Aldolase_II domain-containing protein

Overview
NameAldolase_II domain-containing protein
Smed IDSMED30014826
Length (bp)879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldolase_II domain-containing protein (SMED30014826) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldolase_II domain-containing protein (SMED30014826) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldolase_II domain-containing protein (SMED30014826) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldolase_II domain-containing protein (SMED30014826) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014826

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014826h1SMcG0001161 SmedASXL_013533SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30014826h1SMcG0001161 dd_Smed_v4_15554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014826h1SMcG0001161 dd_Smed_v4_11759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014826h1SMcG0001161 dd_Smed_v4_11759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014826h1SMcG0001161 dd_Smed_v6_15554_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 72.0182 bits (175), Expect = 1.568e-13
Identity = 73/276 (26.45%), Postives = 131/276 (47.46%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNI-VFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + SN +++N+     D   T LK     F  H  + +T  + +C + I+      +S    G++PISQESLLL      ++ +Y+        +  S E+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+ L+      N+ V   ++ K    T+   G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLG-----DVAYYD--------YQGSLEE------QEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGSHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 72.0182 bits (175), Expect = 1.568e-13
Identity = 73/276 (26.45%), Postives = 131/276 (47.46%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNI-VFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + SN +++N+     D   T LK     F  H  + +T  + +C + I+      +S    G++PISQESLLL      ++ +Y+        +  S E+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+ L+      N+ V   ++ K    T+   G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLG-----DVAYYD--------YQGSLEE------QEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGSHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Match: ADD3 (adducin 3 [Source:HGNC Symbol;Acc:HGNC:245])

HSP 1 Score: 71.633 bits (174), Expect = 2.534e-13
Identity = 73/276 (26.45%), Postives = 131/276 (47.46%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNI-VFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + SN +++N+     D   T LK     F  H  + +T  + +C + I+      +S    G++PISQESLLL      ++ +Y+        +  S E+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+ L+      N+ V   ++ K    T+   G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLG-----DVAYYD--------YQGSLEE------QEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGSHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Match: ADD1 (adducin 1 [Source:HGNC Symbol;Acc:HGNC:243])

HSP 1 Score: 57.3806 bits (137), Expect = 1.179e-8
Identity = 68/275 (24.73%), Postives = 122/275 (44.36%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK-HSIAKNFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL   +++  L  W +     I+ + +S  ++F+IV    + S+ + S+ +++NL     D   T L      F +H  +     + +C + I+      +S    GL+PIS E+L L      E+ +++            DE+       K  I+ N    K+  + ++N G +  G ++EEA++    +V AC+ QV+ L+      N+V  + E   A        +    +     S  +W  GE EFEA MR L+   Y TGY ++
Sbjct:  145 LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLG-----EVAYHDYHGILV------DEEE------KVLIQKNLGP-KSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSR-----SPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYR 396          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Match: ADD1 (adducin 1 [Source:HGNC Symbol;Acc:HGNC:243])

HSP 1 Score: 57.3806 bits (137), Expect = 1.211e-8
Identity = 68/275 (24.73%), Postives = 122/275 (44.36%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK-HSIAKNFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL   +++  L  W +     I+ + +S  ++F+IV    + S+ + S+ +++NL     D   T L      F +H  +     + +C + I+      +S    GL+PIS E+L L      E+ +++            DE+       K  I+ N    K+  + ++N G +  G ++EEA++    +V AC+ QV+ L+      N+V  + E   A        +    +     S  +W  GE EFEA MR L+   Y TGY ++
Sbjct:  145 LRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLG-----EVAYHDYHGILV------DEEE------KVLIQKNLGP-KSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSR-----SPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYR 396          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 93.9745 bits (232), Expect = 3.495e-22
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES+++      ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:   41 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMIVG-----DVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 290          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 92.0485 bits (227), Expect = 1.095e-20
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES++     + ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:  358 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMI-----VGDVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 607          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 92.0485 bits (227), Expect = 1.095e-20
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES++     + ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:  358 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMI-----VGDVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 607          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Match: add-2 (Adducin-related protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20952])

