANHLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNCALYSRAVEEQGDDASIPEAMLSKIQEETRHLQLAHLKYFSLWCLMLTLE--SQSKDNRKTHQSIWLTPASELEESGNCVGNLVRTEPVSRVCDGQYLHNFQRKNGPM-PATNLMAGDRIILSGEERKLFALSKGYVKKMNKAAVTCLLDRNLSTLPATTVFRLDREERHGDISTPLGNLS---KLMESTDPSKRLRELIIDFREPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKRVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKVGFLRLGQSHKVHPDIQKFTEEEICRSRSIASLAHLEELYNSHPIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLF----FSRRFVLVGDHQQLPPLVVNREARALGMSESLFKRL-ERNE-SAVVQLTVQYRMNRKIMSLSNKLTYAGKLECGSDRVANAVLALPNLKDARLSLQLYADYSDSPWLAGVLEPDNPVCFLNTDKVPAPEQVENGGVS-NVTEARLIVFLTSTFIKAGCSPSDIGVIAPYRQQLRIISDLLARSSVGMVEVNTVDKYQGRDKSLILVSFV-------RSNEDGTLGELLKDWRRLNVALTRAKHKLILLGSVSSL-KRFPPLGTLFDHLNAEQLI 1041          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|D3ZG52|DNA2_RAT (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus OX=10116 GN=Dna2 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.524e-127
Identity = 319/1001 (31.87%), Postives = 512/1001 (51.15%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADC----LPSVITNIRLCQSCEYLSLCTMFSRLSQ--NDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNEN-------PIKNIIVQNSKKSIRNV--TFESSSLSGINFLIKF---NLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYV--VESPGTDILIISSEKPLICSKMTKL-RIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEHESINSLEFWK------CQCCSSELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFN-ILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K L +T+    + +V   L   W    V  GDI  I     S   W +++  G  +++P  L+S TSV  S+ C R+ VL   F  VS  + + M+IG+ +H +FQ+    E     +++E+A +  ++   L   Y    + +E+  E+E Y P   KW +  + K  K E  +M +                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+  ++ E + + G LLY+K G + +    N       +K+RN+L   +L   S      +     LP +I   + C+ C  +  C ++SR  +  +D+   + M+  I++ T HL     ++F  W  ++ LE  S+ + ++       P   +  + S   I ++  T     +   ++L  F   N P  P    + GD II+S ++ K  A+  GYV  +++     L+  +   L  + + +L R + +  +  P+ NLS    LM+ ++  ++LR+ I+  K P F  +++  L    K    +I+K  N  QR+ +   + SKDY LI G PG+GKT+ I A++RI    G  VL++SYTHSAV NIL KL   +I FL L  +H V   ++  T   +   +   +L +   L  +  VV  TC+  +H   SR  FD  I+DEA QI+ P+ + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L E N   ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A I + +     LEF+             E D  V FLN      P  +E   +  N  EA++ + L   F+K G   SDIG+I PY QQ   I ++    S   VE+NT+D+YQGRDKS++++SFV       ++ E+ +   +L D RRLNVAI+RAKHKLI++G++  L + + P++ + D L A Q+IS
Sbjct:   65 KHLLITVSQEGEQEVLCILRNGWSSVPVEPGDIIHIEGDCTSEP-WIVDDDFGYFILSPDMLISGTSVASSIRCLRRAVLSETFR-VSDTATRQMLIGTILHEVFQKAIS-ESFAPEKLQELALQTLREVRHLKEMYRLNLSQDEVRCEVEEYLPSFSKWADEFMHKGTKAEFPQMHLSLPSDSSDRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKTKYKIMPLELKTGKESNSIEHRGQVILYTLLSQERRE-DPEAGWLLYLKTG-QMYPVPANHLDKRELLKLRNQLAFSLLHRVSRAAAGEEARLLALPQIIEEEKTCKYCSQMGNCALYSRAVEQVHDTSIPEGMRSKIQEGTQHLTRAHLKYFSLWCLMLTLESQSKDTKKSHQSIWLTPASKL--EESGNCIGSLVRTEPVKRVCDGHYLHNFQRKNGPM-PATNLMAGDRIILSGEERKLFALSKGYVKRIDTAAVTCLLDRNLSTLPETTLFRLDREEKHGDINTPLGNLS---KLMENTDSSKRLRELIIDFKEPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQSHKVHPDIQKFTEEEMCRLRSIASLAHLEELYNSHPVVATTCMGISHPMFSRKTFDFCIVDEASQISQPICLGPLF----FSRRFVLVGDHKQLPPLVLNREARALGMSESLFKRL-ERNE-SAVVQLTIQYRMNRKIMSLSNKLTYEGKLECGSDRVANAVITLPNLKDVRLEFYADYSDNPWLAGVFEPDNPVCFLNTDKVPAPEQIENGGVS-NVTEARLIVFLTSTFIKAGCSPSDIGIIAPYRQQLRTITDLLARSSVGMVEVNTVDKYQGRDKSLILVSFV-------RSNEDGTLGELLKDWRRLNVAITRAKHKLILLGSVSSL-KRFPPLEKLFDHLNAEQLIS 1039          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|Q8QHA5|DNA2_XENLA (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis OX=8355 GN=dna2 PE=1 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 9.547e-123
Identity = 310/954 (32.49%), Postives = 485/954 (50.84%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKW-------------INRNLSKK---PEISKM-QVIDVEENIWSTKYGIKGKIDVTLQ--------TNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKF-----TSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDC--SQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKS------IRNV--TFESSSLSGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS-----ELDRSVIFLNYQ--PSF-VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRN----MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            W    +  GDI  +      +  WTI+   G L++ P  L+S TS+   + C R+ VL   F  V  + ++ M+ G+ +H IFQ        D + ++E+A      P  L   Y+      +++ EI+ Y P + KW             INR  S      E +K+ + +D+EENIWS ++G+KGKIDVT +         +   +PLELKTG+ + S EH  QV+LY L+  ++ E + + GLLLY+K G   +    N       +KIRNEL+ ++          S+ T    LP++I + + C+ C  +  C +++R + Q   +C     M  +++  T HL E   ++F  W  +  LE  S+ S     KNI + +S +       I N+  T    ++S + +L  F       P      GD ++VS ++ + +A+  GY+ E    +I  I     +   +    R+D       L+  + NLS    LM+ S + +KLR  I+    P F  H++  L    K     I++  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   ++ FL L     +   ++  +   I   K  ++L     L  +  VV  TC+  NH   +R +FD  I+DEA QI+ P+ + PL   D    +F+L GD  QLPPLV+++ AR  G+ +SLF +L E N  +++ +L +QYRMN +I+ L N + Y  ++ CA+D+V+ A + + H    +  LEF + Q         E    V FLN +  P+   E      N  EAK+   L + +LK G   SDIG+I PY QQ +MI N    +S   VE+NT+D+YQGRDKS++I+SFV  +       +    ++L D RRLNVA++RAKHKLIM+G +  L++
Sbjct:   91 WVALQIKPGDIIHLEGNCSVDNTWTISRDTGYLILYPDLLISGTSIANGIRCLRRSVLSEKFK-VCDKGSRQMLNGTMLHDIFQRATTCGFTD-SVLQELAHHTVHGPKYLKEMYQLKLNQADVMGEIQEYLPSLSKWATDFMTHPLNQQQINRTKSTAGDPTETTKVSEFLDIEENIWSPRFGLKGKIDVTARVKIHQKSKAHLKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRE-DPEAGLLLYLKTG-NMYTVPGNRLDRRELLKIRNELSYYLTNVLHKSDNGSKETTLASLPAMIADRQACKYCSQMRNCALYNRSVEQQTENCYIPPEMIPVVQKETEHLTEDHLQYFRLWYLMCTLEANSKDSKMGR-KNIWMMSSSEREEDGQCIGNLIRTGHVQTISDVQYLHSFQRRSGSVPATNLASGDRVVVSGEE-RFLALSTGYIKEVKDENITCILDRSLVKLPEDLLFRLDHEEGGGGLEFHLGNLS---RLMENSSVSEKLRKLIIDFSKPNFVQHLSSILPPDAKDIVASILRGLNKPQKQAMKRVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLKKFQVGFLRLGRTQKLHPDVQEFSEEEICKAKSIKSLSALEELYNSQPVVATTCMGVNHPIFTRRRFDFCIVDEASQISQPICLGPLFFAD----RFVLVGDHQQLPPLVKSAEARELGMSESLFKRL-ERNQ-EAVVQLTVQYRMNSKIMALSNKLVYEGRLECASDRVSNAVVQLPHIKTLLLELEFRESQESMWIKDVLEPSNPVCFLNTEKIPALETEEKGGISNWIEAKLVFHLTKLYLKAGCRPSDIGIIAPYRQQLKMISNYFNSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNI------DGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLNR 1023          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|P51530|DNA2_HUMAN (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3)

HSP 1 Score: 403.675 bits (1036), Expect = 7.126e-121
Identity = 318/977 (32.55%), Postives = 492/977 (50.36%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELT----NFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQA---MKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIV------QNSKKSIRN-VTFESSSL-SGINFLIKFNLPQK--PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEH--ESINSLEFWKCQCCSS------ELDRSVIFLNY----QPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQII 3381
            W    V  GDI  +     S+  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+          +++E+A +  ++   L   Y    + +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  QV+LY L+ S +   + + GLLLY+K G + +    N       +K+RN++     + I K  + Q T    LP +I   + C+ C  +  C ++SR  +   DCS     M   I++ T HL +   E+F  W  ++ LE  S+ + +N  +NI +      + S   I N +  E   +     +L  F       P    + GD +IVS ++    A+  GYV E   T +  +      +  + T  R+D    N  +  P+ NLS    LM+ + + +KLRD I+  + P F  +++  L    K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V   ++  T   I   K  ++L     L  +  +V  TC+  NH   SR  FD  I+DEA QI+ P+ + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L +  +  ++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A I + H  +    LEF+     +       E +  V FLN      P  VE   +  N  EAK+ + L   F+K G   SDIG+I PY QQ ++I ++   S   VE+NT+D+YQGRDKSIV++SFV  +       +     +L D RRLNVAI+RAKHKLI++G +  L+  Y P++ + + L + ++I
Sbjct:   86 WCSVPVEPGDIIHLEGDCTSDT-WIIDKDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAIN-NSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPANHLDKRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPIVMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNH-QNIWLMPASEMEKSGSCIGNLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQPICLGPLF----FSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQ--NKSAVVQLTVQYRMNSKIMSLSNKLTYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVS-NVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVSFVRSNK------DGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLN-CYPPLEKLLNHLNSEKLI 1039          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Match: sp|E1BMP7|DNA2_BOVIN (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus OX=9913 GN=DNA2 PE=3 SV=3)

