Endonuclease

Overview
NameEndonuclease
Smed IDSMED30014832
Length (bp)1152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endonuclease (SMED30014832) t-SNE clustered cells

Violin plots show distribution of expression levels for Endonuclease (SMED30014832) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endonuclease (SMED30014832) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endonuclease (SMED30014832) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014832

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014832SMESG000058962.1 dd_Smed_v4_14758_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30014832SMESG000058962.1 SmedASXL_015127SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014832SMESG000058962.1 SmedASXL_015127SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endonuclease vs. Ensembl Human
Match: ENDOG (endonuclease G [Source:HGNC Symbol;Acc:HGNC:3346])

HSP 1 Score: 166.392 bits (420), Expect = 5.115e-48
Identity = 88/226 (38.94%), Postives = 128/226 (56.64%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPIL 830
            +  Y  P    LK   ++VL Y+ +T+   WV+E L P  +    D    R++  F  D++ H   R+   DY  SGFDRGH+AAAANH+        +F ++N+ PQV  + N+  WN LE  +R++ R  +   VCTGPL+LP+ +   K +V+Y+VIG N+VAVPTHFFKVL++ E      +L  Y++PN P+        F VP+  IERA+G      IL
Sbjct:   64 LAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGD----RRECDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQV-PHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLIL-EAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNIL 283          
BLAST of Endonuclease vs. Ensembl Human
Match: EXOG (exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:3347])

HSP 1 Score: 140.584 bits (353), Expect = 1.300e-37
Identity = 77/215 (35.81%), Postives = 119/215 (55.35%), Query Frame = 3
Query:  183 NDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG-SKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINS--FKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIF 818
             + + Y N  LSY++  + P WV+E+++ + I    D    RK   F+ D    P F +   DY  SG+ RGHMA A N+K  S     +F ++NI PQ  +N N G WN++E   R +  R E   V +GPL LP+  G  KK V Y+VIG +NVAVP+H +KV+L + +++++    L  +++PN+ +        F V L D+E+ +G   F
Sbjct:   72 TEARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDAD----RKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDN-NSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFF 281          
BLAST of Endonuclease vs. Ensembl Human
Match: EXOG (exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:3347])

HSP 1 Score: 122.094 bits (305), Expect = 3.966e-31
Identity = 68/183 (37.16%), Postives = 100/183 (54.64%), Query Frame = 3
Query:  279 GMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG-SKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINS--FKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIF 818
            G   D    RK   F+ D    P F +   DY  SG+ RGHMA A N+K  S     +F ++NI PQ  +N N G WN++E   R +  R E   V +GPL LP+  G  KK V Y+VIG +NVAVP+H +KV+L + +++++    L  +++PN+ +        F V L D+E+ +G   F
Sbjct:   50 GKQPDGDADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDN-NSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFF 231          
BLAST of Endonuclease vs. Ensembl Human
Match: EXOG (exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:3347])

HSP 1 Score: 93.9745 bits (232), Expect = 3.966e-22
Identity = 55/148 (37.16%), Postives = 79/148 (53.38%), Query Frame = 3
Query:  186 DLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG-SKKFVQYE 626
            + + Y N  LSY++  + P WV+E+++ + I    D    RK   F+ D    P F +   DY  SG+ RGHMA A N+K  S     +F ++NI PQ  +N N G WN++E   R +  R E   V +GPL LP+  G  KK V Y+
Sbjct:   36 EARCYTNHALSYDQAKRVPRWVLEHISKSKIMGDAD----RKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDN-NSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTRGDGKKIVSYQ 178          
BLAST of Endonuclease vs. Ensembl Celegans
Match: cps-6 (Endonuclease G, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q95NM6])

HSP 1 Score: 181.415 bits (459), Expect = 3.949e-54
Identity = 98/227 (43.17%), Postives = 136/227 (59.91%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSI----GMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG-SKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFS 821
            I  + YP   +++ Y +FVLSY+ +T+   WV E+LTP  +    G+     EF+ D+TF         F S   DY  SGFDRGH+AAA NH+   +   ++F ++N+ PQVG  FNR  WN LE   R + ++   + + TGPLYLPK  G  KK+++Y+VIG+NNVAVPTHFFKV L  E     F+L  YILPN  +      + F+VPL  +ER+AG  IF+
Sbjct:   69 IMKHGYPGFTNVRTYEDFVLSYDYKTRTAHWVCEHLTPERLKHAEGVDRKLCEFKPDITFP------QKFLSQNTDYKCSGFDRGHLAAAGNHRKSQLAVDQTFYLSNMSPQVGRGFNRDKWNDLEMHCRRVAKKMINSYIITGPLYLPKLEGDGKKYIKYQVIGDNNVAVPTHFFKVALF-EVTPGKFELESYILPNAVIEDTVEISKFHVPLDAVERSAGLEIFA 288          
BLAST of Endonuclease vs. Ensembl Fly
Match: EndoG (gene:FBgn0033690 transcript:FBtr0088012)

HSP 1 Score: 198.749 bits (504), Expect = 1.148e-60
Identity = 105/266 (39.47%), Postives = 154/266 (57.89%), Query Frame = 3
Query:  102 FINAEAGTLVPVSNN----------ILPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLP-KQVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQ 866
            F    A +L+P   N          I  I  Y +P  + ++ ++++VLSY+R+ + P WV E+LT  S+    ++   R    F+ DE+ HP FRS   DY  SG+DRGHMAAA NH+     C  +F ++N+ PQVG+ FNR  WN LE+  R + +      VCTGPLYLP K+   K +V+YEVIG N VAVPTHF+KV +V E+  +   +  Y++PNQ +  +   ++F VP   +ER+AG   F  I +  +L+ IN K+
Sbjct:   48 FGTVSAASLIPAQENNVSLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAK--NDAVDRSKCDFKQDESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKV-IVGESADHKLHMESYVMPNQVISNDTPISVFQVPPESVERSAGLLFFDQINRK-QLTTINGKK 309          
BLAST of Endonuclease vs. Ensembl Fly
Match: Tengl2 (gene:FBgn0052463 transcript:FBtr0077808)