HSP 1 Score: 92.0485 bits (227), Expect = 1.095e-20
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES++     + ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:  358 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMI-----VGDVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 607          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Match: add-1 (Adducin-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U9K0])

HSP 1 Score: 68.5514 bits (166), Expect = 8.954e-13
Identity = 69/279 (24.73%), Postives = 124/279 (44.44%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-----------PKIKSDNSPSNFLELNLDNFPTELKSISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKS---HEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            ++KL CL ++  L  W +G    IS + +   N  ++N              +K D    N   L+       +   +FL+H  +       +C L ++   V  ++    GL+P+ +E+++L     H+  +I                D+D  FD ++       A +   N +F++N G LV G TIE A F     V AC+TQV+ +      N++ P E+   AI+    +  +   L  N    + W  GELE+E+ MR L+++++ TG+ ++
Sbjct:  124 RNKLACLFRLADLFQWSQGIHNEISYRTNDEDNTFLMNPFGLLYHEITAATIVKID---ENGKILDCGTLKAGVNQPAFLLHSAIYKAHPMVRCILHMHTAIVAAVASMKCGLLPLCKEAMVLGPVGYHDYQDI---------------GDDDIQFDEII-------ANLGDKNVLFLRNQGFLVVGDTIEHATFLANNTVIACETQVRAARA-GLDNLIIPEEK---AIQRAFRNSRNTNSLKRN--GTVDWRVGELEWESWMRVLDHANFQTGHVYR 371          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Match: hts (gene:FBgn0263391 transcript:FBtr0309105)

HSP 1 Score: 68.9366 bits (167), Expect = 7.691e-13
Identity = 74/297 (24.92%), Postives = 131/297 (44.11%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKI-KSDNSPSNFLELNLDNFPTELKSISF---LIHFLVQNTVNC-----QCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI------------KTILLDGTSNVVLINNQK----------SELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL    ++  L  W +G    I+ +  + + + +VN   +   + + S   ++++     E  + +F     HF++ + V+      +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI            K       +       +K          S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  119 LRCKLAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVL--GEITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLP-VGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVGSPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Match: hts (gene:FBgn0263391 transcript:FBtr0309103)

HSP 1 Score: 68.9366 bits (167), Expect = 7.691e-13
Identity = 74/297 (24.92%), Postives = 131/297 (44.11%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKI-KSDNSPSNFLELNLDNFPTELKSISF---LIHFLVQNTVNC-----QCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI------------KTILLDGTSNVVLINNQK----------SELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL    ++  L  W +G    I+ +  + + + +VN   +   + + S   ++++     E  + +F     HF++ + V+      +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI            K       +       +K          S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  119 LRCKLAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVL--GEITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLP-VGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVGSPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Match: hts (gene:FBgn0263391 transcript:FBtr0309107)

HSP 1 Score: 68.9366 bits (167), Expect = 7.691e-13
Identity = 74/297 (24.92%), Postives = 131/297 (44.11%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKI-KSDNSPSNFLELNLDNFPTELKSISF---LIHFLVQNTVNC-----QCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI------------KTILLDGTSNVVLINNQK----------SELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL    ++  L  W +G    I+ +  + + + +VN   +   + + S   ++++     E  + +F     HF++ + V+      +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI            K       +       +K          S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  119 LRCKLAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVL--GEITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLP-VGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVGSPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Match: hts (gene:FBgn0263391 transcript:FBtr0309102)

HSP 1 Score: 68.5514 bits (166), Expect = 1.417e-12
Identity = 75/300 (25.00%), Postives = 131/300 (43.67%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKI-KSDNSPSNFLELNLDNFPTELKSISF---LIHFLVQNTVNC-----QCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI-------------------------KTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL    ++  L  W +G    I+ +  + + + +VN   +   + + S   ++++     E  + +F     HF++ + V+      +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI                          T   D    V  +    S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  119 LRCKLAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLG--EITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLP-VGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVG---SPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Match: hts (gene:FBgn0263391 transcript:FBtr0309115)