HSP 1 Score: 400.593 bits (1028), Expect = 7.245e-120
Identity = 316/985 (32.08%), Postives = 489/985 (49.64%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK--KPEISKMQV--------------------IDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFI---LKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQN---DSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLIKF-----------NLPQK----PFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDL---NSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-----------MEHESINSLEFWKCQCCSSELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFN-ILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQII 3381
            W    V  GDI  +     SN  W I+   G L++ P  L+S TS+  S+ C R+ VL   F   S  + + M+IG+ +H +FQ+    +     +++E+A +  ++   L   Y      +EI +E+E Y P   KW    + K    +  +MQ+                    +D+EE+IWS ++G+KGKIDVT+        +T    +PLELKTG+ + S EH  Q++LY L+ S +   + + GLLLY+K G + +            +++RN++   +   +  ++ + T    LP +I   + C+ C  +  C ++SR  +    DS    +M   IK+ T HL     E+F  W  ++ LE  S+ +  N     ++  S+        ES S  G    I+            N  +K    P    + GD II+S ++    A+  GYV E   T +            + T  R+D    N  +  P+ NLS    LM+ +   QKLRD I+  + P F  +++  L  + K     I+K  N  QR+ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V   ++  T   I   K  ++L     L  +  +V  TC+  NH   SR  FD  I+DEA QI+ PV + PL        +F+L GD  QLPPLV N  AR  G+ +SLF +L +  + +++ +L +QYRMN +I+ L N ++Y  ++ C +D+VA A I           +E  +  S   W     + E +  V FLN      P  VE   +  N  EAK+ + L   F+K G   SDIG+I PY QQ ++I ++    S   VE+NT+D+YQGRDKSIV++SFV       ++ E+ +   +L D RRLNVAI+RAKHKLI++G +  LS+ Y P++ + + L + ++I
Sbjct:   87 WCSVPVEPGDIIHLEGDCISN-TWIIDEDFGYLILYPDMLISGTSIASSIRCMRRAVLSETFRS-SDPATRQMLIGTVLHEVFQKAVS-DSFAPEKLQELASQTIQEIRHLKEMYRLKLNQDEIKQEVEEYLPSFSKWAGDFMHKHTSTDFPQMQLSLPSDGSNSNSTCNIEVTNSLDIEESIWSPRFGLKGKIDVTVGVKIHRGCKTKYKIMPLELKTGKESNSIEHRSQLVLYTLL-SQERRADPEAGLLLYLKTG-QMYPVPAKHLDKRELLRLRNQMAFSLFHRINKSTGEKTELAPLPQIIEEQQTCKYCSQMGNCALYSRAVEQQMEDSSVPTSMWPKIKEETQHLKPIHLEYFSLWCLMLTLESQSKDNKRNYQHIWLMPASEME------ESGSCIGSLIRIEHVKTVCDGQYLHNFQRKNGAIPITNLMAGDRIILSGEERTLFALSRGYVKEINSTTVTCSLDRNLSGLPESTLFRLDQEEKNCDIDTPLGNLS---KLMENTRASQKLRDLIIDFREPQFISYLSSVLPHEAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPDIQKFTEEEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLF----FSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQ--NKNAVVQLTVQYRMNSKIMSLSNKLTYEGKLECGSDKVANAVINLPNFKDVKLELEFYADYSENPW--LIAAFEPNNPVCFLNTHKVPAPEQVEKGGVS-NIMEAKLVVFLTSVFIKAGCKPSDIGIIAPYRQQLKVISDLLAQSSVGMVEVNTVDRYQGRDKSIVVVSFV-------RSNEDGTLGELLKDWRRLNVAITRAKHKLILLGCVPSLSR-YPPLRKLLNHLNSEKLI 1040          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A4Y2AMJ2 (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Araneus ventricosus OX=182803 GN=DNA2 PE=4 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 3.029e-148
Identity = 338/960 (35.21%), Postives = 511/960 (53.23%), Query Frame = 1
Query:  646 HLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISK-----MQVIDVEENIWSTKYGIKGKIDVTLQTN----ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADC----LPSVITNIRLCQSCEYLSLCTMFSRLSQNDS--DCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVL---------EFLSESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNLPQKP-------FYKFVEGDPIIVSSDDG-KKVAIVLGYVVESPGTDILIISSEKPLICSKMTK-----LRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI---MEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIY--FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMI----RNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
             L G W D++V+VGD   ++   ++N    I+NH G LV+NP +L+S+T+V  +LFC RK  L H     S   N  M+IGS +H IFQ+          E+ +I +++ K+   LI       ++ EI  +++ Y P I  WI ++ + K ++        QV  +E+NIWS KYGIKGKID+T++T+       +PLELKTGR+T+S EH  QV LYILMM ++T+  +  GLLLY++D A   +   +  S    I++RNEL  +  K+        D     LP  + + + C  C YL  CT++ R    D   +   AM  LI   T HL     E+FVHW NL++L          F +E S     K + + N   S+     +   +  + ++I F+  +              EGD + VS +    +VAI +GY+ +     +  ++S++ L  SK+ +      RID   S        + L  LM+      KLR+FI+  +PP F   + K + +  + I+K  N  Q+RV++ A+ ++DY +IKG PG+GKTS IVA++R+   MG+ V ++SYTHSA+ NIL KL    ++F+ +     + + LK    S+    + F  +  F   +    VV  TCL+ NHA     KFDV I+DEA QI     I PL     +  KFIL GD  QLPPLV N  AR  G+ QSL  +LC     D+  EL +QYRMN EI++ CN ++YN  + C ++ VA A +      ++++S+  W  Q   SE+ +SVIF+N     +   E     N FE  +  ++++  LK    E DIGVI PY +Q ++I    R ++  ++E+NT+DQYQGRDK ++IIS V  +       +     I+ND++RLNVAISRAK KLI+IG    L+  Y+P K +    R+ QII +
Sbjct:  409 RLKGFWTDSLVNVGDSVHVLKEFENNHT-VIDNHSGFLVINPDFLLSSTAVVSTLFCMRKAALNHILPKWSS-GNNVMMIGSLVHDIFQQAVNNHISSSREINDILEKVLKKRENLICLSCQESSEAEIREKVQEYVPSIANWIQKHCTFKGKVPANSLQVTQVEGIEDNIWSPKYGIKGKIDMTVRTSFQQATKILPLELKTGRSTYSAEHIGQVNLYILMMEERTK-EMSDGLLLYLRDVANMKLVTADHNSRRGLIQLRNELAFYTSKWMQRNFDAPDIEHCHLPKPLNSKKFCGKCPYLLPCTVYQRALSEDKNLEADHAMSSLISSTTSHLNSNHLEYFVHWSNLLLLESSSAALTNAFWTEKSTYREKKGMCLSNL--SLDTNVKKIEEIGQVFYIITFHRSEDSDNSSTLSSIGLKEGDYVAVSKERSLTEVAITMGYIAKIYERSV-AVTSDRDL--SKVPQYEDCTFRIDKQVSNSATSCIRNNLMRLMENENEASKLREFIIEKQPPKFSKSLPKDVVLSGRPILKGLNKVQQRVVLKALMAEDYFIIKGMPGTGKTSTIVALVRLLSSMGISVFLTSYTHSAIDNILLKL-KDHMSFVRIGQEARIHQTLKK--FSFETLTRDFTTVDQFKAFMTQQMVVAATCLAVNHAVFKIKKFDVCIVDEASQINQIACIGPLF----HAKKFILVGDDKQLPPLVVNEKARERGMQQSLLERLCS---ADNCMELVIQYRMNKEIMRFCNELTYNGALQCGSEDVATAVLNLDGLKDNMDSIPNWIIQTLQSEIQKSVIFVNTDQVNISHSEKAQDMNDFEVNLVQDILQVLLKCKVSEWDIGVITPYRRQVDLIEDKLRKVNVNDIEVNTVDQYQGRDKDVIIISCVKHNKSTTDCEKKGI--IINDEKRLNVAISRAKRKLIIIGCKSSLAI-YEPFKNLIKCFRSEQIIDL 1347          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: T1IXE8 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 3.255e-140
Identity = 344/965 (35.65%), Postives = 534/965 (55.34%), Query Frame = 1
Query:  601 LTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINR---NLSKKPEISKM-QVIDVEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILK-FTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLS-QNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLE--------FLS----ESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNLPQKPFYKF----VE-GDPIIVSSDDGKKVAIVLGYVVESPGTDILII----SSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPE--KKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQ--PSFVEADEIYF-NKFEAKITMELVEQFLKIGALESD-IGVIIPYNQQKEMIR------NMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQI 3378
            L+V  E++ +C     L   W  T V + DI +I+    SN + TI+N  G+++VNP +L+S TSV  SLFC RK VL   F G S  +N  MVIGS IH IFQE    +      +  I+K +    S L   Y +G  + E++ EI+ + P+IL W  +   N  K  +  K+  + D+EENIWS +YG+KGKIDV        IP+ELKTGR++FS EH  QV+LY +M SD+   + + GLL+Y++DG  + +  +++      I++RNEL ++I +    +++     LP  + + RLC  C Y ++C ++S L  +N       M+ LI +  GHL E   ++F+ W +L+ LE        F++    ++S+E   K +     K   ++   E+S+  G+ F++KF+             VE G+ +IVS +  K+ AI  G V +   T + +      S +P   S +   R+D  +S  +       L  L+D +++  KLR  I+  + P F   +T S+ +  K I+K  N  Q R ++ ++ ++DY LIKG PG+GKTS IVA++R+  L+G  VL++S+THSAV NIL KL    I+FL L      C K+      +   +  +K   + +     E+ ++   TCL +N+  L R +FD  IIDEA Q+     + PL   +    +FIL GD LQLPPLV+N  AR NG+DQSLF  L   +  DS  +L +QYRMN  I+ L N + YN ++ C +D++A +TI     +N+L   K +  S+ L+ SV+F++    P+   +D +   N  EA+I +++V + LK  A   D IG+I  Y+ Q + IR      N+ST  VE+NT+DQ+QGRDK ++++SFV  +  + K  E     IL D RRLNVAI+RAKHK I+IG++  L+ NY P+  +  +++ N I
Sbjct:  347 LSVRSEED-ECVKTCKLKDFWVQTNVKLNDIVNILSTFDSNQVATIDNTNGLIIVNPDHLLSGTSVVSSLFCMRKSVLMEQFRG-SDPANFIMVIGSLIHQIFQEALCKQAFTAQAIGVISKNILMHNSNLHAIYSAGSNETEVMEEIQKFIPQILLWFQQYVPNTKKSGDFIKVTDIYDIEENIWSPRYGVKGKIDV--------IPIELKTGRSSFSPEHEGQVILYSMMCSDRRS-DPEGGLLVYLRDGKTKEVKAEHNQKR-GLIQLRNELIHYIDQPVNENEIGVVHSLPETLNSNRLCSRCPYATVCCVYSSLDDRNILPSDHEMRVLIPEFAGHLSEAHKKYFMKWQHLLRLESSLSRKFSFINGIYCQTSDERQKKGLAFSQMKVERKDSISETSN--GL-FMMKFSKTSDAQSSLDNTDVEIGEMVIVSCEATKEFAIASGTVRDVKKTYVQVEIDKNLSLRPDFSSAV--FRLDRYTSGNVTAIAAGSLIKLIDNNDMSAKLRRLIIDGERPQFIERLTDSVLIG-KKILKKLNSSQTRAVIKSLTAQDYFLIKGMPGTGKTSTIVALVRLLDLLGYSVLLTSHTHSAVDNILIKLKNYGIDFLRLGK----CSKIHPDIHPFAAEKLVQKLTTVKDLKEFYESKNIYATTCLGSNYTCLQRKRFDFCIIDEAAQVVQIACLGPLFYSN----RFILIGDPLQLPPLVQNRMARKNGMDQSLFELL---DSADSTIDLNIQYRMNKTIMSLANELVYNGRLKCGSDEIARSTI----KLNNLT-SKSKLFSTLLEDSVVFIDTDRIPAPELSDNLGIKNAVEAEIILQIV-KLLKKDAFNMDEIGIISIYSAQVKNIRELLLQNNIST--VEVNTVDQFQGRDKEVILVSFVRSTPNMNKLGE-----ILFDFRRLNVAITRAKHKAILIGSISTLT-NYPPVNKLIQIVKENTI 1268          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A1S3GZW9 (DNA replication ATP-dependent helicase/nuclease DNA2 OS=Lingula unguis OX=7574 GN=LOC106150783 PE=4 SV=1)

HSP 1 Score: 463.381 bits (1191), Expect = 5.419e-138
Identity = 324/977 (33.16%), Postives = 508/977 (52.00%), Query Frame = 1
Query:  649 LDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINR-------NLSKKPEISKM---QVIDVEENIWSTKYGIKGKIDVTLQTN-------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFI------LKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESS-----------SLSGINFLIKFN------LPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTK---LRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP------EKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-------MEHESINSLEFWKCQCCSSELDRSVIFLNYQ----PSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMI--RNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPEN-NSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
            L G W DT+V  GDI +++     +G+  I++++G+LV+NP  L+S TSV G+++C RK +L     G     N AM+ GS IH +FQ   +      ++V  I K + +Q   LI  Y    T+  +  EI+ Y P +L W  +       +   +P  S +   +V+D+EENIWS +YG+KGKID+T+Q         E  +PLELKTG+ +FS EH  QV LY LM SD+ E +   GLLLY+KDG+ + I  D +      +++RNEL +++      ++  S    +   LP  I N R C  C  L  C ++ R +  +D     AM  LI     HL +   E+F HW    +L+ L    +   +K+I  +++++  +     S            +L   +F+  F+       P+     F +GD ++VS      +A+    VV+   T+I +I  ++ L  + +      R+D N S     SN + L  L+  +    +LR+ I+  + P F+  + K    K+KHI K  N  Q+  I+  +  KDY+L+KGYPG+GKTS IVA++RI   +G+ +L++SYTHSAV NIL KL   ++ FL L          ++R    ILP       K  + + +         +V  TCL  NH   ++ +FD+ IIDEA Q+  P    PL        KF+L GD  QLPP+V+++ AR  G+D+SLF +L   ++  +  EL LQYRMN  I++L N + Y   + C +  VA A +       +  E    +  W  +C  S   + V+FL+          +A  +  N  EA+I  +L + FL+ G    ++G+I PY  Q +++  R   + EVE+NT+DQYQGRDKS++I+SFV  + K   + +      IL D RRLNVA++RAKHKL+ +G++  L + YQP++ +  +L   +I  I
Sbjct:  390 LSGFWTDTLVQPGDIVNVLGDFDDSGVCHISDNQGLLVINPDVLISGTSVVGTVYCMRKTLLNEKLRGCD-TGNMAMLHGSIIHALFQAVVQQRAFSKDKVEAIVKEILQQKKFLIEMYGQDATEAVVRAEIDKYIPPMLAWTEKYMPPPVHSFGARPSTSDLHVTKVMDIEENIWSPRYGVKGKIDLTVQVKINGKQKCEKVMPLELKTGKPSFSIEHQGQVTLYSLMSSDRRE-DPGGGLLLYLKDGSMKTITADYAKKR-GLLQLRNELVHYLSLNTEKVESESGTTYHLPKLPRPINNPRSCSKCPQLLNCAVYQRSIDHHDLPDDHAMTSLIPATLAHLHQSHLEYFSHWC---LLQELEAKESYKSLKDIWCKSAEQREKEGNCLSDMVLMDRHDAVLALDNGSFIHTFHKQPSKQSPKISLAGFSKGDSLVVSGQTSGHIALCTASVVQVTQTEITVIL-DRNLQNTNLNSDAVYRLDKNDSFNSMASNYTNLSKLLSDNPHSLRLRELIIDARKPEFELTLAKGAIEKVKHIFKSLNKPQKTAILKILMCKDYVLMKGYPGTGKTSTIVALVRILHQLGLSILLTSYTHSAVDNILLKLKKLDLEFLRLG--------RESRIHPEILPYSEGTLTKNIKTVGDLAEFYTAKQIVATTCLGTNHVLFTKRRFDICIIDEASQVLQPTCFGPL----SCAAKFVLVGDPKQLPPVVQSTEARELGMDESLFMRL---DNTGATYELNLQYRMNSSIMRLSNELVYEGALKCGSQDVAEARLQLSNMEDVRAELSGMMPAW-LECALSP--QPVLFLDTDNISATESYDAQGLVKNDLEAEIVCQLAKCFLRGGLSPQELGIIAPYRNQVKVLHTRLGGSGEVEVNTVDQYQGRDKSVIILSFVRSNSKDDSSSKGRGGTEILCDWRRLNVAVTRAKHKLLFVGSVSTL-KKYQPLQKLIQILNPEEICQI 1340          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A443SN15 (DNA replication ATP-dependent helicase/nuclease DNA2-like isoform X2 OS=Leptotrombidium deliense OX=299467 GN=B4U80_08236 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 4.561e-131
Identity = 318/976 (32.58%), Postives = 505/976 (51.74%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEI-----SKMQVI---DVEENIWSTKYGIKGKIDVTLQTN--------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTM----FSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLI-----------KFNLPQKPF----YKFVEGDPIIVSSDDG----KKVAIVLGYVVESPGTDILIISSEKPLICS-KMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPE-KKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQ--PSFVEADE--IYFNKFEAKITMELVEQFLKIGALE-SDIGVIIPYNQQKEMIRNM--STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQI 3378
            + L + L+ N K  +K  L G W  T + VGD  +++  + ++ +  ++ + G+++VNP  L+S+TS++ S+FC RK  L   F   S  +NK M IG  +H +FQ  C +      E+ ++   + +Q   L   Y +  + E+ +  + VY P I++W+ + +   P +      K +V+   D+E+NIW T  G+KGK+DV LQ            +IPLELKTG+ +FS EH  QVLLY +MM++ T+ + D GLLLY+K+  +            S ++ RNEL  +        L + +  P  + N RLC SC+ L  C+M    F  +   DSD  +   +L+     HL +    FF  W+ L  +E     ++   +K+   +N+      V  E    +  N +I           + N   +PF         GD + +S D G     ++A V+G++ +    +I + + EK L  S + T LR+DL +S KI    L+ L  LM   +    LR++I+       D  I K +    + I+   N  Q++ ++ ++ ++D+ LI G PGSGKT+ IV+++R+   M  ++LV+SYTHSA+ NIL K    +INFL L     +  +L+  +L   L      E    F++   NI VV  TCLS NH      KFD  I+DE  Q+ L  S+ PL        +FIL GD  QLPP+V+N  AR  G DQS+FS LC+ N       L +QYRMN EI+++ + + Y+  + C + ++A +T+++  +    + W  +   + L +SVIFLN    P+  E D   +  N+ EAKI M +V   LK   ++ SDIGVI PY +Q E++R M     ++EINT+DQYQGR               +  + E  +  +L D+RRLNVAI+RA+ KLI++G+   LS  Y+P   +  +L+ +QI
Sbjct:  231 RDLILQLQHN-KITLKCILRGFWSMTNIKVGDSVTVLSNVFADNIVFVDENNGVIIVNPEILISSTSLSSSVFCMRKTWLNEKFVK-SCSTNKEMFIGCIVHELFQNACMMRIKTEQELVKVLDSIIRQSYVLDGCYANKMSTEQFMSHLNVYIPSIVEWMQKYVDADPSLLTSRDEKFRVVKFHDIEDNIWCTDLGLKGKVDVNLQVEIHENKKVIRKSIPLELKTGKASFSFEHEGQVLLYSMMMNEITDSSCDTGLLLYLKEKPQMKFLKVKENVRSSLLQRRNELVQY--------LNDQEVGPPPLNNQRLCYSCDSLFPCSMMFKSFGEMKLTDSDVMRF--ELVPKILDHLSDNHINFFQKWVKLTHMEMSVRDTDRKSLKSFWKENA------VEREQKGFAFANVIIANNVDLEYTLKRINTDCRPFNVKNTCIRVGDRVALSEDKGISMKSRIAFVIGFISKVEEANIYL-TLEKTLNNSFEETTLRVDLLASDKIFSQYLANLLQLMAPEKRESNLRNYIIDGVKAKRDVDINKRILPLCQPIISSLNISQQKAVLKSVQAEDFTLICGTPGSGKTTTIVSIMRVLTAMKKRILVTSYTHSALDNILLKFKKFDINFLRLGFYSRIHPELRKYSLESQLGSLSSVEETKQFYS---NISVVASTCLSLNHPIFELTKFDYCIMDETSQVNLLASLRPLFIT----KRFILVGDSKQLPPVVKNHEARRQGFDQSIFSLLCDEN----TVNLTIQYRMNQEIMRVASELMYDGLLECGSREIATSTLIKRSTCQFEKLWLEEILDNSLTKSVIFLNTDEVPAIEEQDRNNLICNRIEAKIVMLIVNNLLKNFDIKCSDIGVITPYAKQVEILREMCNERTQIEINTVDQYQGR------DKDAVLISTVVSSTEQTTKELLKDKRRLNVAITRARKKLIIVGSQKTLSL-YKPFIHLFSLLKQHQI 1169          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Match: A0A4W3IJH4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=dna2 PE=4 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 2.524e-130
Identity = 321/987 (32.52%), Postives = 486/987 (49.24%), Query Frame = 1
Query:  595 KQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQVI-----DVEENIWSTKYGIKGKIDVTL------QTNEST--IPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFIL-KFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCS---QAMKDLIKDNTGHLCEKDYEFFVHWINLIVLE--------------FLSESSNENP---IKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRS-----------VIFLN-YQPSFVEADEIY--FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTME-----VEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            K LT+T         +  L   WE T +  GDI   V+    +G W IN   G L+ NP +L+S TSV  S+ C R+ VL       S +  + M+ G+ +H IFQ+         + +++I  +  +    L   Y    +  E+L+EI  Y P I+KW    +   P  SK  +      D+EENIWS ++GIKGKIDVT       Q+   T  +PLELKTG+ + S EH  QV+LY L+  ++ E + + G LLY+K G   +    N       +K+RN+L  ++      S    A  LP V+++   C+ C  L  C ++SR  + +   S     +K ++   T HL     ++F  W  L ++E               LS    E     I  ++   + ++I +  ++   +    F+        P    + GD ++VS  + + +A+  GY++    + I  +           T  R D +  +     +L+ L  LM+ S +  KLR+ IV  +PP F  H++  L  ++K    +I+K  N  Q++ +   + S+DY LI G PG+GKT+ I  ++RI    G  VL++SYT+SAV NIL KL   ++ FL L     V   ++  T   I   K    L     L  +  VV  TC+   H   SR +FD  I+DEA QI  P+ + PL   D    +F+L GD  QLPP+V++S AR  G+D+SLF +L E NH D++  L +QYRMN +I+ L N + Y  ++ C ++QVA AT+        L  W      +ELD S           + FLN  +    E DE Y   N  EA++   L    LK G    +IG+I PY QQ + I  +   E     VE+NT+D+YQGRDKS++I SFV  +       + N   +L D RRLNVA++RAKHKLIM+G +  L + Y P++ + D L A Q+IS
Sbjct:   65 KHLTITASQLGDSTEQCVLQDDWESTDIKPGDIVH-VEGENFSGPWVINRDCGYLIWNPDHLISGTSVANSIRCMRRAVL-------SERGTRQMLFGTLVHEIFQKAATSHGFTEDALQKITSKTLRALKYLGEMYSLKLSQAEVLQEISEYVPSIIKWAEDFMHNSPWPSKHSITVTDIEDIEENIWSPRFGIKGKIDVTASVKIHRQSKSQTRIMPLELKTGKESNSIEHRSQVILYTLLSQERRE-DPEAGFLLYLKTGTV-YPVPGNRMDRRELLKLRNQLAFYLANGVVQSSTPKAGLLPPVVSDRLACKFCSQLRNCALYSRAIEEEQAASFVPAELKPVLDQETEHLTRGHLQYFSLWYLLCIMEANTMDSKGGRRLIWMLSAEEREQQGGCIGYLLRNGAAQAISDGQYQHQFIRKNGFI--------PDTALMAGDRVVVSGQEKQLLALSSGYIIGVTESQITCVLDRNLSKLPAETIFRFDHDEGVVGVNYHLANLSKLMEASAVSTKLRELIVDHRPPQFIPHLSTVLPQEVKETVANILKGLNKPQKQAMKRVLLSRDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLASYTNSAVDNILLKLARFKVGFLRLGRVQKVHPNIQKFTDEEICKRKSVHTLAELEELYSSELVVATTCMGVKHPIFSRRRFDFCIVDEASQINQPICLGPLFYAD----RFVLVGDHQQLPPIVQSSEARALGMDESLFKRL-EQNH-DAVVYLNVQYRMNSKIMSLSNKLVYEGKLVCGSEQVAAATL-------QLPRW------NELDSSWLKDALEPRHPICFLNTAKVPAPETDEPYGLGNVTEAQLVYHLTAVLLKAGCRGCNIGIIAPYRQQLKTISALLAKEAAFSAVEVNTVDKYQGRDKSVIIASFVRSNR------DGNLGELLKDWRRLNVAVTRAKHKLIMVGCVPTL-RRYAPLEKLLDNLSAEQMIS 1007          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:103040169])