HSP 1 Score: 170.244 bits (430), Expect = 1.374e-49
Identity = 96/228 (42.11%), Postives = 131/228 (57.46%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQV-GSKKFVQYEVIGNNNVAVPTHFFKVLLVK-ETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            I  + +P  +DL++Y++FVLSY+R+ +   WV E+L  +SI   H N   R    ++ D +    FRS   DY  SGFDRGH+AAA NH      C  +F +TNI PQVG+ FNR  WN LE   R +V R     VCTGPLY P Q  G K  V+YE+IG N VAVPTHFFKV++V+ + ++    +  Y+LPN P+        F   + +IE  AG   F  + +
Sbjct:   75 IMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSI---HPNRGRRGRNPYQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFFDGLRR 299          
BLAST of Endonuclease vs. Ensembl Fly
Match: Tengl4 (gene:FBgn0037857 transcript:FBtr0082326)

HSP 1 Score: 112.464 bits (280), Expect = 1.521e-27
Identity = 69/224 (30.80%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  144 NILPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVGSKKF-VQYEVIGNNNVAVPTHFFKVLLVK-ETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGF 809
            ++  I  Y +P  +++ +Y NFVLSY+R+ +   WV E++    +    D     K   +  D T   +F +   D+ NS +  GH+A+  N+K D++    ++  TNI P +       IW +LES  R      +   V TGPL++P+++  + + V+Y V+G N VAVPTHFFK+++ + E N +   +  Y++PN  +  + +   F   + DIE  AG 
Sbjct:  132 HVADIMKYGFPGMDEIHVYKNFVLSYDRRNRIAHWVCEHVKSGCV-QERDEKTLNKPNAYITDNTIPTIFSANMRDFKNSDWVGGHLASPQNYKCDALKFLEAYKFTNIVP-INRGLKNHIWYRLESYVRDKAIEFDSVHVYTGPLFMPQRITFRNWSVRYHVMGMNTVAVPTHFFKIIIREDEFNRDMPIMEGYVVPNAYVDKDMDLRSFLADVRDIEHFAGL 353          
BLAST of Endonuclease vs. Ensembl Fly
Match: Tengl1 (gene:FBgn0051682 transcript:FBtr0077807)

HSP 1 Score: 68.1662 bits (165), Expect = 1.696e-12
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYN--NFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVGSKK-FVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLF--CYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPI 827
            I  Y +P  ND+ I    +FV S++R+     W+ E                R DL             S  V Y +S       + A        +  R F ++NI P +   FN  +W++L      + +R+      TG +YLP+++ S   F++++      VAVPTHFFK+L++ +        +   Y++PN PL  N         + +IE A G   F  +
Sbjct:   80 IMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCE----------------RVDL-------------SNRVVYGDS------TSVAPAGAFGQSEAARVFFLSNIRPFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGL 273          
BLAST of Endonuclease vs. Ensembl Fly
Match: Tengl3 (gene:FBgn0051679 transcript:FBtr0077809)

HSP 1 Score: 60.4622 bits (145), Expect = 6.773e-10
Identity = 60/244 (24.59%), Postives = 103/244 (42.21%), Query Frame = 3
Query:  138 SNNILPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK--QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLF--CYILPNQPLVTNGNFNLFYVPLVDIERAAGFF---IFSPILKYLKLS 848
            + ++L +  Y  P   +L ++ ++V+S + +T    W+ E+                              FR    DY     D G  +      ND       +V++     + + F R IWN LE+   ++ +        TGP+Y P   ++G K  ++YEV     + VP+HFFKVL+V E+ +   + F   +I+ N   V  G  N   V + +IER  G     I  P++++ K S
Sbjct:  105 TTDLLDLVKYGLPSTENLYVHKDYVVSQDLRTNGVRWICEH------------------------------FRG---DYQRVSSDGGGYSTMNLRYNDV------YVLSCGSMSICKAFKRKIWNDLENYVSSMAKEFGSVYAYTGPIYTPTCYEIG-KWTMKYEVFDWIPIPVPSHFFKVLIV-ESGVPGSQPFMEAFIIENSRRV-GGKLNDHRVKVGEIERYTGLRFNKIMQPVVQFGKDS 306          
BLAST of Endonuclease vs. Ensembl Zebrafish
Match: endog (endonuclease G [Source:ZFIN;Acc:ZDB-GENE-050522-402])

HSP 1 Score: 165.622 bits (418), Expect = 7.075e-48
Identity = 88/224 (39.29%), Postives = 129/224 (57.59%), Query Frame = 3
Query:  165 YRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ-VGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            Y +P  +++K   ++V SY+ + +   WVIE L   ++    D    RK   F+ DE+ H   RS   DY  SGFDRGH+AAAANHK        +F ++N+ PQ   N N+  WN LE   R++ +  +   VCTGPLYLP+Q    K +V+Y+V+G N+VAVPTHFFKV+++++      +L  Y++PN P+        F VP+  IERA+G      I+K
Sbjct:   78 YGFPSLSNIKSRESYVTSYDPRNRTAAWVIEQLNAETVTGSSD----RKYCEFKEDESVHVYHRSSNADYKGSGFDRGHLAAAANHKWSQKAMDETFYLSNVSPQ-NPNLNQNAWNNLEKYCRSLTKHYQNVFVCTGPLYLPRQEADGKMYVKYQVLGKNHVAVPTHFFKVVILEKPR-GDVELRSYVMPNMPVDEKIPLERFLVPIESIERASGLLFVPNIMK 295          
BLAST of Endonuclease vs. Ensembl Xenopus
Match: endog (endonuclease G [Source:NCBI gene;Acc:549956])