HSP 1 Score: 68.1662 bits (165), Expect = 1.584e-12
Identity = 63/224 (28.12%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  251 FLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI-------------------------KTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            F++H +V     + +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI                          T   D    V  +    S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  195 FVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLG--EITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLL-PVGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVG---SPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 75.0998 bits (183), Expect = 9.685e-15
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L++I  L +W      +I+++ S  ++ I++    +  ++ S SN +++N+     D   T L+  +  F  H  + +   + +C + I+      +S    GL+PISQE+L+L      +I +Y     +    +  +E          ++++  A+    K+ + +N G +  G TIEEA+       YAC+ QV    C       IV   E+ K   + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 QTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVHISTPATAAVSSMKCGLLPISQEALILG-----DIAYYN----YQGSLDEQEE----------RVELQKALGPTAKVLVLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLEKFKARTQGVAQVGV-------NMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 75.0998 bits (183), Expect = 9.685e-15
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L++I  L +W      +I+++ S  ++ I++    +  ++ S SN +++N+     D   T L+  +  F  H  + +   + +C + I+      +S    GL+PISQE+L+L      +I +Y     +    +  +E          ++++  A+    K+ + +N G +  G TIEEA+       YAC+ QV    C       IV   E+ K   + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 QTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVHISTPATAAVSSMKCGLLPISQEALILG-----DIAYYN----YQGSLDEQEE----------RVELQKALGPTAKVLVLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLEKFKARTQGVAQVGV-------NMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 74.7146 bits (182), Expect = 1.265e-14
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L++I  L +W      +I+++ S  ++ I++    +  ++ S SN +++N+     D   T L+  +  F  H  + +   + +C + I+      +S    GL+PISQE+L+L      +I +Y     +    +  +E          ++++  A+    K+ + +N G +  G TIEEA+       YAC+ QV    C       IV   E+ K   + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 QTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVHISTPATAAVSSMKCGLLPISQEALILG-----DIAYYN----YQGSLDEQEE----------RVELQKALGPTAKVLVLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLEKFKARTQGVAQVGV-------NMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 74.7146 bits (182), Expect = 1.351e-14
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L++I  L +W      +I+++ S  ++ I++    +  ++ S SN +++N+     D   T L+  +  F  H  + +   + +C + I+      +S    GL+PISQE+L+L      +I +Y     +    +  +E          ++++  A+    K+ + +N G +  G TIEEA+       YAC+ QV    C       IV   E+ K   + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 QTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVHISTPATAAVSSMKCGLLPISQEALILG-----DIAYYN----YQGSLDEQEE----------RVELQKALGPTAKVLVLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLEKFKARTQGVAQVGV-------NMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 74.7146 bits (182), Expect = 1.351e-14
Identity = 71/278 (25.54%), Postives = 127/278 (45.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L++I  L +W      +I+++ S  ++ I++    +  ++ S SN +++N+     D   T L+  +  F  H  + +   + +C + I+      +S    GL+PISQE+L+L      +I +Y     +    +  +E          ++++  A+    K+ + +N G +  G TIEEA+       YAC+ QV    C       IV   E+ K   + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 QTRCKLASLYRIVDLFSWAHFASCYITVRVSKEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVHISTPATAAVSSMKCGLLPISQEALILG-----DIAYYN----YQGSLDEQEE----------RVELQKALGPTAKVLVLRNHGIVALGETIEEAFHYIYGAQYACEIQVNAFSCAGGMENLIVLDLEKFKARTQGVAQVGV-------NMGSQQKWRLGELEFESLMRMLDNLGYRTGYTYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Match: atr (ATR serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1012722])