HSP 1 Score: 408.683 bits (1049), Expect = 3.709e-121
Identity = 323/1040 (31.06%), Postives = 502/1040 (48.27%), Query Frame = 1
Query:  454 FDDCFNDDFKWDESLIEDKIKQISPNKIQDQDFYYX---XXXXXXXXXXXKQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQV------------------------IDVEENIWSTKYGIKGKIDVTLQTN---------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILK--FTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQN-DSDCS-QAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRN------------VTFESSSLSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPL--ICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIM---EHESINSLEFWKCQC-------CSSELDRSVIFLNYQ--PSF--VEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIK 3345
            FDD   ++ K  +S +E KI +         + Y+             + K LT+T   + +      L   WE T V VGDI  +     SN  W I    G LV+ P  L+S TS+  S+ C R+ VL   F    G S K M+ G+ +H +FQ+          ++ ++A       + L   Y    T  ++ +E+E Y P + +W    L       K Q+                        +D+EENIWS ++G+KGKIDVT             +  +PLELKTG+ + S EH  QV+LY LM S++  ++ + G L+Y+K G    I   N       IK+RN L + + K     +  +    LP+V+++ + C+ C     C +++R  +    +CS +  +  ++  + HL +   ++F HW+ L  LE  +  S +   +NI +Q++++  +N            VT  S  +    F  +    ++       GD I VS  + + + I  GY+     T +   S +K L    S M   R+D +       ++L  L +LM+ +   +KLR  IV  KPPLF   ++  L  + K    +I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL   +I FL L     V   +   T  +    +    L    NL     +V  TC+   H   SR +FD  I+DEA QI+ PV + PL        +F+L GD  QLPP+V+N+ AR  G+D+SLF +L   +  +++ +L +QYRMN  I+ L N + Y  ++ C +++ A A +       ++  LE + CQ         + E  + V FL+    P+   VE   +  N+ EA +   L+   LK G    DIGVI PY QQ + I N+    +   VE+NT+D+YQGRDKS++I+SFV  +      PE N   +L D RRLNVAI+RAKHKL+M+G+   L + Y P++
Sbjct:  349 FDDGMEEEPKQQKSKLEKKIPENVVLAAGLHNRYWVLDVQETTGSKGYSEKHLTITFSKSREPTETCILKDGWESTPVAVGDIIHLEGESISN-TWVIGRDSGFLVLLPDLLISGTSIASSIRCMRRAVLGEMFKSFDGGS-KQMLNGTIVHDVFQKAAMSMDFSSAKLAKLASEALLSLNYLGQMYSLKLTQADMKQEVEEYLPALSEWAKAYLHTSQHAGKKQLSLKLPSDGQLSRQDSSCSITVTDFVDIEENIWSPRFGLKGKIDVTAGVRIHRKGRKHMDKVVPLELKTGKESNSIEHRSQVILYTLMSSER-RVDAEAGFLVYLKTGNLHPIVG-NHMDRRELIKLRNLLAHHVGKSIVKENGKSQMAPLPAVVSDQQTCKYCPQRRNCAVYNRAVERVPGECSPEDPQAFLQLESEHLSQVHLQYFNHWLLLCSLEAHTMES-KGGRRNIWLQSAQEREKNGGCVGNMVLRDNVTAISDGVYAHYFERRPG--EQTLISLAVGDRIAVSDQNCRFIGIATGYIRGITSTGV-TCSLDKNLSKFPSDMV-FRLDQDEGAGGLSTHLGNLSTLMENTPTSEKLRQLIVEFKPPLFIESLSSVLPREAKDTVANILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILHACGFSVLLTSYTHSAVDNILLKLKKFKIGFLRLGRAQKVHPDILPFTEEHSR-ARGIHTLEQLENLYNKELIVATTCMGVKHPIFSRRRFDFCIVDEASQISQPVCLGPLFYAQ----RFVLVGDHQQLPPIVQNAEARALGMDESLFKRL--EHQKEAVVQLNVQYRMNSVIMSLSNALMYEGKLECGSERTASAVLQLPYRESTVRELEMYVCQPQYTTWVQAALEPQKPVCFLDTSEVPAMETVEKGGVS-NQTEAVLVHSLISLLLKAGCKAGDIGVIAPYRQQLKAISNLLEGAAFTAVEVNTVDKYQGRDKSVIIVSFVRSN------PEGNLGELLKDWRRLNVAITRAKHKLLMLGSAPTL-RLYAPLQ 1364          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: upf1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:103031971])

HSP 1 Score: 122.479 bits (306), Expect = 1.168e-27
Identity = 153/583 (26.24%), Postives = 255/583 (43.74%), Query Frame = 1
Query: 1759 LSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLK-IPISNLSVLGSLMDKSEIGQKLRDFIVHCKPP-------LFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG-MKVLVSSYTHSAVSNILQKL------------DARE-----INFLYLNGN----HSVCE-----KLKNRTLSYILP-EKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
            + G    +++     P +K + G  I V  + G ++AI L     S G  + +  + +     K T     + S+LK   +   SV G +  K  +G ++ D I+ C+ P       L D + ++  AVK                   +  +   LI+G PG+GKT     ++      G   VLV + ++ AV  + +K+             +RE     ++FL L+       S+ E     +LK+ T       EK++  L       L+ N DV+  TC+ A    L++++F  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +     A D++              +F W       + D+ + F     Q     +   Y N+ EA    ++  + LK GA    IG+I PY  Q+  +++ M            EVEI ++D +QGR+K  +I+S V       +A E+     LND RRLNVA++RA++ +I++GN   LS+  QP+
Sbjct:  337 MQGDEICLRYKGDMAPLWKGI-GHVIKVPDNYGDEIAIEL---RSSAGAPVEVPHNFQVDFVWKSTSFD-RMQSALKTFAVDETSVSGYIYHKL-LGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVK------------------TVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSSDEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRP---IRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRIK----------KGFDFQW------PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCV-------RANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSK--QPL 864          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: ighmbp2 (immunoglobulin mu DNA binding protein 2 [Source:NCBI gene;Acc:103034943])

HSP 1 Score: 108.997 bits (271), Expect = 1.417e-23
Identity = 107/440 (24.32%), Postives = 183/440 (41.59%), Query Frame = 1
Query: 2158 QRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLF-------------------------------NFHNLIENIDVVGV--------TCLSANHAA--------LSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICE-LKLQYRMNIEILKLCNTISYNNQITCATD-------QVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM---STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMI 3303
            Q+  +  A+  KD  +I G PG+GKT+ +V +I   V    KVL  + ++ AV N++++L   +   L L     + E ++  +L  ++ +    N+                                +    +++ + V +          L+ N  A        L    FD+V+IDE  Q       + LLK      K IL GD  QLPP +++ TA   GL  SL  +L +  + DS+   L  QYRMNI I++  +   Y  ++T            +A    +E  S+  L      C  +EL+ +             ++   N+ E  I    V+   + G    DI VI PYN Q +++R        E+EI ++D +QGR          +    L ++        L + RR+NVA++RA+ +L+++
Sbjct:  194 QKEAVSFALSQKDVAIIHGPPGTGKTTTVVEVILQAVKQDQKVLCCAPSNVAVDNLVERLAKSKAKVLRLGHPARLLESVQKHSLDAVVAQSDSSNIIADVRKDMDKAFSQIKKVRDKGQRSSLRREIGDLRKELKSREEVAIKQILKKASVVLATNTGASDDGPLKYLPSEHFDLVVIDECAQALESSCWIALLKAR----KCILAGDYKQLPPTIKSQTAAAKGLSVSLMERLIQ-KYGDSVVRMLTTQYRMNIAIMQWASEQMYQGRLTAHPSVEKHLLKDLAGVAHVEETSMPLLLIDTAGCGLNELEDT------------DEQSKGNQGEVDIVSVHVKALTEAGVHAKDIAVIAPYNLQVDLLRQKLSNEHPELEIKSVDGFQGR-------EKEAVLLSLVRSNRKGEVGFLAEDRRINVAVTRARRQLMVV 609          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: mov10a (putative helicase mov-10-B.1 [Source:NCBI gene;Acc:103034927])

HSP 1 Score: 102.064 bits (253), Expect = 2.284e-21
Identity = 128/459 (27.89%), Postives = 208/459 (45.32%), Query Frame = 1
Query: 2149 NPDQRRV---IMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG--MKVLVSSYTHSAVSNILQKLDAREINFLYLNGNH--SVCEKLKN-RTL---------------SYILPEKKFENLFNFHNLIENIDVVGVTCLSANH---AALSRLKFDVVIIDEAGQITLP---VSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN------HPDS-------ICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNY---------QPSFVEADEI-----YFNKFEAKITMELVEQFLKIGALE-SDIGVIIPYNQQKEMIRN-MSTM-------EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            NP+Q      I+S        LI G PG+GKT  +V  I+     G    VL  + ++SA   + ++L        Y++G+H   +C   ++ RT+               S+ILP K  E L  +        V+ VT ++A       +    F  V IDEAGQ   P   V I  LL  +  KG+ +L GD  QL P++R+  A+ +GL  SL  +L   N      H  S       + +L   YR +  IL++ N + Y+N++    DQ      ME E+    E    Q         VIF             PSF    EI     Y  K      ++L +    +  L+ +DIG+I PY +Q E IR  + T+       ++++ +++++QG++K ++++S V  S    K  ++ +   L +++R NVA++RAK  LI++GN   L++N
Sbjct:  516 NPEQSTAVQHILSGHSKPGPYLIFGPPGTGKTVTLVEAIKQVNRSGTVAHVLACAPSNSACDLLCERL------LRYVDGHHLYRLCASSRDPRTMPQKLLKHSNWDEGQDSFILPSK--ETLMGY-------SVIVVTLITAGRLVSGGVPVGHFTHVFIDEAGQAVEPECVVGIAGLLHPE--KGQVVLAGDPQQLGPILRSPLAQQHGLGLSLLERLMTQNSLYQKTHDGSQAYNSCFVTKLLRNYRSHPAILEIPNELFYDNELQVFADQ------MEREAFCHWEHLPKQGF------PVIFHGVMGKDEREANSPSFFNVSEIEVLISYLQK------LKLTQGKKGLPKLKPADIGIIAPYRKQVEKIRKALQTVKELKQWNDIKVGSVEEFQGQEKRVIMVSAVRSSISYVKMDQDFNIGFLTNEKRFNVAMTRAKALLIVVGNPVILNKN 939          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Match: ENSAMXT00000014945.2 (Mov10 like RISC complex RNA helicase 1 [Source:NCBI gene;Acc:103044404])