HSP 1 Score: 168.318 bits (425), Expect = 7.640e-49
Identity = 89/227 (39.21%), Postives = 137/227 (60.35%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLP-KQVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            +  +  P  + LK   ++VLSY+ + + P WV+E+L+P  +   H + E R+   F+ D + H   R+   D+  SGFDRGH+AAAANHK        +F+++NI PQ   + N+  WN LE   R++ ++N+   VCTGPL+LP ++     +V+Y+VIG+NNVAVPTHFFKV+++++ +    +L  Y++PN P+        F VP+  IERAAG      ILK
Sbjct:   61 LTRFGLPGLSQLKSRESYVLSYDPRLRGPAWVLEHLSPERL---HGSAE-RQGCDFQEDVSVHQYHRAANSDFKGSGFDRGHLAAAANHKWSQKAMDETFILSNIYPQ-NPHLNQKAWNNLERYCRSVTKKNKNVYVCTGPLFLPRREPDGNMYVKYQVIGSNNVAVPTHFFKVVVLEKFS-GEIELRSYVMPNHPVDEQIPLERFLVPIESIERAAGLLFVPNILK 281          
BLAST of Endonuclease vs. Ensembl Mouse
Match: Endog (endonuclease G [Source:MGI Symbol;Acc:MGI:1261433])

HSP 1 Score: 164.466 bits (415), Expect = 1.862e-47
Identity = 88/226 (38.94%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPIL 830
            +  Y  P    L+   ++VLSY+ +T+   WV+E L P  +    D    R    F  D++ H   R+   DY  SGFDRGH+AAAANH+        +F ++N+ PQV  + N+  WN LE  +R++ R  +   VCTGPL+LP+ +   K +V+Y+VIG N+VAVPTHFFKVL++ E      +L  Y++PN P+        F VP+  IERA+G      IL
Sbjct:   61 LAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGD----RSACDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQV-PHLNQNAWNNLERYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLIL-EAAGGQIELRSYVMPNAPVDETIPLERFLVPIESIERASGLLFVPNIL 280          
BLAST of Endonuclease vs. Ensembl Mouse
Match: Exog (endo/exonuclease (5'-3'), endonuclease G-like [Source:MGI Symbol;Acc:MGI:2143333])

HSP 1 Score: 129.413 bits (324), Expect = 1.315e-33
Identity = 74/214 (34.58%), Postives = 116/214 (54.21%), Query Frame = 3
Query:  186 DLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLP-KQVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKET--NINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIF 818
            + + Y N  LSY++  + P WV+E+++ + I    D    RK   F+ D +    F +L  DY  SG+ RGHMA A N+K  S     +F ++NI PQ  +N N G WN++E   R +  R E   + +GPL LP  +    K V Y+VIG +NVAVP+H +KV+L + +  +     L  +++PN+ +      + F V L D+E+ +G   F
Sbjct:   73 ETRRYTNHALSYDQAKRVPRWVLEHISKDKIIGDAD----RKHCKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFDN-NSGYWNRIEMYCRELTERFEDVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVILARRSPESTEPLALGAFVVPNKAIGFQSQLSEFQVSLHDLEKMSGLVFF 281          
BLAST of Endonuclease vs. UniProt/SwissProt
Match: sp|Q95NM6|NUCG_CAEEL (Endonuclease G, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cps-6 PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.023e-53
Identity = 98/227 (43.17%), Postives = 136/227 (59.91%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSI----GMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG-SKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFS 821
            I  + YP   +++ Y +FVLSY+ +T+   WV E+LTP  +    G+     EF+ D+TF         F S   DY  SGFDRGH+AAA NH+   +   ++F ++N+ PQVG  FNR  WN LE   R + ++   + + TGPLYLPK  G  KK+++Y+VIG+NNVAVPTHFFKV L  E     F+L  YILPN  +      + F+VPL  +ER+AG  IF+
Sbjct:   69 IMKHGYPGFTNVRTYEDFVLSYDYKTRTAHWVCEHLTPERLKHAEGVDRKLCEFKPDITFP------QKFLSQNTDYKCSGFDRGHLAAAGNHRKSQLAVDQTFYLSNMSPQVGRGFNRDKWNDLEMHCRRVAKKMINSYIITGPLYLPKLEGDGKKYIKYQVIGDNNVAVPTHFFKVALF-EVTPGKFELESYILPNAVIEDTVEISKFHVPLDAVERSAGLEIFA 288          
BLAST of Endonuclease vs. UniProt/SwissProt
Match: sp|Q14249|NUCG_HUMAN (Endonuclease G, mitochondrial OS=Homo sapiens OX=9606 GN=ENDOG PE=1 SV=4)