HSP 1 Score: 71.2478 bits (173), Expect = 2.822e-13
Identity = 66/275 (24.00%), Postives = 121/275 (44.00%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSI-------SFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  ++++  L  W    + +I+++ +  ++ I++    +  S+ S SN ++LN+     E  S         F  H  +  T  + +CA+ I+      +S    G++PISQE+LLL      ++ +Y     +    +  +E      ++    KV         + ++N G L  G ++EEA+     V  AC+ QV         N  ++   E+ K     +   G   V    N + + +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 RCKLASMYRLADLFGWAHLAKAYITVRVTKEQDHILIMPRGLSFSEASASNLVKLNIIGEVVEQGSTNLQIDPSGFSPHAAIYATRPDVRCAIHIHTPAAAAVSSMKCGILPISQEALLLG-----DVAYYN----YQGSLDEQEERIELQKVLGASAKV---------LVLRNHGVLALGESLEEAFHYIFNVQLACEVQVHALAGAGGVNNLLLLDLEKFKPTTYCVAAAGGGGV----NMEGDHKWKVGELEFESLMRMLDNLGYRTGYAYR 388          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Match: atr (ATR serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1012722])

HSP 1 Score: 70.8626 bits (172), Expect = 3.916e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSI-------SFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  ++++  L  W    + +I+++ +  ++ I++    +  S+ S SN ++LN+     E  S         F  H  +  T  + +CA+ I+      +S    G++PISQE+LLL      ++ +Y     +    +  +E          +I++   +  + K+ + +N G L  G ++EEA+     V  AC+ QV         N  ++   E+ K     +   G   V    N + + +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  133 RCKLASMYRLADLFGWAHLAKAYITVRVTKEQDHILIMPRGLSFSEASASNLVKLNIIGEVVEQGSTNLQIDPSGFSPHAAIYATRPDVRCAIHIHTPAAAAVSSMKCGILPISQEALLLG-----DVAYYN----YQGSLDEQEE----------RIELQKVLGASAKVLVLRNHGVLALGESLEEAFHYIFNVQLACEVQVHALAGAGGVNNLLLLDLEKFKPTTYCVAAAGGGGV----NMEGDHKWKVGELEFESLMRMLDNLGYRTGYAYR 385          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Match: atr (ATR serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1012722])

HSP 1 Score: 70.4774 bits (171), Expect = 4.115e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSI-------SFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  ++++  L  W    + +I+++ +  ++ I++    +  S+ S SN ++LN+     E  S         F  H  +  T  + +CA+ I+      +S    G++PISQE+LLL      ++ +Y     +    +  +E          +I++   +  + K+ + +N G L  G ++EEA+     V  AC+ QV         N  ++   E+ K     +   G   V    N + + +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  137 RCKLASMYRLADLFGWAHLAKAYITVRVTKEQDHILIMPRGLSFSEASASNLVKLNIIGEVVEQGSTNLQIDPSGFSPHAAIYATRPDVRCAIHIHTPAAAAVSSMKCGILPISQEALLLG-----DVAYYN----YQGSLDEQEE----------RIELQKVLGASAKVLVLRNHGVLALGESLEEAFHYIFNVQLACEVQVHALAGAGGVNNLLLLDLEKFKPTTYCVAAAGGGGV----NMEGDHKWKVGELEFESLMRMLDNLGYRTGYAYR 389          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Match: atr (ATR serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1012722])

HSP 1 Score: 70.4774 bits (171), Expect = 4.634e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSI-------SFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  ++++  L  W    + +I+++ +  ++ I++    +  S+ S SN ++LN+     E  S         F  H  +  T  + +CA+ I+      +S    G++PISQE+LLL      ++ +Y     +    +  +E          +I++   +  + K+ + +N G L  G ++EEA+     V  AC+ QV         N  ++   E+ K     +   G   V    N + + +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  136 RCKLASMYRLADLFGWAHLAKAYITVRVTKEQDHILIMPRGLSFSEASASNLVKLNIIGEVVEQGSTNLQIDPSGFSPHAAIYATRPDVRCAIHIHTPAAAAVSSMKCGILPISQEALLLG-----DVAYYN----YQGSLDEQEE----------RIELQKVLGASAKVLVLRNHGVLALGESLEEAFHYIFNVQLACEVQVHALAGAGGVNNLLLLDLEKFKPTTYCVAAAGGGGV----NMEGDHKWKVGELEFESLMRMLDNLGYRTGYAYR 388          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Match: atr (ATR serine/threonine kinase [Source:Xenbase;Acc:XB-GENE-1012722])