HSP 1 Score: 100.523 bits (249), Expect = 6.456e-21
Identity = 115/422 (27.25%), Postives = 194/422 (45.97%), Query Frame = 1
Query: 2149 NPDQR----RVIMSAIFSKDYLLIKGYPGSGKTSCIV-AMIRIF-VLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENID------VVGVTCLSAN---HAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKL-------CEFN--HPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVE--ADEIYFNKFEAKITMELVEQFLK-----IGALESDIGVIIPYNQQKEMIR----NMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGN 3309
            NP QR    R++        Y+L  G PG+GKT  +V A+++++  + G ++LV + ++SA   I  +L   E  FL           L     +  L E   E L  +    E+I       +V  TC SA       L    F  V +DEAGQ T P + +PL  + +  G+ +L GD  QL P+V++  A   GL  SL  +L       C  N  +P  + +L   YR +  +L L + + Y  ++   + +    ++     + +  F             +IF   + S +   ++  +FN  EA   M    Q  K     I A  +DIG+I PY +Q E IR     +   ++++ +++++QG++  ++I+S V  ++ L  +   N    L++ +R NVAI+R+K  LI IGN
Sbjct:  741 NPAQRQAVKRILGGECRPTPYVLF-GPPGTGKTITLVEAILQVYHRVTGSRILVCTPSNSAADLICIRL--HESGFL-------PAASLARVNATCRLEESIPEVLHQYSRAGEDIRNACFHRIVVSTCSSAGMFYQIGLRIGHFTHVFLDEAGQATEPEAQIPLGLLSERTGQIVLAGDPKQLGPVVKSKLAEAFGLGVSLLERLMANPLYSCSENGYNPLLVTKLVYNYRSHEVLLALPSRLFYGGELCVRSQRSVVDSLCHWGRLPTKGF------------PLIFHGVRGSEMREGSNPSWFNPVEAVQVMLYCCQLAKRLYNPIPA--TDIGIISPYRKQVEKIRVLLHKVGLGDIKVGSVEEFQGQEFLVIILSTVRSNEDLSGSDLQNVLGFLSNPKRFNVAITRSKALLITIGN 1138          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: DNA2 (DNA replication helicase/nuclease 2 [Source:HGNC Symbol;Acc:HGNC:2939])

HSP 1 Score: 281.567 bits (719), Expect = 2.293e-80
Identity = 233/840 (27.74%), Postives = 351/840 (41.79%), Query Frame = 1
Query:  601 LTVTLEDNYKCQVK-----LHLDGMWEDTVVHVGD--ICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPE---------------------------ISKMQVIDVEENIWSTKYGIKGKIDVTL--------QTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFT----------------------SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMK----------DLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNL----------PQ-----------------KPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPI-SNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIK----HIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLN-------GNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKL-CEFNHPDSICELKLQYRMN 2778
            LT  L+D++          LHLDG  E   +  G+   C+ V    +  +  + N  G +VVNP  L+S T+VT  + C R+ VL   F G      + M++G+ +H +FQ            +R  A     Q   L   Y+ G +  E+L E+E YF  I +W +R L   PE                           +S   + DVEE++WS ++G+KGK+D           + +   +PLELKTG+ + S EH  QV+LY  +++ +   +   G LLY+K G    +       +   IK+RN+L + +                            Q      LP  I  I  C++C  L  C ++ R  + ++  S  +            L+ + T HL      +F  W  L +LE  +E          ++   ++  + +     +L G                   PQ                  P      GD +IVS  D   +AI    V+     ++                  +D++ S    + ++L  L  L+  +    KLR+ ++  K P F   ++  L V  K     I+K  N  QR+ +   + S+DY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL    + FL L        G H+  E+   R      PE+          L E   VV  TC+   HA  SR  FD  I+DEA QI  PV +  LL    +  +F+L GD  QLPPLV NS AR  G+D+SLF +L C   H +++  L LQYRMN
Sbjct:   48 LTCVLKDDWALAPVSVGDVLHLDGAVE-VPLRGGEEATCASV----TAAVLEVTNDAGFVVVNPDLLLSGTTVTNGIRCPRRAVLSERFKGGGEWGTRQMLLGTLLHEVFQRAALQRDFSDAALRSAASATLAQLQHLAEMYKLGVSQAELLGEMEEYFSAIGRWASRYLEGGPEPNSASHGLRMPIKITRRAGEGDASACTVSVCHLGDVEESVWSPRFGLKGKVDAMATVRIHRRARCDGKKVPLELKTGKESQSIEHKAQVVLYTTLLTQERWGDPGLGFLLYLKSGGMHPVPASRL-DMRELIKLRNQLAHSLANGVWWPPRTAASGAGAGGRRKEEEEDRQEPRPAPLPEPIAEIFTCRNCSQLGNCAVYHRAVEEEARGSSDVPASSSWPVEFVSLLAERTQHLSPAHLRYFSRWYLLCLLEAQTEQCKGGRHNLWVLPPHERQAKGLCVCDLTLLGPAVATPDGRFFIQRFRRRGPQGGWGAAGLTPDLEGQGSAPQGCVAVGDRVIVSGKDPATIAIATATVLSVTNEEVQCQVDRDLGRFGAAFLFSLDVDESFSGSVDTHLGNLSRLLSNTPASAKLRELVIDLKRPEFLERLSDVLPVDAKDTVAQILKGLNRPQRQAMKRVLLSRDYTLIVGMPGTGKTTTICTLVRILHACGHSVLLTSYTHSAVDNILLKLVPHRVPFLRLGRPAKVHAGVHAFTEEELCRQHDVRTPEQ-------LQQLYEGQRVVATTCMGLRHAIFSRRVFDFCIVDEASQIGQPVCLGLLL----HASRFVLVGDHHQLPPLVLNSRARAMGMDESLFKRLEC---HAEAVVYLNLQYRMN 867          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: ighmbp2 (immunoglobulin mu DNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050419-258])

HSP 1 Score: 122.094 bits (305), Expect = 1.209e-28
Identity = 107/448 (23.88%), Postives = 182/448 (40.62%), Query Frame = 1
Query: 2158 QRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILP---------------EKKFENLFN----------------------------FHNLIENIDVVGVTCLSANHAALSRL----KFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITC----------------ATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMST---MEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMI 3303
            QR  ++ A+  ++  +I G PG+GKT+ +V +I+  V  G KVL  + ++ AV N++++L    +  L L     + + +++R L  +L                +K    L N                              N++++ DV+  T   A      +L     F V ++DE GQ     S +PLL+      + +L GD  QLPP + +  A   GL  SL  +L E     ++  L +QYRMN  I+   +   Y  ++                  ATD+ A A ++       ++   C    +EL                ++   N  E  I    V+  +  G    DI VI PYN Q +M+R   +    E+EI ++D +QGR          +    L ++        L + RR+NVA++RA+  L ++
Sbjct:  199 QREAVIFALAQREVAIIHGPPGTGKTTTVVEIIQQTVRRGEKVLACAPSNVAVDNLVERLACAGVRVLRLGHPARLLDSVRSRCLDAVLARGDDAGIVRDVRSDMDKVHAKLRNGSERGERARLQAEMRSLRKELREREDTAMRNILQSADVILATTTGAWAGGPLKLLPPAHFAVAVVDECGQAVEAASWLPLLQAP----RCVLAGDHRQLPPTIVSQRAAEGGLAVSLMERLVERLGSSAVRMLTVQYRMNAAIMDWASQHVYQGKLEAHPSVASHLLKDLPGVEATDETALALLL-------VDTAGCGLLETEL--------------AGEQSKGNAGEVDIVSAHVQALIDAGVKAEDIAVIAPYNLQVDMLRQKLSDRHPELEIRSVDGFQGR-------EKEAVILSLVRSNRKGEVGFLAEDRRINVAVTRARRHLAVV 614          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: upf1 (UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-GENE-040426-2836])

HSP 1 Score: 113.62 bits (283), Expect = 1.367e-25
Identity = 137/509 (26.92%), Postives = 227/509 (44.60%), Query Frame = 1
Query: 1972 LNSSLK-IPISNLSVLGSLMDKSEIGQKLRDFIVHC-------KPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLM-GMKVLVSSYTHSAVSNILQKL------------DARE-----INFLYLNGN----HSVCE-----KLKNRTLSYI-LPEKKFENLFN--FHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
            + S+LK   +   SV G +  K  +G ++ D ++ C        P L D + ++  AVK                   +  +   LI+G PG+GKT     ++          VLV + ++ AV  + +K+             +RE     ++FL L+       S+ E     +LK+ T       EK++  L       L+ N DV+  TC+ A    L+++++  ++IDE+ Q T P  ++P +       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +    + V  A  ++       +F W      ++ D+ + F     Q     +   Y N+ EA    ++  + LK GA    IG+I PY  Q+  +++ M            EVEI ++D +QGR+K  +I+S V       +A E+     LND RRLNVA++RAK+ +I++GN   LS+  QP+
Sbjct:  411 MQSALKTFAVDETSVSGYIYHKL-LGHEVEDVLIKCMLPKRFTAPGLPDLNHSQVYAVKT------------------VLQRPLSLIQGPPGTGKTVTSATIVYHLAKQNSGPVLVCAPSNIAVDQLTEKIHRTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSLPELQKLQQLKDETGELSSADEKRYRALKRNAERELLMNADVICCTCVGAGDPRLAKMQYRSILIDESTQATEPECMVPTVL---GAKQLILVGDHCQLGPVVMCKKAAKAGLCQSLFERLVVLGIRP---IRLQVQYRMHPALSAFPSNIFYEGSLQ---NGVTAAERVK----KGFDFTW------TQPDKPMFFYVTQGQEEIASSGTSYLNRTEASNVEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHAKLYQEVEIASVDAFQGREKDFIILSCV-------RANEHQGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSK--QPL 872          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001658.1 (pep scaffold:Pmarinus_7.0:GL482735:13451:15897:-1 gene:ENSPMAG00000001498.1 transcript:ENSPMAT00000001658.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.697e-14
Identity = 67/226 (29.65%), Postives = 108/226 (47.79%), Query Frame = 1
Query: 2782 EILKLCNTISYNNQITCATDQVAFATIMEHESINSLEF-----------WKCQCCSSELDRSVIFLNYQPSFVEADEIY-----FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTME---------VEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIIS 3384
            EI+ L N ++Y   + C +++V+   +    S+  L             W  Q  + + DR V+FLN +   V A+E+       N  EA++   +    +K G    D+G+I PY QQ   +                +EINT+D+YQGRDK ++I+ FV      G   E     +L D+RRLNVA++RAKHKL+++       + Y P+  + D +    +IS
Sbjct:    2 EIMSLSNVLTYGGLLACGSERVSTCRL----SLPGLPAFLDGMGGGNHPWLTQ--ALDPDRPVLFLNTE--KVPAEEMVDQGGVKNPTEAQLIAIIAASLIKAGCRTKDVGIISPYRQQLGAVSAALAALPCPAAALAGLEINTVDKYQGRDKPVIIVGFVRTCATAGILGE-----LLKDRRRLNVAVTRAKHKLLLL-GCLPTLKLYTPLAALIDHMATQGMIS 213          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008661.1 (pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-1 gene:ENSPMAG00000007841.1 transcript:ENSPMAT00000008661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 5.982e-12
Identity = 87/316 (27.53%), Postives = 139/316 (43.99%), Query Frame = 1
Query: 2431 KKFENLFNFHNLIE--NIDVVGVTCLSANHAALSR-LKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADE-----IYFNKFEAKITMELVEQFLKIGAL-ESDIGVIIPYNQQKEMIRNMSTME----VEINTIDQYQGRXXXXXXXXXXXX------XXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYL 3321
            KK++ L     +IE    DVV  TC +A    L + L   V ++DE    T P  ++PL    ++  + +L GD  QL P V N TA   G+++S+F +     +      L  QYRM+ +I +      Y+   T  T + A        SI  L +     C +     V     + + V + E        NK E +  + LV + +K G++ E DI ++ PYN Q   I+     E    V   TI + QG +   V++S V             +  + +    + D+ ++NVA++RAK  L +IGN D L
Sbjct:  101 KKYKKLIKDAKVIELKKSDVVITTCSTAATVILLKNLDPRVCLVDECAMCTEPECLIPLTSY-KDIAQVVLLGDHKQLRPFVLNRTAAKLGMEKSMFER-----YAKRAIMLDTQYRMHPDICEFPAKQFYSE--TNKTLKTAKEVFGRPNSI--LGYAHKPSCPTLFGHVV---GKEVTLVVSTEEGSENSKANKAEVEQVVRLVSELIKKGSIAEKDIAILTPYNAQANEIQKALEKEHIKKVTATTITKSQGSEWRYVLLSTVRSCSLDEFKANPSRGWQISRLGFIIDENQVNVALTRAKEGLCIIGNQDLL 403          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Match: DNA2 (Tripartite DNA replication factor; single-stranded DNA-dependent ATPase, ATP-dependent nuclease, helicase; tracking protein for flap cleavage during Okazaki fragment maturation; involved in DNA repair/processing of meiotic DNA double strand breaks; component of telomeric chromatin with cell-cycle dependent localization; required for telomerase-dependent telomere synthesis; forms nuclear foci upon DNA replication stress; human homolog DNA2 complements yeast dna2 mutant [Source:SGD;Acc:S000001207])

HSP 1 Score: 228.409 bits (581), Expect = 2.735e-61
Identity = 163/438 (37.21%), Postives = 243/438 (55.48%), Query Frame = 1
Query: 2053 LRDFIVHCKPPLF-DCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHA--ALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSS--------ELDRSVIFLNYQ--PSFVEADEI--YFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTMEV----EINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGN 3309
            LR  +V  + P F D +    +  K+     + N +Q+  I   + ++DY LI G PG+GKT+ I  +I+I V  G +VL++SYTHSAV NIL KL    I+ + L   H    K+   T  Y+      ++  ++ + I +  VV  TCL  N     L+   FD VI+DEA QI++PV++ PL    +   +FI+ GD  QLPPLV+N  AR+ GL++SLF   CE  HP+S+ EL LQYRM  +I+ L N + Y+N++ C  ++V FA  +E     +L  ++ +  +S        E  R V+FLNY   P  +E  E     N  EA++T++ VE  L  G    DIGV+  Y  Q  +++ +    V    EI T DQ+QGRDK  +IIS V ++ +L      N   +L + RR+NVA++RAK KLI+IG+
Sbjct: 1021 LRSLLVDNRAPKFRDANDDPVIPYKLSKDTTL-NLNQKEAIDKVMRAEDYALILGMPGTGKTTVIAEIIKILVSEGKRVLLTSYTHSAVDNILIKLRNTNISIMRLGMKH----KVHPDTQKYVPNYASVKSYNDYLSKINSTSVVATTCLGINDILFTLNEKDFDYVILDEASQISMPVALGPL----RYGNRFIMVGDHYQLPPLVKNDAARLGGLEESLFKTFCE-KHPESVAELTLQYRMCGDIVTLSNFLIYDNKLKCGNNEV-FAQSLELPMPEALSRYRNESANSKQWLEDILEPTRKVVFLNYDNCPDIIEQSEKDNITNHGEAELTLQCVEGMLLSGVPCEDIGVMTLYRAQLRLLKKIFNKNVYDGLEILTADQFQGRDKKCIIISMVRRNSQL------NGGALLKELRRVNVAMTRAKSKLIIIGS 1441          