HSP 1 Score: 166.392 bits (420), Expect = 2.456e-47
Identity = 88/226 (38.94%), Postives = 128/226 (56.64%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPIL 830
            +  Y  P    LK   ++VL Y+ +T+   WV+E L P  +    D    R++  F  D++ H   R+   DY  SGFDRGH+AAAANH+        +F ++N+ PQV  + N+  WN LE  +R++ R  +   VCTGPL+LP+ +   K +V+Y+VIG N+VAVPTHFFKVL++ E      +L  Y++PN P+        F VP+  IERA+G      IL
Sbjct:   64 LAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGD----RRECDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQV-PHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLIL-EAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNIL 283          
BLAST of Endonuclease vs. UniProt/SwissProt
Match: sp|O08600|NUCG_MOUSE (Endonuclease G, mitochondrial OS=Mus musculus OX=10090 GN=Endog PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.303e-46
Identity = 88/226 (38.94%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPIL 830
            +  Y  P    L+   ++VLSY+ +T+   WV+E L P  +    D    R    F  D++ H   R+   DY  SGFDRGH+AAAANH+        +F ++N+ PQV  + N+  WN LE  +R++ R  +   VCTGPL+LP+ +   K +V+Y+VIG N+VAVPTHFFKVL++ E      +L  Y++PN P+        F VP+  IERA+G      IL
Sbjct:   61 LAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRPERLRGDGD----RSACDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQV-PHLNQNAWNNLERYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLIL-EAAGGQIELRSYVMPNAPVDETIPLERFLVPIESIERASGLLFVPNIL 280          
BLAST of Endonuclease vs. UniProt/SwissProt
Match: sp|P38447|NUCG_BOVIN (Endonuclease G, mitochondrial OS=Bos taurus OX=9913 GN=ENDOG PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 5.757e-46
Identity = 89/226 (39.38%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPIL 830
            +  Y  P    LK   ++VL Y+ +T+   WV+E L P   G+  D    R    F  D++ H   R+   DY  SGFDRGH+AAAANH+        +F ++N+ PQV  + N+  WN LE  +R++ R  +   VCTGPL+LP+ +   K +V+Y+VIG N+VAVPTHFFKVL++ E      +L  Y++PN P+        F VP+  IERA+G      IL
Sbjct:   66 LAKYGLPGVAQLKSRASYVLCYDPRTRGALWVVEQLRPE--GLRGDGN--RSSCDFHEDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQV-PHLNQNAWNNLEKYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLIL-EAAGGQIELRSYVMPNAPVDEAIPLEHFLVPIESIERASGLLFVPNIL 285          
BLAST of Endonuclease vs. UniProt/SwissProt
Match: sp|P08466|NUC1_YEAST (Mitochondrial nuclease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUC1 PE=1 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.507e-43
Identity = 85/222 (38.29%), Postives = 128/222 (57.66%), Query Frame = 3
Query:  183 NDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ--VGSKKFVQYEVIGN-NNVAVPTHFFKVLLVKETNINSFK----LFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPI 827
            +DL+    F+  YNRQT+NP WV+E++TP S+   + +   RK+  F+ DE     FR    DY  SG+DRGH A AA+ K        +F ++N+CPQVGE FNR  W  LE   R + ++ +   + TGPLYLPK+  + +K  V YEVIGN  ++AVPTHFFK+++ +    N  +    +  ++LPN+P+        F VP+  +ER+ G  +   +
Sbjct:   69 HDLQNREEFISCYNRQTQNPYWVLEHITPESLAARNAD---RKNSFFKEDEVIPEKFRGKLRDYFRSGYDRGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLYLPKKDPIDNKFRVNYEVIGNPPSIAVPTHFFKLIVAEAPTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKV 287          
BLAST of Endonuclease vs. TrEMBL
Match: A0A1I8IF12 (Endonuclease OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 3.881e-65
Identity = 110/223 (49.33%), Postives = 149/223 (66.82%), Query Frame = 3
Query:  183 NDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEF--DETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ-VGSK-KFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPN--QPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            +++K+++++VL+Y+R+ + P WV+E L   S   P           FEF  D  +HP FR+   DYA SG+DRGHMAAA NHK+ S  C ++F+++NICPQVG  FNR +WN LE   R++ +      VCTGPL+LP Q  GSK KFVQYEV+G+N+VAVPTHFFKV+L+ ET    F+L CY++PN   P+    + +LF VPL  IERAAGF IF  + K
Sbjct:   27 SNVKLFDDYVLAYDRRLRIPAWVVERLDNQSRPNPASTSSVVDRAGFEFYEDLAQHPYFRASNSDYAGSGYDRGHMAAAGNHKSSSASCLQTFILSNICPQVGNGFNRHLWNSLERYIRSLTKHYSAVYVCTGPLFLPTQHSGSKRKFVQYEVLGSNSVAVPTHFFKVVLL-ETPAQQFELLCYLVPNMAHPVNPEPSLDLFLVPLDAIERAAGFLIFDQVQK 248          
BLAST of Endonuclease vs. TrEMBL
Match: A0A267GZS2 (Endonuclease (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022984g2 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.585e-65
Identity = 115/254 (45.28%), Postives = 157/254 (61.81%), Query Frame = 3
Query:  141 NNILPIPNYRYPD-----------------KNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEF--DETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ-VGSK-KFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPN--QPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            N +LP+P  + P                   +++K+++++VL+Y+R+ + P WV+E L   S   P           FEF  D  +HP FR+   DYA SG+DRGHMAAA NHK+ S  C ++F+++NICPQVG  FNR +WN LE   R++ +      VCTGPL+LP Q  GSK KFVQYEV+G+N+VAVPTHFFKV+L+ ET    F+L CY++PN   P+    + +LF VPL  IERAAGF IF  + K
Sbjct:   46 NALLPMPTTQLPSNSNSRAQQILRFGSPTTDSNVKLFDDYVLAYDRRLRIPAWVVERLDNQSRPNPASTSSVVDRAGFEFYEDLAQHPYFRASNSDYAGSGYDRGHMAAAGNHKSSSASCLQTFILSNICPQVGNGFNRHLWNSLERYIRSLTKHYSAVYVCTGPLFLPTQHSGSKRKFVQYEVLGSNSVAVPTHFFKVVLL-ETPAQQFELLCYLVPNMAHPVNPEPSLDLFLVPLDAIERAAGFLIFDQVQK 298          
BLAST of Endonuclease vs. TrEMBL
Match: A0A1I8N062 (Endonuclease OS=Musca domestica OX=7370 GN=101896925 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.323e-64
Identity = 114/248 (45.97%), Postives = 158/248 (63.71%), Query Frame = 3
Query:  126 LVPVSNNILPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQV-GSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQ 866
            L      +  I  Y +P  + ++ Y++FVLSY+R+ + P+WV E++T  SI   ++N + R    F+ DE+ HP F+S   DY  SGFDRGHMAAA NHK     C  +F +TN+ PQVG+ FNR  W +LES TRA+ +      VCTGPLYLPKQ    KK+V+Y+VIGNNNVAVPTHF+KV +V ET+ N  ++  Y++PNQ +  +   ++F VP   +ERAAG   F  I K  +L +IN K+
Sbjct:   71 LTATPQRVGEIMKYGFPSLDSVRSYSDFVLSYDRRNRVPNWVFEHITAESIAK-NENVD-RSKCDFKVDESIHPYFQSQNSDYRRSGFDRGHMAAAGNHKRHQKHCEDTFYLTNMAPQVGQGFNRDSWERLESHTRALTKVYTNVYVCTGPLYLPKQEDDGKKYVKYQVIGNNNVAVPTHFYKV-IVGETSDNHLEMESYVMPNQVISDDTPLSVFQVPPESVERAAGLLFFDKINK-KQLRKINGKK 314          
BLAST of Endonuclease vs. TrEMBL
Match: A0A267H6P9 (Endonuclease (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004414g1 PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.654e-64
Identity = 115/254 (45.28%), Postives = 157/254 (61.81%), Query Frame = 3
Query:  141 NNILPIPNYRYPD-----------------KNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEF--DETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ-VGSK-KFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPN--QPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            N +LP+P  + P                   +++K+++++VL+Y+R+ + P WV+E L   S   P           FEF  D  +HP FR+   DYA SG+DRGHMAAA NHK+ S  C ++F+++NICPQVG  FNR +WN LE   R++ +      VCTGPL+LP Q  GSK KFVQYEV+G+N+VAVPTHFFKV+L+ ET    F+L CY++PN   P+    + +LF VPL  IERAAGF IF  + K
Sbjct:   49 NALLPMPTTQLPSNPNSRAQQILRFGSPTTDSNVKLFDDYVLAYDRRLRIPAWVVERLDNQSRPNPASTSSVVDRAGFEFYEDLAQHPYFRASNSDYAGSGYDRGHMAAAGNHKSSSAACLQTFILSNICPQVGNGFNRHLWNSLERYIRSLTKHYSAVYVCTGPLFLPIQHSGSKRKFVQYEVLGSNSVAVPTHFFKVVLL-ETPAQQFELLCYLVPNMAHPVNPEPSLDLFLVPLDAIERAAGFLIFDQVQK 301          
BLAST of Endonuclease vs. TrEMBL
Match: A0A1I8HVW5 (Endonuclease OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.853e-64
Identity = 110/223 (49.33%), Postives = 149/223 (66.82%), Query Frame = 3
Query:  183 NDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEF--DETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ-VGSK-KFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPN--QPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            +++K+++++VL+Y+R+ + P WV+E L   S   P           FEF  D  +HP FR+   DYA SG+DRGHMAAA NHK+ S  C ++F+++NICPQVG  FNR +WN LE   R++ +      VCTGPL+LP Q  GSK KFVQYEV+G+N+VAVPTHFFKV+L+ ET    F+L CY++PN   P+    + +LF VPL  IERAAGF IF  + K
Sbjct:   27 SNVKLFDDYVLAYDRRLRIPAWVVERLDNQSRPNPASTSSVVDRAGFEFYEDLAQHPYFRASNSDYAGSGYDRGHMAAAGNHKSSSAACLQTFILSNICPQVGNGFNRHLWNSLERYIRSLTKHYSAVYVCTGPLFLPIQHSGSKRKFVQYEVLGSNSVAVPTHFFKVVLL-ETPAQQFELLCYLVPNMAHPVNPEPSLDLFLVPLDAIERAAGFLIFDQVQK 248          
BLAST of Endonuclease vs. Ensembl Cavefish
Match: endog (endonuclease G [Source:ZFIN;Acc:ZDB-GENE-050522-402])