HSP 1 Score: 70.4774 bits (171), Expect = 5.045e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSI-------SFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  ++++  L  W    + +I+++ +  ++ I++    +  S+ S SN ++LN+     E  S         F  H  +  T  + +CA+ I+      +S    G++PISQE+LLL      ++ +Y     +    +  +E          +I++   +  + K+ + +N G L  G ++EEA+     V  AC+ QV         N  ++   E+ K     +   G   V    N + + +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  130 RCKLASMYRLADLFGWAHLAKAYITVRVTKEQDHILIMPRGLSFSEASASNLVKLNIIGEVVEQGSTNLQIDPSGFSPHAAIYATRPDVRCAIHIHTPAAAAVSSMKCGILPISQEALLLG-----DVAYYN----YQGSLDEQEE----------RIELQKVLGASAKVLVLRNHGVLALGESLEEAFHYIFNVQLACEVQVHALAGAGGVNNLLLLDLEKFKPTTYCVAAAGGGGV----NMEGDHKWKVGELEFESLMRMLDNLGYRTGYAYR 382          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 71.633 bits (174), Expect = 1.529e-13
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 71.633 bits (174), Expect = 1.529e-13
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 71.633 bits (174), Expect = 1.529e-13
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 71.633 bits (174), Expect = 1.529e-13
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Match: Add3 (adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:1351615])