HSP 2 Score: 95.5153 bits (236), Expect = 3.368e-20
Identity = 102/346 (29.48%), Postives = 170/346 (49.13%), Query Frame = 1
Query:  754 ILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVR-EIAKRLSKQPSQLITFY--------ESGWTDEEILREIEVYFPRILKWINRNLSKK--------------PEISKMQVIDVEENIWSTKYGIKGKIDVTLQTN-----ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKD-GAERFIFNDNSPSVISTIK----IRNELT-NFI--LKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDN----TGHLCE--KDY-EFFVHWINLIVLE 1662
            +LV+NP  L S TSV  S+ C R+ +LQ  F    G+ +  M +G+ +H + Q+  + + L  N++  EI   + K  S L T+         E  +  E +++E   +   IL ++N+ +SK                 IS   VID+EENIWS  YG+KG +D T++ N     +  +PLE+KTG++  S  +  Q L+Y L+++D+ E+ I+  LL + +D    +F      PSV+ +IK     RN ++ NF   L+    Q  +   LP ++ +   C SC     C + ++L +   D +     L++      T HL +   +Y EFF  + +LI  E
Sbjct:  499 LLVLNPDVLFSATSVGSSVGCLRRSILQMQFQDPRGEPSLVMTLGNIVHELLQDSIKYK-LSHNKISMEII--IQKLDSLLETYSFSIIICNEEIQYVKELVMKE---HAENILYFVNKFVSKSNYGCYTSISGTRRTQPISISNVIDIEENIWSPIYGLKGFLDATVEANVENNKKHIVPLEVKTGKSR-SVSYEVQGLIYTLLLNDRYEIPIEFFLLYFTRDKNMTKF------PSVLHSIKHILMSRNRMSMNFKHQLQEVFGQAQSRFELPPLLRDSS-CDSCFIKESCMVLNKLLE---DGTPEESGLVEGEFEILTNHLSQNLANYKEFFTKYNDLITKE 827          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Match: NAM7 (ATP-dependent RNA helicase of the SFI superfamily; involved in nonsense mediated mRNA decay; required for efficient translation termination at nonsense codons and targeting of NMD substrates to P-bodies; binds to the small ribosomal subunit via an interaction with Rps26; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000004685])

HSP 1 Score: 107.071 bits (266), Expect = 6.746e-24
Identity = 110/426 (25.82%), Postives = 186/426 (43.66%), Query Frame = 1
Query: 2173 MSAIFSKDYLLIKGYPGSGKTSCIVAMI-RIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNG--NHSVCEKLKNRTLSYIL---PEKKFENLFNFHN-----------------------LIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYF-NKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTM----------EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            +S +  +   LI+G PG+GKT     ++  +  +   ++LV + ++ AV ++  KL    +  + L       V   + N  L  ++    + + +NL    +                       ++   DVV  TC+ A    L   KF  V+IDE+ Q + P  ++P++K      + IL GD  QL P++    A   GL QSLF +L    H      L++QYRMN  + +  + + Y   +          TI +    NS   W  +         + + NY    + A+   F N+ EA     ++ +  + G     IGVI PY  Q+  I     M          +VE+ ++D +QGR+K  +I+S V       +A E  +   L D RRLNV ++RAK+ L+++GN   L++N
Sbjct:  417 VSHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKIHKDRILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDVESSVSNLALHNLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEAEILNKADVVCCTCVGAGDKRLD-TKFRTVLIDESTQASEPECLIPIVK---GAKQVILVGDHQQLGPVILERKAADAGLKQSLFERLISLGH--VPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGV------TIEQRTVPNSKFPWPIRGIPM-----MFWANYGREEISANGTSFLNRIEAMNCERIITKLFRDGVKPEQIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCV-------RANEQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRSLARN 818          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Match: HCS1 (Hexameric DNA polymerase alpha-associated DNA helicase A; involved in lagging strand DNA synthesis; contains single-stranded DNA stimulated ATPase and dATPase activities; replication protein A stimulates helicase and ATPase activities [Source:SGD;Acc:S000001500])

HSP 1 Score: 105.145 bits (261), Expect = 1.720e-23
Identity = 123/506 (24.31%), Postives = 220/506 (43.48%), Query Frame = 1
Query: 2035 SEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNP---DQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG--MKVLVSSYTHSAVSNILQKLDAREINFLYL-----------NGNHSV-----------------------CEKLKN-----------RTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLK--------FDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTAR--INGLDQSLFSKLCE-FNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVE----ADEIY-----FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQ----KEMIRN-MSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQ 3327
            S I  K+  ++V+ +P + + +         ++I    NP   D ++  ++   + D  +I G PG+GKT  ++ +I+  ++     ++L+   ++ +V  IL++L     N L L           N  HS+                        +KLKN           + L   L +++F+ +    +LI    +V  T   ++   L  L         FD +IIDE  Q   P   +PL+       K +L GD  QLPP ++    +  I+ L+ +LF ++ + F   D +  L +QYRMN +I++  +   YN ++      +A AT+     I+ L          + D  +  + Y     E    ADE       +N+ E  I  E +E        E+ IGVI PYN Q    K++I + +   ++EI+T+D +QGR               L ++ E      L ++RRLNVA++R + +L+++GN++ L +
Sbjct:  174 SPIQDKIIQYLVNERPFIPNTN-------SFQNIKSFLNPNLNDSQKTAINFAINNDLTIIHGPPGTGKTFTLIELIQQLLIKNPEERILICGPSNISVDTILERLTPLVPNNLLLRIGHPARLLDSNKRHSLDILSKKNTIVKDISQEIDKLIQENKKLKNYKQRKENWNEIKLLRKDLKKREFKTI---KDLIIQSRIVVTTLHGSSSRELCSLYRDDPNFQLFDTLIIDEVSQAMEPQCWIPLIAHQNQFHKLVLAGDNKQLPPTIKTEDDKNVIHNLETTLFDRIIKIFPKRDMVKFLNVQYRMNQKIMEFPSHSMYNGKL------LADATVANRLLID-LPTVDATPSEDDDDTKIPLIWYDTQGDEFQETADEATILGSKYNEGEIAIVKEHIENLRSFNVPENSIGVISPYNAQVSHLKKLIHDELKLTDIEISTVDGFQGR-------EKDVIILSLVRSNEKFEVGFLKEERRLNVAMTRPRRQLVVVGNIEVLQR 655          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Match: SEN1 (ATP-dependent 5' to 3' RNA/DNA and DNA helicase; subunit of the exosome-associated Nrd1p complex that mediates 3' end formation of snRNAs, snoRNAs, CUTs and some mRNAs; helicase-independent role in transcription-coupled repair; coordinates replication with transcription, associating with moving forks and preventing errors that occur when forks encounter transcribed regions; homolog of Senataxin, implicated in Ataxia-Oculomotor Apraxia 2 and a dominant form of juvenile ALS [Source:SGD;Acc:S000004422])

HSP 1 Score: 75.8702 bits (185), Expect = 3.437e-14
Identity = 91/311 (29.26%), Postives = 145/311 (46.62%), Query Frame = 1
Query: 2479 DVVGVTCLSANHAALSRL--KFDVVIIDEAGQITLPVSIMPLLKMDQNKGKF-ILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQIT--CATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESD----IGVIIPYNQQ-----KEMIRNMSTM---EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDV 3360
            D++  T   + H  L+ +  KFD VIIDEA Q T   SI+PL    +  GK  I+ GD  QLPP V +  A     +QSLF ++ + + P     L +QYRM+  I K  ++  Y  ++      D +      + E +   +F+       E +   +              Y N  E ++ +ELV+   +    + D    IG+I PY +Q     KE  R    M    ++ NTID +QG++K I++IS V   D        +S   L D RR+NVA++RAK  + ++G+   L+++     +I D 
Sbjct: 1563 DIICSTLSGSAHDVLATMGIKFDTVIIDEACQCTELSSIIPL----RYGGKRCIMVGDPNQLPPTVLSGAASNFKYNQSLFVRMEKNSSP---YLLDVQYRMHPSISKFPSSEFYQGRLKDGPGMDILNKRPWHQLEPLAPYKFFDIISGRQEQNAKTM-------------SYTNMEEIRVAIELVDYLFRKFDNKIDFTGKIGIISPYREQMQKMRKEFARYFGGMINKSIDFNTIDGFQGQEKEIILISCVRADDT------KSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIEDA 1847          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO44587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV67])

HSP 1 Score: 115.546 bits (288), Expect = 4.813e-28
Identity = 79/275 (28.73%), Postives = 131/275 (47.64%), Query Frame = 1
Query:  661 WEDTVVHVGDICSIVDPIKSNGLWTI--NNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLS--KKPEISKM--------------------QVIDVEENIWSTKYGIKGKIDVTLQT-------------------NESTIPLELKTGRTTFSR----EHTCQVLLYILMMSDKTEMNIDKGLLLYIKDG 1344
            WE T V  GDI  +      N    I  N     ++V+P  L+S T++ G+  C R+ +L   F   +  +N+AM++G+ +H +F    +      + +    + L +Q + L  FY  G T+ + L +++   P   +W  R +     P++S M                    Q+ D+EEN+WS ++G+KGK+D T++                      +++PLELKTG+  FS+    EH  QV+LY L++SD+    ID GLL Y+K G
Sbjct:   36 WEGTDVEPGDIVHVTGVFDINSGVCILDNTANNYIIVHPDTLISGTTIAGATRCLRRSILNERFR--TEDANEAMLMGTLLHDLFDRAMKSNDFSHDALLCAVQGLLEQFTYLDGFYGLGMTECDALNKVKELLPAFSEWAWRYVCDLPDPDLSTMDYKDGSCDTGGTEMPSVCVSQLRDIEENVWSPRFGLKGKVDATVEVKIDRRPMSRRHRPGMDNHLTTASVPLELKTGK-LFSKLGSVEHRAQVILYTLLLSDRYRHGIDTGLLYYMKSG 307          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO34496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP82])

HSP 1 Score: 94.3597 bits (233), Expect = 8.332e-20
Identity = 123/473 (26.00%), Postives = 211/473 (44.61%), Query Frame = 1
Query: 2068 VHCKPPLFDCHITKSL-AVKIKHIMKICNPDQRRVIMSAIFSKDY---LLIKGYPGSGKTSCIVAMIR--IFVLMGMKVLVSSYTHSAVSNILQKLDAR----EINFLYLNGNHSVCEKLKN--RTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANH---AALSRLKFDVVIIDEAGQITLPVSIMPLLKM----DQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSK------------------LCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLK---IGALESDIGVIIPYNQQKEMIRNM----STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIH 3354
            +H  PPL D    K L  VK++      N +QR+ ++S +         LI G PG+GKT  +V  I+  + V    KVL  + ++SA   IL+++       ++  L LN        L +  + +S I     F   F     I N  +V  T ++A     A +    F  V IDE+GQ   P  ++PL  +    +   G+ +L GD  QL P++R+  A   GL  SL  +                  L E+  P  + +L   YR +  IL+L N + Y++++    D++   ++     + +  F         +    +     PSF       FN  EA   ++ ++       +  L ++IGVI PY QQ   IR +    +   +++ +++++QG ++ ++IIS V  S +  K         LN+++R NVAI+RA+  LI++GN   L ++    + IH
Sbjct:   42 IHHLPPLCDDDKVKRLFDVKLED-----NQEQRQAVVSIVKGTSRPHPYLIFGPPGTGKTITVVESIKQVLHVFPNSKVLACAPSNSAADLILERVMKHNVIPKMKMLRLNAFGRSYASLSDSIKVVSCIHDGDFF---FPGKEEIMNKRLVVCTLVTAGRLVSADIPDTHFTHVFIDESGQALEPECMVPLAGLLNPENPGGGQLVLAGDPQQLGPVLRSPLAIKYGLRMSLLERLMTRVAAYGRITEDEEDELGEYE-PAMLTKLLKNYRSHPAILELPNGMFYDDELETCADKLKRESLCNWSKLPTKGF---PILFDGVLGKDLREGKSPSF-------FNPEEAATVVKHIKDLRDSRGVRVLMAEIGVISPYRQQVSKIRQLLHKNNITGIKVGSVEEFQGDERRVIIISTVRSSQEFLKMDAQFKLGFLNNRKRFNVAITRAQALLIVVGNPHVLCKDSHWGRFIH 495          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO45106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX4])

HSP 1 Score: 87.0409 bits (214), Expect = 1.000e-17
Identity = 106/433 (24.48%), Postives = 199/433 (45.96%), Query Frame = 1
Query: 2155 DQRRVIMSAIFSKD-----YLLIKGYPGSGKTSCIV-AMIRIF-VLMGMKVLVSSYTHSAVSNILQKLDA----REINFLYLNGNHSVCEKLKNRTLSYILPEK--KFENLFNFHNLIENIDVVGVTCLSANHA---ALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCE-----------FNH----PDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEA--DEIYFNKFEAKITMELVEQFLKIGAL----ESDIGVIIPYNQQKEMIR----NMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQN 3330
            +++R  ++ I S       YLL  G PG+GKT  +V A++++F  +   +V+  + ++SA   +  +L      +E + + LN    V E          +PE   K+    +   L  +  ++  TC +A       L    F  V +DEAGQ T P  ++P+       G+ IL GD  QL P++R+  A   GL+ SL  +L              +H    P  + +L   YR +  +L+L + + Y++++    ++         E ++  E    Q         ++F   +   +       +FN  EA   +  V Q LK  A      +D+G+I PY +Q E IR     +   EV++ +++++QG+++  +IIS V  ++ +      ++   L++ +R NVA++RA+  L+++GN   L ++
Sbjct:   18 ERQRAAVARILSGQSRPTPYLLF-GPPGTGKTVTLVEAILQVFHRVPSSRVIACAPSNSAADLMAVRLHRSGFIQEGDMIRLNAFQRVQE----------IPESINKYCVDTDSLQLAAHYRIIVCTCSTAGQLFSLGLKPGHFTHVFVDEAGQATEPECLIPIGLAAGEDGQIILAGDPFQLGPVLRSPVAISYGLNVSLLERLMSGLLYARDETRFVDHGCYDPLLVTKLVNNYRSHPSLLRLPSALFYHSELRVCAERTM------REQLSQWEMLPTQ------GTPLVFHGLKGEDMREGNSPSWFNPVEAVQVVRYV-QALKNSATCPIKLADLGIITPYKKQVEKIRLLLSRVGIDEVKVGSVEEFQGQERPAIIISTVRSTEAMVGFDVAHTIGFLDNPKRFNVAVTRAQSLLVVVGNPHVLCRD 426          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO45137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS2])