HSP 1 Score: 164.466 bits (415), Expect = 2.424e-47
Identity = 91/242 (37.60%), Postives = 135/242 (55.79%), Query Frame = 3
Query:  120 GTLVPVSN---NILPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQV-GSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            G L+P          +  Y +P  ++++   ++V SY+ + +   WVIE L+P ++    D    RK   F+ DE+ H   RS   DY  SGFDRGH+AAAANHK        +F ++N+ PQ   + N+  WN LE   R++ ++     VC+GPLYLP+Q    K +V+Y+VIG N+VAVPTHFFKV+++ E      +L  Y++PN P+        F VP+  IERA+G      I+K
Sbjct:   67 GALIPGGGGGGKSAAVMKYGFPSLSNVRSRESYVSSYDPRCRTAAWVIEQLSPETLSGSAD----RKRCDFKEDESVHVYHRSTNPDYRGSGFDRGHLAAAANHKWSQKAMEDTFYLSNVAPQ-NPHLNQNAWNNLEQYCRSLTKQFHNVFVCSGPLYLPRQEPDGKMYVKYQVIGKNHVAVPTHFFKVVIL-ENRRGEVELRSYVMPNTPVDDKIPLERFLVPIESIERASGLLFVPNIMK 302          
BLAST of Endonuclease vs. Ensembl Cavefish
Match: EXOG (exo/endonuclease G [Source:NCBI gene;Acc:103039129])