HSP 1 Score: 71.633 bits (174), Expect = 1.529e-13
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20952|ADD2_CAEEL (Adducin-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=add-2 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.393e-19
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES++     + ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:  358 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMI-----VGDVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 607          
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UEY8|ADDG_HUMAN (Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.217e-12
Identity = 73/276 (26.45%), Postives = 131/276 (47.46%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNI-VFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + SN +++N+     D   T LK     F  H  + +T  + +C + I+      +S    G++PISQESLLL      ++ +Y+        +  S E+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+ L+      N+ V   ++ K    T+   G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLG-----DVAYYD--------YQGSLEE------QEERIQLQKVLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGSHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QYB5|ADDG_MOUSE (Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 1.437e-12
Identity = 69/276 (25.00%), Postives = 129/276 (46.74%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +IS++ S  ++ II+    +  S+ + S  +++N+     D   T+LK     F  H  + +T  + +C + I+      +S    G++PISQESL+L      ++ +Y+          S DE+       + +I++   +  + K+ + +N G +  G T+EEA+     V  AC+ QV+        +  +V   ++ K     + + G   V + ++QK    W  GE+EFE  MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTDLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLILG-----DVAYYDYQG-------SLDEE-------EERIELQKVLGPSCKVLVLRNHGMVALGETLEEAFHYIFNVQMACEIQVQAVAGAGGVDNLLVLDLQKYKAFTHGVAMSGGGGVNMASHQK----WKVGEIEFEGLMRTLDNLGYRTGYAYR 390          
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9U9K0|ADD1_CAEEL (Adducin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=add-1 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 1.470e-11
Identity = 69/279 (24.73%), Postives = 124/279 (44.44%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-----------PKIKSDNSPSNFLELNLDNFPTELKSISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKS---HEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            ++KL CL ++  L  W +G    IS + +   N  ++N              +K D    N   L+       +   +FL+H  +       +C L ++   V  ++    GL+P+ +E+++L     H+  +I                D+D  FD ++       A +   N +F++N G LV G TIE A F     V AC+TQV+ +      N++ P E+   AI+    +  +   L  N    + W  GELE+E+ MR L+++++ TG+ ++
Sbjct:  124 RNKLACLFRLADLFQWSQGIHNEISYRTNDEDNTFLMNPFGLLYHEITAATIVKID---ENGKILDCGTLKAGVNQPAFLLHSAIYKAHPMVRCILHMHTAIVAAVASMKCGLLPLCKEAMVLGPVGYHDYQDI---------------GDDDIQFDEII-------ANLGDKNVLFLRNQGFLVVGDTIEHATFLANNTVIACETQVRAARA-GLDNLIIPEEK---AIQRAFRNSRNTNSLKRN--GTVDWRVGELEWESWMRVLDHANFQTGHVYR 371          
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02645|HTS_DROME (Protein hu-li tai shao OS=Drosophila melanogaster OX=7227 GN=hts PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.903e-11
Identity = 75/298 (25.17%), Postives = 132/298 (44.30%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPK--IKSDNSPSNFLELNLDNFPTELKSISF---LIHFLVQNTVNC-----QCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNK-IFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI------------KTILLDGTSNVVLINNQK----------SELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL    ++  L  W +G    I+ +  + + + +VN P   +  + + S   ++++     E  + +F     HF++ + V+      +CA+ I  + VV IS    GL+P+++++ +L   EI    +  LF+E                  + + ++  ++  N+K I + N G L  G TIEEA+F    +V AC+TQ+KL   +   N+V   EES+ AI            K       +       +K          S  +W  G  EFEA MR L+ + Y TGY ++
Sbjct:  119 LRCKLAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVN-PYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLG--EITTHAYTGLFDE------------------EERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLP-VGLDNLVLIPEESRKAIYEQSRRPPEDLEKKFAAVAAAEDGAATAEKDAAEAVPKVGSPPKWRVGGAEFEALMRMLDNAGYRTGYIYR 394          
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Match: Q1ZXU2 (Aldolase_II domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=add-2 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.318e-18
Identity = 66/269 (24.54%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITG 829
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ S+ S S+ ++++LD    +  S +F       ++H  + N     +C + ++H  VV +S    GL+PISQES+++      ++ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQ++     ++ N+ FP++ +   +  +   G   V   N   + ++W  GELE++A MRQL+   Y+TG