HSP 1 Score: 68.1662 bits (165), Expect = 2.558e-11
Identity = 78/313 (24.92%), Postives = 144/313 (46.01%), Query Frame = 1
Query: 2476 IDVVGVTCLSA------NHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDS--ICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYF-----NKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNM------STMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHD 3357
            +D++  TC  A       HA +++      I+DE+     P  ++P +       +F+L GD  QL P++++  A   GL +SLF  L E +   S   C L  Q+RM+  + K  ++  YN Q +   + V+ A   E E      FW       +L      +  +P   E+D  Y      N  E +  +E+VE  +  G     I ++ P+ +Q+  I +       S +++ + + ++ QG    ++++S V    +      +  F  L D+ ++NV ++RA+  L+++GN  YLS N    +++HD
Sbjct: 2529 VDIIICTCAEAGSQRMRTHANIAQ-----CIVDESNYCLEPEVLVPAVTAGPRCSRFVLVGDHKQLVPVLQSKEAWKLGLGRSLFEDLWEAHREGSSACCTLNTQHRMHPSLGKFSSSFFYNVQQS--RENVSNACARELEG-----FWPA---GRDLYHVFCHVEDEP---ESDCDYIEGGMSNDAEVQKVVEVVESLMSRGVQPFKIWIVSPFLRQRHSILHALDSTLGSQLDIRLTSPEECQGAQCDVLVLSTVRGRPRDQLTGPHGGFGCLGDKHQMNVVLTRARKGLVIVGNRYYLSGNPMWNRLLHD 2823          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Match: EDO34933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW5])

HSP 1 Score: 63.929 bits (154), Expect = 3.676e-10
Identity = 80/310 (25.81%), Postives = 130/310 (41.94%), Query Frame = 1
Query: 2464 LIENIDVVGVTCLSANHAALSR-------LKFDVVIIDEAGQITLPVSIMPLLKMDQNKG-----KFILTGDLLQLPPLVRN-STARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTME----------VEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLS 3324
            L++   ++ +TC    HAAL R        K+D V+++E+ QI    + +PLL  +   G     +  L GD  QLPP+++N +  + + ++QSLF++      P    +L  Q R       LCN   YN +     +     T  E+   N    +  Q    +    V      P F      Y N  EA+  + L      IG     I ++  YN QK +IR++               ++ T+D+YQG+    +I+S V             +   L D RRL VA+SRA+  L ++  +   S
Sbjct:  998 LVKEAKIIAMTC---THAALKRHDLVELGFKYDNVLMEESAQILEIETFIPLLLQNPEDGYNRLKRVCLIGDHNQLPPVIKNMAFQKFSNMEQSLFTRFVRLGVP--TVQLDAQGRARP---SLCNL--YNWRYKTLGNLPHVLTWPEYGVENPGFHFDFQLIDVQDFNGVGESEPNPYF------YQNLGEAEYAVALFMYMRLIGIPAERIAILTTYNGQKHLIRDVINQRCGNNPLIGRPSKVTTVDRYQGQQNDFIILSLV----------RTRTVGHLRDVRRLVVAMSRARLGLYILARVSLFS 1281          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: dna2 (DNA replication helicase/nuclease 2 [Source:NCBI gene;Acc:101165382])

HSP 1 Score: 427.557 bits (1098), Expect = 4.672e-128
Identity = 317/1007 (31.48%), Postives = 506/1007 (50.25%), Query Frame = 1
Query:  610 TLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSK-KPEISKMQVI----------------------DVEENIWSTKYGIKGKIDVTLQTN-----------ESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVIST---IKIRNELTNFILKFT--SSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSR-LSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRN------------VTFESSSLSGINFLIKFNLPQKPFY--KFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKH----IMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYI---LPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFA--TIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPS---------FVEADEIY-----FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQ----KEMIRNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
            TL     C +K   DG WE T V  GD+  + +     G W +   +G+LV+ P  L+S TS++ S+ C R+ VL   F    G S K M+ G+ +H +FQ   + +     ++ ++A      P  L   Y  G + EE+ +E+  Y P +  W +  LS  KP+   ++++                      D+EEN+WS ++G+KGKIDVT Q             E T PLELKTGR + S EH  QV+LY LM  ++   N + GLLLY+K G+   +    +PS +     +K+RN L + +       + L+N   LP ++T+ + CQ C     C ++ R L  + +D S  ++D ++   GHL ++   +F HW+ L +LE ++  + +N  K+I +Q+ + S +N            V  ++  +    F    + P +         GD I+VS  DG+ V +  GY+ E   T +    S + L   +    R+D +  +    ++L+ L  LM+  +  ++LR  IV  +PP F  +++  L    K     I+K  N  Q++ +   + SKDY LI G PG+GKT+ I  ++RI    G  VL++SYTHSAV NIL KL    + FL L       +K+    L Y    + +K    L +   L     VV  TC+   H   +R +FD  I+DEA QI+ P+ + PL        +F+L GD  QLPP+V+N  AR  G+D+SLF +L    H +++ +L +QYRMN +I+ L N++ Y+ ++ C +++ A A  T+    S+ S E         + D S +     PS          V A E        N  EA +   L+   +K G   SD+GVI PY QQ    + ++++ +   VE+NT+D+YQGRDKS++++SFV  + + G   E     +L D RRLNVAI+RAKHKL+M+G+   L + + P++ + + L+   +IS 
Sbjct:  372 TLHPTETCLLK---DG-WETTPVRRGDVVHL-EGRSDAGTWLVERDQGLLVLQPDSLISGTSISNSIRCMRRAVLGEMFKSFDGGS-KQMLNGTMVHEVFQGAAKAKDFSSEKLFKLADEALHSPRYLGDMYTLGVSQEEMKQELLDYLPSLENWASEYLSSSKPKSIGLKILNPSRAPGGCQESNAVVTVTDLTDIEENVWSPRFGLKGKIDVTAQVQIQRPRTSRSPEEKTFPLELKTGRESNSIEHRSQVILYTLMSMER--YNPEAGLLLYLKTGSMHPV----APSHMDRRELLKLRNTLAHHLHNSVEKGADLSNLQRLPDILTSRQTCQYCPQKLNCALYERALDPSSADPSDDVRDFLQQECGHLAQQHLNYFSHWLLLCILEAVTMET-KNSRKHIWLQSIESSEKNGSCVGNLQLKDAVAAQAEDVFLHRFQRTGSAPSQSATNCGLTNGDRIVVSDQDGRLVGLATGYLCEVDKTSVSCTLS-RDLSKFRDVLFRLDADEGVVGMSTHLTNLSRLMENCQDSERLRKLIVDLRPPEFIFNLSSVLPRDAKETVAEILKGLNKPQKQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILQACGFSVLLTSYTHSAVDNILLKLKRFRVGFLRLGQG----QKIHPDILPYTEENVRKKGVHTLLDLEQLYNKELVVATTCMGIKHPIFTRRRFDYCIVDEASQISQPICLGPLFYAH----RFVLVGDHQQLPPIVQNKEARSLGMDESLFKRL--EVHGEAVVQLNVQYRMNRQIMSLSNSLMYDGRLECGSERTAAALLTLPSLASVQS-ELRSHSETHPQHDLSWVQFTLLPSNPVCFLDCSLVPALESVEQGGVSNHTEAALIHMLLSLLIKAGCRPSDVGVIAPYRQQLKTIQALLQSPTFSGVEVNTVDKYQGRDKSLIVLSFVRSNTEEGHLGE-----LLKDWRRLNVAITRAKHKLLMVGSAVTL-RRFPPVEKLLNHLQQENMISF 1347          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: UPF1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:101168695])

HSP 1 Score: 123.25 bits (308), Expect = 6.340e-28
Identity = 153/583 (26.24%), Postives = 255/583 (43.74%), Query Frame = 1
Query: 1759 LSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLK-IPISNLSVLGSLMDKSEIGQKLRDFIVHCKPP-------LFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMG-MKVLVSSYTHSAVSNILQKLD------------ARE-----INFLYLNGNHS---------VCEKLKNRTLSYI-LPEKKFENLFNF--HNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQI---TCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKE-MIRNMS---------TMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
            + G    +++     P +K + G  I V  + G ++AI L   V +P   + I  + +     K T     + S+LK   +   SV G +  K  +G ++ D  + C+ P       L D + ++  AVK                   +  +   LI+G PG+GKT     ++      G   VLV + ++ AV  + +K+D            +RE     ++FL L+   S           ++LK+ T       EK++  L       L+ N DV+  TC+ A    L++++F  ++IDE+ Q T P  ++P++       + IL GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +     A D++              +F W       + D+ + F     Q     +   Y N+ EA    ++  + LK GA    IG+I PY  Q+  +++ M            +VEI ++D +QGR+K  +I+S V       +A E+     LND RRLNVA++RAK+ +I++GN   LS+  QP+
Sbjct:  338 MQGDEICLRYKGDLAPLWKGI-GHVIKVPDNYGDEIAIELRSSVGAP---VEIPHNFQVDFVWKSTSFD-RMQSALKTFAVDETSVSGYIYHKL-LGHEVEDVTIKCQLPKRFTAQGLPDLNHSQVYAVKT------------------VLQRPLSLIQGPPGTGKTVTSATIVYHLSRQGNGPVLVCAPSNIAVDQLTEKIDKTGLKVVRLCAKSREAIESPVSFLALHNQISNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVL---GAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRP---IRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRIK----------KGFDFQW------PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTRLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQQVEIASVDAFQGREKDFIILSCV-------RANEHQGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSK--QPL 865          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: ighmbp2 (immunoglobulin mu DNA binding protein 2 [Source:NCBI gene;Acc:101158519])

HSP 1 Score: 108.227 bits (269), Expect = 2.221e-23
Identity = 110/455 (24.18%), Postives = 190/455 (41.76%), Query Frame = 1
Query: 2158 QRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLF----------------------NFHNLIENI-------DVVGVT--------CLSANHAA--------LSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINS--LEFWKCQCCSSELDRSVIFLNYQPSFVEADEIY-----FNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTM---EVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHD 3357
            QR  +M A+  ++  +I G PG+GKT+ +V +I   V  G KVL  + ++ AV N++++L   +   L L     + E ++  +L  IL +    N+                       N+   I  +       +   +T         LS N  A        L    FD V+IDE  Q       + LLK      K IL GD  QLPP +++  A   GL  SL  ++ +      +  L +QYRMN  I++  +   Y  ++T             H S+ S  L+        +E    ++ ++   S +   E+       N+ E  I    ++   + G    DI VI PYN Q +++R   +    E+EI ++D +QGR          +    L ++        L++ RR+NVA++RA+  + ++ +   + QN+  +K + D
Sbjct:  194 QREAVMFALSQRELAVIHGPPGTGKTTTVVEIILQAVKQGQKVLCCAPSNVAVDNLVERLAQCKAKVLRLGHPARLLESIQKHSLDAILAQSDNANIIADIRKDIDKVLMGMKKEKGERGNYKREIGELKKELKSREATAITQILKGADVVLSTNTGACDDGPLKLLPAEHFDWVVIDECAQALESSCWIALLKAR----KCILAGDYKQLPPTIKSQAAASKGLSLSLMERVIQIYGDVVVRMLTVQYRMNSAIMEWASKEMYQGKLTA------------HCSVESHLLKDLTGVASVAETSTPLLLIDTAGSGLTEMEVTDEQSKGNQGEVDIVELHIKALTEAGVKAKDIAVIAPYNLQVDLLRQRLSARHPELEIKSVDGFQGR-------EKEAVVLSLVRSNRKGEVGFLSEDRRINVAVTRARRHIAVVCDTQTV-QNHAFLKSLVD 624          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: ENSORLT00000003680.2 (Mov10 like RISC complex RNA helicase 1 [Source:NCBI gene;Acc:101169938])

HSP 1 Score: 93.2041 bits (230), Expect = 1.124e-18
Identity = 107/436 (24.54%), Postives = 213/436 (48.85%), Query Frame = 1
Query: 2107 KSLAVKIKHIMKICNPDQR----RVIMSAIFSKDYLLIKGYPGSGKTSCIVAMI-RIF-VLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLK--NRTLSYILP--EKKFENLFN--FHNLIENIDVVGVTCLSA---NHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCE---FNHPDSICELKL------QYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVE--ADEIYFNKFEAKITM----ELVEQFLK-IGALESDIGVIIPYNQQKEMIR----NMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGN 3309
            +++ V       + NP QR    R++        Y+L  G PG+GKT  ++ +I +++  L   ++LV + ++SA   I  +L      FL  NG+ +        N +L  +L    K  E++ +  FH ++ +      TC SA   ++  +   +F  + +DEAGQ T P S++P+  + +  G+ +L GD  QL P+V++  A + GL  SL  +L     ++  DS  + KL       YR +  +L L + + Y+ +++    +    ++ E  S+    F             ++F   + + +   ++  +FN  EA   M    +L ++  K + A  +DIG+I PY +Q E IR     +   ++++ +++++QG++  ++I+S V  ++ +      +    L++ +R NVA++R+K  L+++GN
Sbjct:  731 RAIPVSGHFFNPVLNPAQREAVKRILAGECRPIPYVLF-GPPGTGKTITLIEVILQVYHFLPNSRILVCTPSNSAADLICTRLHYS--GFLE-NGSLARVNAFSRDNESLPEVLRPYAKAGEDIRHAAFHRIVVS------TCSSAGMFHNIGIRVGQFSHLFLDEAGQATEPESMIPISLISEKDGQIVLAGDPCQLGPVVKSEVASVFGLGVSLLERLMTNPLYSRQDSGYDPKLVTKLIYNYRSHEVLLSLPSKLFYHGELSFQAPRSVVDSLSEWNSLPKKGF------------PLLFHGVRGTEMREGSNPSWFNPVEAVQVMMYCCQLAKKLYKPVNA--ADIGIIAPYRKQCEKIRVLLGKVGLQDIKVGSVEEFQGQEYLVIILSTVRSNESVQSNDLQSLLGFLSNPKRFNVAVTRSKALLLIVGN 1142          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Match: ENSORLT00000034865.1 (putative helicase mov-10-B.2 [Source:NCBI gene;Acc:101175667])