HSP 1 Score: 130.183 bits (326), Expect = 4.625e-34
Identity = 88/264 (33.33%), Postives = 131/264 (49.62%), Query Frame = 3
Query:   48 SAGGILTIITEYYTSHTDFINAEAGTLVPVSNNI----LPIPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVG--SKKFVQYEVIGNNNVAVPTHFFKVLLV-KETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIF 818
            S G  +T +  Y T      + E  T   V   I    LP+         + + Y+N + SY++  + P WV E+L+ N +    D    RK   F+ D      F +   DY  SG+ RGHMA A ++K        SF ++NI PQ  EN N G WN+LE   R +  R     V +GPL LP+ VG   KK V Y++IG ++VAVPTH +KV+LV K+ +     +  +++PN P+  +     + V L ++ER +G   F
Sbjct:   21 STGACITALRLYLTKQ-QLQHEETQTESAVQRLIKLYGLPLTG------AETRSYSNHIQSYDQSRRIPRWVAEHLSNNKLVGGAD----RKHCKFKPDPNIPQCFTAHNEDYLGSGWSRGHMAPAGDNKFSEQSMEESFYLSNIVPQNYEN-NAGFWNRLEMYCRELTERFSDVWVISGPLTLPR-VGEDGKKAVSYQLIGKDDVAVPTHLYKVVLVRKDMSAEPLAMAAFVVPNAPIGFDHQLKEYQVSLSELERMSGLTFF 271          
BLAST of Endonuclease vs. Ensembl Yeast
Match: NUC1 (Major mitochondrial nuclease; has RNAse and DNA endo- and exonucleolytic activities; roles in mitochondrial recombination, apoptosis and maintenance of polyploidy; involved in fragmentation of genomic DNA during PND (programmed nuclear destruction); encodes ortholog of mammalian endoG [Source:SGD;Acc:S000003744])

HSP 1 Score: 156.762 bits (395), Expect = 3.611e-45
Identity = 85/222 (38.29%), Postives = 128/222 (57.66%), Query Frame = 3
Query:  183 NDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQ--VGSKKFVQYEVIGN-NNVAVPTHFFKVLLVKETNINSFK----LFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPI 827
            +DL+    F+  YNRQT+NP WV+E++TP S+   + +   RK+  F+ DE     FR    DY  SG+DRGH A AA+ K        +F ++N+CPQVGE FNR  W  LE   R + ++ +   + TGPLYLPK+  + +K  V YEVIGN  ++AVPTHFFK+++ +    N  +    +  ++LPN+P+        F VP+  +ER+ G  +   +
Sbjct:   69 HDLQNREEFISCYNRQTQNPYWVLEHITPESLAARNAD---RKNSFFKEDEVIPEKFRGKLRDYFRSGYDRGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLYLPKKDPIDNKFRVNYEVIGNPPSIAVPTHFFKLIVAEAPTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKV 287          
BLAST of Endonuclease vs. Ensembl Nematostella
Match: EDO45231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTL4])

HSP 1 Score: 176.022 bits (445), Expect = 4.711e-53
Identity = 94/226 (41.59%), Postives = 137/226 (60.62%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHK-NDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPK-QVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPI 827
            I  + YP   +LK  +++VLSYNR+ + P+WV E+LT   +         R    F  D + HP+FR    DY  SG+DRGHMAAAANH+ +   +C ++F+++NI PQVG  FNR  W  LE   R + R  +   V TGPL+LPK +     +V+Y++IG + +AVPTH+FKV+L +  N N ++L  YILPNQP+      + F VP+  IE+A+G  +F  +
Sbjct:   16 IMRFGYPGYENLKYRDDYVLSYNRRLRLPNWVCEHLTVERL---RKRVADRSKCDFTIDTSVHPMFRVTNEDYRKSGYDRGHMAAAANHQYSQDANC-QTFLLSNIGPQVGSGFNRDSWEHLEKYVRHLPRSYKNVYVLTGPLFLPKLEQDGHLYVKYKLIGQHRIAVPTHYFKVVLTESHN-NKYELQSYILPNQPINEKTPLHRFQVPVETIEKASGLVMFEKL 236          
BLAST of Endonuclease vs. Ensembl Nematostella
Match: EDO41220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4V6])

HSP 1 Score: 130.954 bits (328), Expect = 2.606e-35
Identity = 82/227 (36.12%), Postives = 120/227 (52.86%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKI-YNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNP--EFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQV---GSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIF 818
            I +Y  P ++   I Y N VL Y++  K P WV E++T + +    +    +FR DL          +F++   DY   G+ RGHMA AA+ + D      +F ++N+ PQ   N N   W +LES  R + +      V TGPL+LP +    G KKFV+YEVIG+NNVAVPTH FK +L  ET      L  +I+PNQP+  + +   F V +  + + +G   F
Sbjct:    2 ISSYGLPRRSTEFIQYRNHVLCYDQARKIPRWVYEHVTADKLKGEGERSRCDFRPDLNVP------AIFQATNEDYLGRGWSRGHMAPAADCRFDQQAMSETFFLSNVVPQDLNN-NSSFWYRLESYCRYLTKHYSDVHVVTGPLFLPSEEDENGGKKFVKYEVIGDNNVAVPTHLFKAILA-ETEGKPALLGAFIVPNQPISFDRDLKEFQVSIEKLSKDSGLVFF 220          
BLAST of Endonuclease vs. Ensembl Nematostella
Match: EDO36065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM1])