HSP 1 Score: 91.6633 bits (226), Expect = 2.749e-18
Identity = 125/490 (25.51%), Postives = 221/490 (45.10%), Query Frame = 1
Query: 2047 QKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIV-AMIRIFVLMGMKVLVSSYTHSAVSNILQKL-----DAREINFLY--LNGNHSVCEKLK------NRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKM-DQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-----HPD------SICELKLQYRMNIEILKLCNTISYNNQI-TCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLK--IGALE---------SDIGVIIPYNQQKEMIRNMSTME----------VEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRAN 3372
            ++L   +   +PP F+ +  +  AV   HI+       RR    A +     L+ G PG+GKT  +V A++ I     + +LV + ++SA  +I +K+     D  ++  LY  L+    + E LK       +  +  +P KK  ++ +   L+  +   G          +    +  + +DEAGQ T   S++P+  + D++  + +L GD  QL P+V + TA  +GL  SL  +L   N     H D       I +L   YR +  ILK+ N + Y  ++  CA     +         N LE    +         V+F  +  + +   E  F+ F     +E+++++LK  I  L           +IG+I PY +Q E I+     +          VE+ T+D++QG++ S++++S V    KL K  +N     + D RR NVA++RA+  L+++G+   L+ +      IH  L+A 
Sbjct:  378 RRLPRLLALNRPPRFEFNPEQQKAVT--HIL-------RRTAKPAAY-----LLCGPPGTGKTLTLVKAIMEIVKAQDINILVCAPSNSASDDICEKILKGLVDTDKVYRLYPLLHSIAKIPEILKKNCNLDQKKGTIKIPNKK--SIMSRKILVTTLQTAGRLVT----GGIPPKHYTYIFVDEAGQATETESMIPIAGLCDRSTCQVVLAGDPKQLGPVVISKTAEYHGLGVSLLERLMRDNDLYKPHEDFGFDSNFITKLLKNYRSHPAILKVPNDLFYGGELQPCARLSKLY---------NQLELLPKEGF------PVVF--HGVAGISQQEKGFSSFYNMAEIEVIKEYLKSLIQHLHRNNVSHVPPGEIGIISPYRKQVEKIQKAIQWDADLSKENLENVEVGTVDKFQGKEFSVILMSTVRCFPKL-KHKQNFILGFIRDDRRFNVAMTRARSLLVVVGDPRLLATDKNWNTFIHYCLKAG 829          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000005730.1 (SMESG000005730.1)

HSP 1 Score: 2160.57 bits (5597), Expect = 0.000e+0
Identity = 1107/1115 (99.28%), Postives = 1111/1115 (99.64%), Query Frame = 1
Query:   43 MKQTNIFDFVKKIDQNEIENQKKLLNENVKPLCPKSINFLRKRKKSHLVDGRNYSSNQVVLSKDLNSNQIDSSIVSNKLSSYQDRXXXXXXXXXXXXXXVESDNKENIYSNRIPIPTFKAVLNEYNNKFDENNKKQLFDDCFNDDFKWDESLIEDKIKQISPNKIQDQDFYYXXXXXXXXXXXXKQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQVIDVEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
            MKQTNIFDFVKKIDQNEIENQKKLLNENVKPLCPKS NFLRKRKKSHLVDGRNYSSNQVVLSKDLNSNQIDSSIVSNKLSSYQDRIKKINDKLNIKKTIV+SDNKENIYSNRIPIPTFKAVLNEYNNKFDENNKKQLFDDCFNDDFKWDESLIEDKIKQISPNKIQDQDFYYCVVNNVESVCNVKQLTVTL+DNYKCQVKLHLDGMWEDTVVHV DICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQVID+EENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSS SGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSL+FWK QCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRDKSIVIISFVSKSDKLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI
Sbjct:    1 MKQTNIFDFVKKIDQNEIENQKKLLNENVKPLCPKSTNFLRKRKKSHLVDGRNYSSNQVVLSKDLNSNQIDSSIVSNKLSSYQDRIKKINDKLNIKKTIVDSDNKENIYSNRIPIPTFKAVLNEYNNKFDENNKKQLFDDCFNDDFKWDESLIEDKIKQISPNKIQDQDFYYCVVNNVESVCNVKQLTVTLQDNYKCQVKLHLDGMWEDTVVHVRDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLSKKPEISKMQVIDIEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKKSIRNVTFESSSHSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMKICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLKFWKRQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRDKSIVIISFVSKSDKLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 1115          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000052537.1 (SMESG000052537.1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 495/988 (50.10%), Postives = 697/988 (70.55%), Query Frame = 1
Query:  514 KQISPNKIQDQDFYYXXXXXXXXX-XXXKQLTVTLEDNYKCQVKLHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTTSVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDLNEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLS-----KKPEISKMQVIDVEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTFSREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVISTIKIRNELTNFILKFTSSQ---LTNADCLPSVITNIRLCQSCEYLSLCTMFSRLSQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENPIKNIIVQNSKK---SIRNVTFESSSLSGINFLIKFNLPQKPFYKFVEGDPIIVSSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKIPISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKI-------------KHIMKICNPDQRRVIMSAI-FSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATI-MEHESINSLEFWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPE---NNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPIKVIHDVLRANQIISI 3387
            + I+P  IQ QDFY  VV  ++S    +K+LT+   +N   Q+KL+L+G+W + +++  +IC++++PIK+   W INN++G++V+NP +L+++T++TGSLFCQRK V QH+F+ +SG+S K+MV+G+FIH IFQ+C + ++L ++++++I K    Q  Q+++FYES ++D EI+ E+E+YFP+IL+WI RN+S     K+  + K  +ID+EE+IWS KYG+KGKID+TLQ+ ES +PLELKTG+T+FSR+HT QVLLY LMMSD  + +ID GLLLYIKDG+E+ + N+  P+VIS + +RNEL N++ +F ++      + + LP V+ N R C  CEYL+LC+ FSRL+  +++  + M+ LI+ NT HL  KD++F   WINLI++E+ SE S E  IKNI   ++     SIRNV F+SS  +G  F + F   +    K  EGDP+IVSSDDGK++AI  G++  S   D L I S+KPL CS   KLRID NS +KIPISNLS L +LMD+SE  Q LR +I+H   P    H   ++ V I             K I+K CN DQ+  IM  +  S  + LIKGYPGSGKT+C+VAMIR+FV +GM+VLVSSYTHSAVSNIL+KL   +++F+YL+ +H VC ++ +RTL   +     E +      +E I+V+GVTCLSA+H  LSRLKFD+V+IDEAGQITLP+S+MPLLKM    G F+L GD+ QLPPLV+NSTAR++GL+QSLF  LC  NH ++I EL +QYRMN EIL+LCN I+Y N+I+CA++ VA AT  M+ +     E WK QC S+EL  SV+F+N+Q    + +EIYFN+FEA++  EL  +FL +G  ES IG+I PYN QK+++    T  +EINTIDQ+QG+DKSI+IIS V +      A E   N S +IL D RR+NVA++R+KHKLI++GNLDYL + Y+PI  + +VLR +QI+SI
Sbjct:   81 ENINPEIIQIQDFYRVVVIEIDSRDETIKRLTLKTCENNGYQIKLNLEGLWANCLINENEICNVINPIKTKENWKINNNQGLIVINPDFLLNSTAITGSLFCQRKSVFQHYFTDISGKSKKSMVLGTFIHSIFQKCSKEQNLSIDKIKKITKNFLIQEKQMLSFYESEFSDNEIMIELEIYFPQILQWIYRNISQSEHDKRINMKKSSIIDIEESIWSVKYGMKGKIDMTLQSGESIVPLELKTGKTSFSRDHTSQVLLYTLMMSDARQTDIDSGLLLYIKDGSEKPVINNRHPNVISIVMLRNELANYLSRFLTNPPPVANDTNLLPPVLENNRFCGQCEYLTLCSTFSRLTNENTN--ETMEALIQANTDHLSGKDFQFLTKWINLILVEYFSERSGEKIIKNISTNSNNAVSDSIRNVVFDSSKFTGNQFQLTFVFEENKSIKLTEGDPVIVSSDDGKRLAIATGFICGSISIDRLSILSDKPLPCSSALKLRIDRNSYMKIPISNLSALANLMDRSETSQSLRRYIIHGDNPAL--HTVANVPVAIGNQYEQSIYKKIDKSILKHCNQDQKSAIMRTVGLSSGFSLIKGYPGSGKTACVVAMIRVFVQLGMRVLVSSYTHSAVSNILEKLIDCQVDFIYLSASHKVCNRISDRTLGSFISRNAIETVSQLEKALERINVIGVTCLSAHHPLLSRLKFDIVMIDEAGQITLPISLMPLLKMKPTTGVFLLAGDVHQLPPLVKNSTARLDGLNQSLFEYLCNHNHDNTISELTIQYRMNEEILRLCNEITYGNRISCASEMVAKATFAMDTKLKGERESWKRQCLSNELRHSVVFVNHQKK--QPNEIYFNQFEAQLVTELANEFLDLGVSESVIGIIAPYNAQKDLLIEFRTGGIEINTIDQFQGKDKSIIIISLVRQQSTNQTAREVADNESLDILKDNRRINVALTRSKHKLILVGNLDYLPEFYRPIAELRNVLRPDQIVSI 1062          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000052629.1 (SMESG000052629.1)

HSP 1 Score: 199.519 bits (506), Expect = 5.874e-58
Identity = 110/263 (41.83%), Postives = 153/263 (58.17%), Query Frame = 1
Query: 2251 MIRIFVLMGMKVLVSSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFL 3036
            MIR+FV +GM VLVSSY HSAVSNIL+KL   +++F+YL+G+H VC ++ +RT +  +     E +      +E I+V+GVT LSA+H  LSR+KFD+V+IDEAGQITLP+S+MPLLKM   K                                             L  QYRMN +IL+LCN I+Y+N+I+C ++ VA A    +  +      WK QC S EL  SV+F+N+Q    +  +IYFN+ EA++ MEL  +FL
Sbjct:    1 MIRVFVQLGMWVLVSSYMHSAVSNILEKLIDCQVDFIYLSGSHKVCYRISDRTFTSFISRNAIETVSQLEKAMERINVIGVTSLSAHHPLLSRVKFDIVMIDEAGQITLPISLMPLLKMKPTK---------------------------------------------LTNQYRMNEDILRLCNEITYDNRISCPSEMVAKAKFAMNPKLKCERVSWKRQCLSKELRHSVVFVNHQKK--QPSKIYFNQLEAQLAMELANEFL 216          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000052629.1 (SMESG000052629.1)

HSP 1 Score: 174.481 bits (441), Expect = 1.937e-49
Identity = 97/245 (39.59%), Postives = 138/245 (56.33%), Query Frame = 1
Query: 2305 HSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFENLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFL 3036
            HSAVSNIL+KL   +++F+YL+G+H VC ++ +RT +  +     E +      +E I+V+GVT LSA+H  LSR+KFD+V+IDEAGQITLP+S+MPLLKM   K                                             L  QYRMN +IL+LCN I+Y+N+I+C ++ VA A    +  +      WK QC S EL  SV+F+N+Q    +  +IYFN+ EA++ MEL  +FL
Sbjct:    2 HSAVSNILEKLIDCQVDFIYLSGSHKVCYRISDRTFTSFISRNAIETVSQLEKAMERINVIGVTSLSAHHPLLSRVKFDIVMIDEAGQITLPISLMPLLKMKPTK---------------------------------------------LTNQYRMNEDILRLCNEITYDNRISCPSEMVAKAKFAMNPKLKCERVSWKRQCLSKELRHSVVFVNHQKK--QPSKIYFNQLEAQLAMELANEFL 199          
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Match: SMESG000077362.1 (SMESG000077362.1)