HSP 1 Score: 54.6842 bits (130), Expect = 3.816e-8
Identity = 51/184 (27.72%), Postives = 81/184 (44.02%), Query Frame = 3
Query:  189 LKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMD-CRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVGSK-------KFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLF 716
            L   + ++  Y+   + P WV   L     G   D    RKD  F  D        S    Y  SGFDRGHM   A+H  D       +F+++NI PQ    FN   W  LE   R +   +   ++ +GP++     G++       ++++ +    N VA+PTHF+K+  +   N+N   L+
Sbjct:  517 LLTQSEYLTGYSTYLRLPLWVGYRLD----GEKSDQTLPRKD-CFRHDVRLTNAQASTCTHYYKSGFDRGHMVPNADHDYDEYRPTMNTFLLSNIAPQY-HKFNIRDWLNLEIYVRDLASGSTIYVI-SGPIFDEDADGNRDHDNNITRWIKDDR--PNTVAIPTHFYKI--ITRCNVNKTSLY 689          
BLAST of Endonuclease vs. Ensembl Medaka
Match: endog (endonuclease G [Source:NCBI gene;Acc:101165647])

HSP 1 Score: 177.948 bits (450), Expect = 1.060e-52
Identity = 90/227 (39.65%), Postives = 134/227 (59.03%), Query Frame = 3
Query:  156 IPNYRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLP-KQVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILK 833
            +  Y +P   ++K   ++V SY+ +T+  +WVIE L P ++    D    RK   F+ D++ H   R+   DY  SGFDRGH+AAA NHK        +F ++N+ PQV  + N+  WN LE L R++ +R     VCTGPLYLP ++     +V+Y+VIG N+VAVPTHFFKVL++++ +    +L  Y+LPN+P+        F VP+  IERA+G      I+K
Sbjct:   70 VMKYGFPSLVNVKTRESYVTSYDPRTRTANWVIERLNPAALTGQSD----RKYCEFKEDDSVHVFHRATNADYKGSGFDRGHLAAAGNHKWSQKAMEDTFYLSNVAPQVNPHLNQKTWNNLEKLCRSLTKRYLNVYVCTGPLYLPRREANGNLYVRYQVIGRNHVAVPTHFFKVLILEQADGRGVELRSYVLPNEPVDEQIPLETFLVPIETIERASGLLFVPNIMK 292          
BLAST of Endonuclease vs. Planmine SMEST
Match: SMESG000058962.1 (SMESG000058962.1)

HSP 1 Score: 407.527 bits (1046), Expect = 3.495e-144
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = 3
Query:  282 MPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVGSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQYG 872
            MPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQV SKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQYG
Sbjct:    1 MPHDNPEFRKDLTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMTNICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVCSKKFVQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFNLFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQYG 197          
The following BLAST results are available for this feature:
BLAST of Endonuclease vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENDOG5.115e-4838.94endonuclease G [Source:HGNC Symbol;Acc:HGNC:3346][more]
EXOG1.300e-3735.81exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:33... [more]
EXOG3.966e-3137.16exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:33... [more]
EXOG3.966e-2237.16exo/endonuclease G [Source:HGNC Symbol;Acc:HGNC:33... [more]
back to top
BLAST of Endonuclease vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cps-63.949e-5443.17Endonuclease G, mitochondrial [Source:UniProtKB/S... [more]
back to top
BLAST of Endonuclease vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EndoG1.148e-6039.47gene:FBgn0033690 transcript:FBtr0088012[more]
Tengl21.374e-4942.11gene:FBgn0052463 transcript:FBtr0077808[more]
Tengl41.521e-2730.80gene:FBgn0037857 transcript:FBtr0082326[more]
Tengl11.696e-1225.33gene:FBgn0051682 transcript:FBtr0077807[more]
Tengl36.773e-1024.59gene:FBgn0051679 transcript:FBtr0077809[more]
back to top
BLAST of Endonuclease vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
endog7.075e-4839.29endonuclease G [Source:ZFIN;Acc:ZDB-GENE-050522-40... [more]
back to top
BLAST of Endonuclease vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
endog7.640e-4939.21endonuclease G [Source:NCBI gene;Acc:549956][more]
back to top
BLAST of Endonuclease vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Endog1.862e-4738.94endonuclease G [Source:MGI Symbol;Acc:MGI:1261433][more]
Exog1.315e-3334.58endo/exonuclease (5'-3'), endonuclease G-like [Sou... [more]
back to top
BLAST of Endonuclease vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95NM6|NUCG_CAEEL5.023e-5343.17Endonuclease G, mitochondrial OS=Caenorhabditis el... [more]
sp|Q14249|NUCG_HUMAN2.456e-4738.94Endonuclease G, mitochondrial OS=Homo sapiens OX=9... [more]
sp|O08600|NUCG_MOUSE1.303e-4638.94Endonuclease G, mitochondrial OS=Mus musculus OX=1... [more]
sp|P38447|NUCG_BOVIN5.757e-4639.38Endonuclease G, mitochondrial OS=Bos taurus OX=991... [more]
sp|P08466|NUC1_YEAST2.507e-4338.29Mitochondrial nuclease OS=Saccharomyces cerevisiae... [more]
back to top
BLAST of Endonuclease vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IF123.881e-6549.33Endonuclease OS=Macrostomum lignano OX=282301 PE=3... [more]
A0A267GZS24.585e-6545.28Endonuclease (Fragment) OS=Macrostomum lignano OX=... [more]
A0A1I8N0621.323e-6445.97Endonuclease OS=Musca domestica OX=7370 GN=1018969... [more]
A0A267H6P91.654e-6445.28Endonuclease (Fragment) OS=Macrostomum lignano OX=... [more]
A0A1I8HVW51.853e-6449.33Endonuclease OS=Macrostomum lignano OX=282301 PE=3... [more]
back to top
BLAST of Endonuclease vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
endog2.424e-4737.60endonuclease G [Source:ZFIN;Acc:ZDB-GENE-050522-40... [more]
EXOG4.625e-3433.33exo/endonuclease G [Source:NCBI gene;Acc:103039129... [more]
back to top
BLAST of Endonuclease vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endonuclease vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NUC13.611e-4538.29Major mitochondrial nuclease; has RNAse and DNA en... [more]
back to top
BLAST of Endonuclease vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO452314.711e-5341.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412202.606e-3536.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360653.816e-827.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endonuclease vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
endog1.060e-5239.65endonuclease G [Source:NCBI gene;Acc:101165647][more]
back to top
BLAST of Endonuclease vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058962.13.495e-14499.49SMESG000058962.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014832 ID=SMED30014832|Name=Endonuclease|organism=Schmidtea mediterranea sexual|type=transcript|length=1152bp
TGATAAATTGAAAAATGAATAAAATATTGAAAACTCTAGCAGTCTTTAGT
GCTGGAGGTATTTTGACAATAATTACAGAATATTATACTTCACATACTGA
TTTTATCAATGCTGAGGCAGGTACATTAGTTCCAGTTTCAAATAATATTT
TACCAATTCCAAATTATCGATATCCGGACAAAAATGATTTGAAAATATAT
AATAATTTCGTATTATCTTATAACAGACAAACTAAAAATCCAGATTGGGT
TATTGAATATCTAACGCCTAATTCGATTGGAATGCCACATGACAATCCTG
AATTTAGAAAAGATCTAACGTTTGAATTTGACGAAACCGAGCATCCTTTG
TTCCGGTCATTGCCGGTGGATTATGCCAATTCCGGCTTTGACCGGGGACA
CATGGCCGCAGCAGCCAATCACAAAAACGATTCAATGGATTGCAGGAGGT
CTTTCGTTATGACCAATATTTGTCCCCAAGTTGGTGAAAACTTCAATAGA
GGTATTTGGAACAAATTAGAAAGTTTAACTCGCGCCATAGTTAGAAGAAA
TGAATTTGCCATTGTTTGCACTGGCCCGCTTTATTTACCCAAACAGGTTG
GTTCCAAGAAATTTGTTCAGTATGAAGTAATCGGTAACAATAATGTCGCT
GTTCCCACCCATTTTTTCAAAGTTCTTCTCGTAAAAGAAACAAATATAAA
TTCGTTTAAATTATTTTGTTATATTCTCCCAAATCAACCGCTAGTAACAA
ATGGCAATTTTAATTTATTTTATGTGCCACTTGTTGATATTGAAAGAGCG
GCAGGATTTTTTATTTTCAGCCCGATATTAAAATATTTGAAGCTGAGTCA
AATTAATGATAAGCAATATGGCTAATAGTTTTGTAAATTGTCTTTATTTT
CTATCAATTCTACTCGTTGTCCATAGAATAAACCTTCTCGTCAGTCGTGC
AAATCTTTTTTTCTATTCTGTGATTATTTGTGATTGGTCAAAATCATAAC
AGGTCGGCCCATTGTTGATTGTAGAAACTTGTAAAGCAAAAATAAAATCA
AAAATTACTAAACCACTCATAGAATCCATGTAAAGCCACGTTACAAATTT
GAAAATAAAAAAAGTAAATTTTAAAAACCAAATTTTTTTTTATATCTTTT
CC
back to top