HSP 1 Score: 118.242 bits (295), Expect = 1.891e-26
Identity = 118/432 (27.31%), Postives = 197/432 (45.60%), Query Frame = 1
Query: 2179 AIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGM-KVLVSSYTHSAVSNILQKLD------------------------AREINFLYLNGNHSV--CEKLKNRTLSYILPEKKFENLFNFH---NLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIMPLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFN-HPDSICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLEF-WKCQCCSSELDRSVIFL--NYQPSFVEADEIYFNKFEAKITMELVEQFLKIGALESDIGVIIPYNQQKEMI-------RNMST---MEVEINTIDQYQGRXXXXXXXXXXXXXXXLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI 3342
             +  +   LI+G PG+GKT     ++     M   +VLV + ++ AV  + +K+D                        A  +    ++GN      ++LK+ T   I  +++   +       +L+ N DV+  TC+ A    LS+++F  V+IDE+ Q T P  ++ L+   +   + +L GD  QL P+V    A   GL QSLF +L      P     L++QYRM+  +    + I Y   +           +   E  N ++F W         D+ + F   + Q         Y N+ EA    +LV + LK G    +IGVI PY  Q+  +         ++T    E+E+ ++D +QGR+K  +++S V       +A E+     LND RRLNVA++RAK+ LI++GN   L++  QP+
Sbjct:  455 TVLQRPLSLIQGPPGTGKTVTSATIVYHLSQMNHGQVLVCAPSNIAVDQLTEKIDKIGLKVVRLCAKSREAIQSPVSHLALHVQVQNMDGNSEFKKLQELKDVTGELIQSDERRYRMLKKQLERDLLMNADVICCTCVGAGDPRLSKMRFPCVLIDESTQATEPECLISLVLGCK---QAVLVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRP---MRLQVQYRMHPVLSAFPSNIFYEGSLQNG--------VTAEERNNKIDFPW------PNPDKPMYFYCSSGQEEMASNGTSYLNRTEAATVEKLVTRLLKDGVKPCNIGVITPYEGQRAYLVHYFHFSGQLNTKLYQEIEVASVDAFQGREKDYILLSCV-------RANEHQGIGFLNDPRRLNVALTRAKYGLIIVGNPKVLAK--QPL 857          
The following BLAST results are available for this feature:
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNA21.484e-12132.55DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA21.111e-5728.96DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA21.111e-5728.96DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA21.320e-5528.84DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
DNA21.523e-4838.13DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dna-25.543e-10029.84Yeast DNA helicase/endonuclease family [Source:Un... [more]
smg-23.491e-2629.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-23.491e-2629.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-23.491e-2629.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
Y106G6D.52.338e-2527.10pep chromosome:WBcel235:I:10119209:10121815:-1 gen... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29903.684e-11330.53gene:FBgn0030170 transcript:FBtr0071415[more]
CG29903.804e-11330.53gene:FBgn0030170 transcript:FBtr0112971[more]
Upf19.734e-3029.80gene:FBgn0030354 transcript:FBtr0342744[more]
Upf19.734e-3029.80gene:FBgn0030354 transcript:FBtr0073596[more]
CG69673.442e-1324.49gene:FBgn0034187 transcript:FBtr0300276[more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dna23.017e-13032.28DNA replication helicase/nuclease 2 [Source:ZFIN;A... [more]
dna24.029e-13032.50DNA replication helicase/nuclease 2 [Source:ZFIN;A... [more]
BX530068.26.571e-13032.38DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
BX530068.28.271e-13032.38DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
BX890597.22.532e-12931.81DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNA26.625e-12232.87DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA21.937e-12132.77DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA22.256e-12132.60DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA25.414e-12132.77DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
DNA21.597e-11532.42DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dna22.518e-12832.18DNA replication helicase/nuclease 2 [Source:MGI Sy... [more]
Dna22.871e-10330.55DNA replication helicase/nuclease 2 [Source:MGI Sy... [more]
Upf16.519e-2826.54UPF1 regulator of nonsense transcripts homolog (ye... [more]
Upf19.334e-2826.54UPF1 regulator of nonsense transcripts homolog (ye... [more]
Zgrf16.571e-2530.19zinc finger, GRF-type containing 1 [Source:MGI Sym... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZQJ5|DNA2_MOUSE1.762e-12732.18DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|D3ZG52|DNA2_RAT3.524e-12731.87DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|Q8QHA5|DNA2_XENLA9.547e-12332.49DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|P51530|DNA2_HUMAN7.126e-12132.55DNA replication ATP-dependent helicase/nuclease DN... [more]
sp|E1BMP7|DNA2_BOVIN7.245e-12032.08DNA replication ATP-dependent helicase/nuclease DN... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2AMJ23.029e-14835.21DNA replication ATP-dependent helicase/nuclease DN... [more]
T1IXE83.255e-14035.65Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A1S3GZW95.419e-13833.16DNA replication ATP-dependent helicase/nuclease DN... [more]
A0A443SN154.561e-13132.58DNA replication ATP-dependent helicase/nuclease DN... [more]
A0A4W3IJH42.524e-13032.52Uncharacterized protein OS=Callorhinchus milii OX=... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNA23.709e-12131.06DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
upf11.168e-2726.24UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
ighmbp21.417e-2324.32immunoglobulin mu DNA binding protein 2 [Source:NC... [more]
mov10a2.284e-2127.89putative helicase mov-10-B.1 [Source:NCBI gene;Acc... [more]
ENSAMXT00000014945.26.456e-2127.25Mov10 like RISC complex RNA helicase 1 [Source:NCB... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNA22.293e-8027.74DNA replication helicase/nuclease 2 [Source:HGNC S... [more]
ighmbp21.209e-2823.88immunoglobulin mu DNA binding protein 2 [Source:ZF... [more]
upf11.367e-2526.92UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000001658.11.697e-1429.65pep scaffold:Pmarinus_7.0:GL482735:13451:15897:-1 ... [more]
ENSPMAT00000008661.15.982e-1227.53pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
DNA22.735e-6137.21Tripartite DNA replication factor; single-stranded... [more]
NAM76.746e-2425.82ATP-dependent RNA helicase of the SFI superfamily;... [more]
HCS11.720e-2324.31Hexameric DNA polymerase alpha-associated DNA heli... [more]
SEN13.437e-1429.26ATP-dependent 5' to 3' RNA/DNA and DNA helicase; s... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445874.813e-2828.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344968.332e-2026.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451061.000e-1724.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451372.558e-1124.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349333.676e-1025.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dna24.672e-12831.48DNA replication helicase/nuclease 2 [Source:NCBI g... [more]
UPF16.340e-2826.24UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
ighmbp22.221e-2324.18immunoglobulin mu DNA binding protein 2 [Source:NC... [more]
ENSORLT00000003680.21.124e-1824.54Mov10 like RISC complex RNA helicase 1 [Source:NCB... [more]
ENSORLT00000034865.12.749e-1825.51putative helicase mov-10-B.2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of DNA replication ATP-dependent helicase/nuclease DNA2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005730.10.000e+099.28SMESG000005730.1[more]
SMESG000052537.10.000e+050.10SMESG000052537.1[more]
SMESG000052629.15.874e-5841.83SMESG000052629.1[more]
SMESG000052629.11.937e-4939.59SMESG000052629.1[more]
SMESG000077362.11.891e-2627.31SMESG000077362.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014833 ID=SMED30014833|Name=DNA replication ATP-dependent helicase/nuclease DNA2|organism=Schmidtea mediterranea sexual|type=transcript|length=3605bp
AAAATTAAAAGATTATTTTAAAAATAATTAAAATAATTATAAATGAAACA
AACTAATATTTTTGATTTCGTTAAAAAAATTGATCAAAATGAAATTGAAA
ATCAAAAAAAATTACTAAATGAAAACGTGAAGCCACTGTGTCCAAAGTCA
ATTAATTTTTTGAGGAAGCGCAAAAAGTCACATTTAGTAGATGGCCGTAA
TTATTCATCGAATCAAGTTGTATTAAGTAAAGATTTAAACTCCAACCAGA
TTGATTCTTCTATCGTCAGCAATAAATTATCCTCTTACCAGGATAGAATT
AAAAAAATTAATGATAAGTTGAATATAAAAAAAACAATAGTTGAATCTGA
CAATAAAGAAAACATCTATTCAAATAGAATTCCCATTCCTACTTTCAAAG
CAGTGTTGAATGAATACAATAATAAATTTGATGAAAACAATAAAAAACAA
TTATTTGATGATTGCTTTAATGATGATTTCAAATGGGATGAAAGTTTGAT
TGAAGATAAAATTAAACAGATTTCTCCCAACAAAATACAAGATCAAGATT
TTTATTATTGTGTAGTTAATAATGTCGAATCGGTATGTAATGTAAAGCAG
TTAACAGTCACATTAGAAGATAATTATAAATGCCAAGTAAAACTCCATCT
TGATGGGATGTGGGAAGATACAGTGGTTCATGTAGGGGATATTTGTAGTA
TAGTTGATCCAATTAAATCAAATGGATTATGGACTATAAACAATCATCGA
GGAATATTAGTAGTGAATCCATTTTATTTAGTAAGTACTACAAGTGTTAC
TGGGTCTTTGTTTTGTCAAAGAAAAGTTGTATTACAACATTTTTTCTCTG
GTGTGTCCGGTCAATCCAACAAAGCCATGGTAATTGGATCTTTTATTCAT
TTAATATTCCAAGAATGTTGTCGACTCGAACATTTGGATTTGAATGAAGT
TAGAGAAATCGCTAAAAGATTATCAAAACAACCATCACAATTGATAACAT
TTTATGAATCAGGATGGACAGATGAAGAAATATTAAGAGAAATAGAAGTT
TATTTTCCTAGAATTCTTAAATGGATTAACCGAAACCTAAGCAAGAAACC
AGAAATCAGTAAAATGCAAGTGATAGATGTTGAAGAAAATATATGGTCAA
CAAAATATGGGATAAAAGGTAAAATTGATGTAACGCTTCAAACAAACGAG
TCAACAATACCACTTGAATTAAAAACCGGAAGAACTACTTTCTCCAGAGA
GCATACATGCCAAGTATTGCTATATATTTTGATGATGAGTGATAAAACAG
AAATGAATATAGATAAAGGTCTCCTACTTTATATAAAGGATGGAGCGGAA
CGCTTTATATTCAATGATAACAGTCCGAGTGTGATCAGTACAATTAAAAT
AAGAAATGAATTGACGAATTTTATTCTCAAATTTACAAGCAGTCAATTGA
CAAACGCGGATTGTTTACCTTCAGTAATTACAAATATCAGACTCTGTCAA
TCTTGTGAATACTTGTCTCTGTGTACAATGTTCTCTCGGCTTTCTCAAAA
CGATTCTGACTGTAGTCAAGCAATGAAAGATTTAATTAAGGATAATACTG
GACATTTATGTGAAAAAGATTATGAGTTTTTTGTTCATTGGATAAATTTA
ATAGTTTTGGAATTTCTGTCCGAAAGTAGCAATGAAAACCCCATTAAAAA
CATCATAGTGCAAAACTCAAAGAAATCAATAAGAAATGTGACATTTGAAT
CATCGAGTCTTAGTGGAATTAATTTCTTAATCAAATTTAATTTACCACAA
AAGCCTTTCTATAAATTCGTTGAAGGCGATCCAATAATTGTTAGTAGTGA
TGATGGTAAAAAGGTGGCAATAGTTCTTGGTTATGTTGTTGAATCACCCG
GGACTGATATTTTGATTATTTCTTCAGAAAAACCCCTTATATGTTCAAAG
ATGACAAAATTGAGAATCGATCTTAATAGTTCTCTGAAAATCCCCATTTC
CAATTTGTCAGTGTTAGGCAGTCTTATGGATAAATCTGAAATCGGTCAAA
AGTTAAGGGATTTTATCGTGCATTGTAAACCTCCGCTATTTGATTGTCAT
ATAACTAAATCTCTAGCTGTGAAAATCAAACACATAATGAAAATATGCAA
TCCTGATCAAAGAAGAGTTATAATGTCTGCAATATTTTCTAAAGATTATT
TATTGATTAAGGGATATCCTGGGTCAGGAAAGACTTCATGTATTGTTGCG
ATGATCAGAATATTCGTGTTGATGGGAATGAAGGTTTTAGTTAGTAGTTA
TACTCATTCAGCTGTGAGTAATATACTGCAGAAACTTGATGCCAGGGAAA
TTAACTTTTTATACTTAAATGGCAATCATTCTGTTTGTGAGAAATTGAAG
AATAGAACTCTAAGTTACATTCTGCCCGAAAAGAAATTCGAAAATTTATT
TAATTTTCACAATCTTATAGAAAATATTGATGTTGTTGGAGTAACATGTT
TGTCTGCAAATCATGCTGCTTTATCACGATTGAAATTTGATGTTGTGATT
ATTGATGAAGCTGGTCAAATTACACTTCCGGTTTCGATAATGCCATTGTT
GAAAATGGACCAAAATAAAGGAAAATTTATCCTAACTGGTGATTTGTTAC
AATTGCCTCCTCTTGTAAGGAATTCTACAGCAAGAATAAACGGCCTAGAT
CAGAGTTTGTTCTCGAAATTGTGCGAATTTAATCATCCGGATTCTATTTG
TGAATTAAAATTGCAGTATCGGATGAATATTGAAATTCTGAAACTGTGCA
ATACTATCTCCTATAATAACCAAATAACTTGCGCCACTGATCAAGTGGCG
TTTGCAACTATTATGGAGCATGAATCTATTAATAGTTTGGAATTTTGGAA
GTGTCAATGTTGTAGTAGTGAATTAGATCGTTCTGTAATTTTCCTAAACT
ATCAACCTTCGTTTGTTGAGGCTGATGAAATATATTTCAACAAATTTGAA
GCTAAAATTACAATGGAACTCGTAGAACAATTTCTGAAAATAGGTGCTCT
TGAATCTGATATCGGTGTAATCATTCCATATAATCAACAAAAGGAAATGA
TTAGAAACATGTCCACCATGGAAGTAGAGATTAATACAATTGATCAATAC
CAAGGCAGGGATAAATCAATCGTCATAATATCATTTGTTAGCAAATCTGA
TAAACTTGGAAAAGCTCCTGAAAATAATTCCTTTAATATTCTCAATGACC
AGAGACGATTGAACGTAGCGATATCTCGCGCAAAACATAAATTAATAATG
ATAGGAAATTTGGATTACCTTTCCCAGAATTATCAACCAATTAAAGTTAT
TCATGATGTTTTGCGGGCTAATCAAATTATATCGATTTGATGTAACTTTG
GAAATATATGTTTATCATCTTTAAATGTGTATTTATGGAAATTATATAAA
GTAATTTAACTTATTGACTAGAAATGATTTTTTAGAGTGATGGTTCCAAA
ATGAATTCTAACGTTTTATTTCTAAAACTTTGACAGGTTATTTGTGTTTC
AAGATCTTTTGGGCACATTTTCCGATCTTATTGATATAGGCATGATGTTT
TGCGG
back to top

protein sequence of SMED30014833-orf-1

>SMED30014833-orf-1 ID=SMED30014833-orf-1|Name=SMED30014833-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1116bp
MKQTNIFDFVKKIDQNEIENQKKLLNENVKPLCPKSINFLRKRKKSHLVD
GRNYSSNQVVLSKDLNSNQIDSSIVSNKLSSYQDRIKKINDKLNIKKTIV
ESDNKENIYSNRIPIPTFKAVLNEYNNKFDENNKKQLFDDCFNDDFKWDE
SLIEDKIKQISPNKIQDQDFYYCVVNNVESVCNVKQLTVTLEDNYKCQVK
LHLDGMWEDTVVHVGDICSIVDPIKSNGLWTINNHRGILVVNPFYLVSTT
SVTGSLFCQRKVVLQHFFSGVSGQSNKAMVIGSFIHLIFQECCRLEHLDL
NEVREIAKRLSKQPSQLITFYESGWTDEEILREIEVYFPRILKWINRNLS
KKPEISKMQVIDVEENIWSTKYGIKGKIDVTLQTNESTIPLELKTGRTTF
SREHTCQVLLYILMMSDKTEMNIDKGLLLYIKDGAERFIFNDNSPSVIST
IKIRNELTNFILKFTSSQLTNADCLPSVITNIRLCQSCEYLSLCTMFSRL
SQNDSDCSQAMKDLIKDNTGHLCEKDYEFFVHWINLIVLEFLSESSNENP
IKNIIVQNSKKSIRNVTFESSSLSGINFLIKFNLPQKPFYKFVEGDPIIV
SSDDGKKVAIVLGYVVESPGTDILIISSEKPLICSKMTKLRIDLNSSLKI
PISNLSVLGSLMDKSEIGQKLRDFIVHCKPPLFDCHITKSLAVKIKHIMK
ICNPDQRRVIMSAIFSKDYLLIKGYPGSGKTSCIVAMIRIFVLMGMKVLV
SSYTHSAVSNILQKLDAREINFLYLNGNHSVCEKLKNRTLSYILPEKKFE
NLFNFHNLIENIDVVGVTCLSANHAALSRLKFDVVIIDEAGQITLPVSIM
PLLKMDQNKGKFILTGDLLQLPPLVRNSTARINGLDQSLFSKLCEFNHPD
SICELKLQYRMNIEILKLCNTISYNNQITCATDQVAFATIMEHESINSLE
FWKCQCCSSELDRSVIFLNYQPSFVEADEIYFNKFEAKITMELVEQFLKI
GALESDIGVIIPYNQQKEMIRNMSTMEVEINTIDQYQGRDKSIVIISFVS
KSDKLGKAPENNSFNILNDQRRLNVAISRAKHKLIMIGNLDYLSQNYQPI
KVIHDVLRANQIISI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00171085'-flap endonuclease activity
GO:0017116single-stranded DNA-dependent ATP-dependent DNA helicase activity
GO:0004386helicase activity
Vocabulary: biological process
TermDefinition
GO:0032508DNA duplex unwinding
GO:0033567DNA replication, Okazaki fragment processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041677DNA2/NAM7_AAA_11
IPR041679DNA2/NAM7-like_AAA
IPR011604Exonuc_phg/RecB_C
IPR026851Dna2
IPR014808DNA_replication_fac_Dna2_N
IPR027417P-loop_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014808DNA replication factor Dna2, N-terminalPFAMPF08696Dna2coord: 195..383
e-value: 3.0E-44
score: 151.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 909..1114
e-value: 4.8E-41
score: 142.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 654..908
e-value: 1.8E-48
score: 167.2
NoneNo IPR availablePANTHERPTHR10887DNA2/NAM7 HELICASE FAMILYcoord: 145..1093
NoneNo IPR availableCDDcd18808SF1_C_Upf1coord: 911..1096
e-value: 4.59468E-36
score: 133.128
NoneNo IPR availableCDDcd18041DEXXQc_DNA2coord: 702..910
e-value: 5.97481E-73
score: 238.675
IPR041677DNA2/NAM7 helicase, AAA domainPFAMPF13086AAA_11coord: 806..876
e-value: 3.5E-14
score: 53.2
IPR041679DNA2/NAM7 helicase-like, AAA domainPFAMPF13087AAA_12coord: 885..1089
e-value: 2.7E-42
score: 144.7
IPR011604Exonuclease, phage-type/RecB, C-terminalGENE3DG3DSA:3.90.320.10coord: 341..497
e-value: 4.2E-8
score: 35.1
IPR026851DNA replication ATP-dependent helicase/nuclease Dna2PANTHERPTHR10887:SF433DNA REPLICATION ATP-DEPENDENT HELICASE/NUCLEASE DNA2coord: 145..1093
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 695..1098