protein sequence of SMED30014832-orf-1

>SMED30014832-orf-1 ID=SMED30014832-orf-1|Name=SMED30014832-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MNKILKTLAVFSAGGILTIITEYYTSHTDFINAEAGTLVPVSNNILPIPN
YRYPDKNDLKIYNNFVLSYNRQTKNPDWVIEYLTPNSIGMPHDNPEFRKD
LTFEFDETEHPLFRSLPVDYANSGFDRGHMAAAANHKNDSMDCRRSFVMT
NICPQVGENFNRGIWNKLESLTRAIVRRNEFAIVCTGPLYLPKQVGSKKF
VQYEVIGNNNVAVPTHFFKVLLVKETNINSFKLFCYILPNQPLVTNGNFN
LFYVPLVDIERAAGFFIFSPILKYLKLSQINDKQYG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0000737DNA catabolic process, endonucleolytic
GO:0006309apoptotic DNA fragmentation
GO:0006401RNA catabolic process
GO:0006915apoptotic process
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040255Non-specific_endonuclease
IPR020821Extracellular_endonuc_su_A
IPR001604DNA/RNA_non-sp_Endonuclease
IPR018524DNA/RNA_endonuclease_AS
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0003676nucleic acid binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0004520endodeoxyribonuclease activity
GO:0004521endoribonuclease activity
GO:0042803protein homodimerization activity
GO:0043565sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001604DNA/RNA non-specific endonucleaseSMARTSM00892Endonuclease_NS_2coord: 61..275
e-value: 2.9E-50
score: 183.0
IPR001604DNA/RNA non-specific endonucleasePFAMPF01223Endonuclease_NScoord: 52..268
e-value: 8.9E-51
score: 172.9
IPR020821Extracellular Endonuclease, subunit ASMARTSM00477endopluscoord: 62..274
e-value: 5.6E-54
score: 195.3
NoneNo IPR availableGENE3DG3DSA:3.40.570.10coord: 33..285
e-value: 2.7E-74
score: 251.8
NoneNo IPR availablePANTHERPTHR13966:SF5ENDONUCLEASE G, MITOCHONDRIALcoord: 49..271
NoneNo IPR availableCDDcd00091NUCcoord: 55..273
e-value: 1.05436E-47
score: 157.532
NoneNo IPR availableSUPERFAMILYSSF54060His-Me finger endonucleasescoord: 43..270
IPR040255Non-specific endonucleasePANTHERPTHR13966ENDONUCLEASE RELATEDcoord: 49..271
IPR018524DNA/RNA non-specific endonuclease, active sitePROSITEPS01070NUCLEASE_NON_SPECcoord: 126..134