Sbjct:   41 RNKLASLYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQLYSEVSASSLIKVDLDGTVIDGGSTNFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQESMIVG-----DVGYHEYRGILIDEAERA-------LLVR-------DLGDRNVMILRNHGFVVCGESIEHALSLTYHLIIACETQIRTVPGGNTDNVHFPAQSAIKQVYKVASQGGGGVNRQNGHVNSMQWKKGELEWQAYMRQLDAQGYVTG 290          
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Match: A0A1I7TP00 (Aldolase_II domain-containing protein OS=Caenorhabditis tropicalis OX=1561998 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.182e-18
Identity = 68/272 (25.00%), Postives = 136/272 (50.00%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISF-------LIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDF 838
            ++KL  L+++  L  W +G    I+++ S   + I++N   +  ++ S S+ ++++LD    +  S SF       ++H  + N     +C + ++H  VV +S    GL+PISQE+++     + E+ ++E       +   +       LL++        +   N + ++N G +V G +IE A      ++ AC+TQVK     ++ N+ FP++ +   +  +  +G   V   N   +  +W  GELE++A MRQL+   Y+TG+++
Sbjct:  336 RNKLAALYRLVDLFRWSQGIYNHITVRVSTDPDEILINAFGQFYNEVSASSLIKVDLDGTVIDGGSTSFGVNQAGYVLHSAIHNGRPEVKCVVHLHHPSVVAVSAQKCGLLPISQEAMI-----VGEVGYHEYRGILIDEAERA-------LLIR-------DLGDRNVLILRNHGFVVCGESIEHALSLTYHLIIACETQVKAVPGGNTDNVHFPAQSAIKQVYKVASNGGGGVNRQNGHVNSTQWRKGELEWQAYMRQLDAQGYVTGHEY 588          
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Match: A0A2G5TGG3 (Aldolase_II domain-containing protein OS=Caenorhabditis nigoni OX=1611254 GN=Cni-add-2 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.292e-17
Identity = 66/275 (24.00%), Postives = 138/275 (50.18%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISFLIH---FLVQNTVN-----CQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLK 847
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ ++ S S+ ++++LD       S  F ++   +++ + V+      +C + ++H  VV +S    GL+PISQE+++     + E+ ++E       +   +       LL++        +   + + ++N G +V G ++E A      ++ AC+TQVK     ++ N+ FP+  +   +  +  +G   V   N   +  +W  GELE++A MRQL+   Y+TG+D+  K
Sbjct:  374 RNKLAALYRLVDLFRWSQGIYNHITVRVSNDPDEILINAFGQLYNEVSASSLIKVDLDGTVINGGSTDFGVNQAGYVLHSAVHRARPEIKCVVHLHHPSVVAVSAQKCGLLPISQEAMI-----VGEVGYHEYRGILIDEAERA-------LLVR-------DLGDRHVMILRNHGFVVCGESVEHALSVTYHLIIACETQVKTVPGGNTDNVHFPAHSAIKQVYQVACNGGGGVNRQNGHVNSTQWRKGELEWQAYMRQLDAQGYVTGHDYNCK 629          
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Match: A8Y444 (Protein CBR-ADD-2 OS=Caenorhabditis briggsae OX=6238 GN=add-2 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.220e-17
Identity = 65/275 (23.64%), Postives = 138/275 (50.18%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNLDNFPTELKSISFLIH---FLVQNTVN-----CQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLK 847
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ ++ S S+ +++++D       S  F ++   +++ + V+      +C + ++H  VV +S    GL+PISQE+++     + E+ ++E       +   +       LL++        +   + + ++N G +V G ++E A      ++ AC+TQVK     ++ N+ FP+  +   +  +  +G   V   N   +  +W  GELE++A MRQL+   Y+TG+D+  K
Sbjct:  372 RNKLAALYRLVDLFRWSQGIYNHITVRVSNDPDEILINAFGQLYNEVSASSLIKVDMDGTVINGGSTGFGVNQAGYVLHSAVHRARPEIKCVVHLHHPSVVAVSAQKCGLLPISQEAMI-----VGEVGYHEYRGILIDEAERA-------LLVR-------DLGDRHVMILRNHGFVVCGESVEHALSVTYHLIIACETQVKTVPGGNTDNVHFPAHSAIKQVYQVASNGGGGVNRQNGHVNSTQWRKGELEWQAYMRQLDAQGYVTGHDYNCK 627          
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Match: A0A2H2IJW5 (Aldolase_II domain-containing protein OS=Caenorhabditis japonica OX=281687 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.338e-16
Identity = 65/271 (23.99%), Postives = 136/271 (50.18%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN-PKIKSDNSPSNFLELNL-----DNFPTE--LKSISFLIHFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYD 835
            ++KL  L+++  L  W +G    I+++ S   + I++N   ++ ++ + S+ ++++L     D   TE  +    +++H  + +   + +C + ++H  VV +S    GL+PISQE++++      ++ ++E       +   +       LL++        + + N + ++N G +V   ++E A      ++ AC+TQVK      + N+ FPS+ +   +  +   G   V   N Q +  RW  GELE++A MRQL+   Y+TG++
Sbjct:   42 RNKLASLYRLVDLFRWSQGIYNHITVRISPDTDEILINAFGQLYNEVTASSLVKVDLEGNVLDKGSTEFGVNQAGYVLHSAIHSGRPDAKCVIHLHHPSVVAVSAQKCGLLPISQEAMIVG-----DVAYHEYKGILIDEAERA-------LLIR-------DLGERNVMILRNHGFVVCAESVEHALSLTYHLIIACETQVKSVPGGCTDNVHFPSQAAVKQVYMVASHGGGGVNRENGQINSCRWRRGELEWQAYMRQLDAQGYVTGHE 293          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Match: add3a (adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-030131-2721])

HSP 1 Score: 63.1586 bits (152), Expect = 9.379e-11
Identity = 68/278 (24.46%), Postives = 119/278 (42.81%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIA------KNFIIVNNPKIKSDNSPSNFLELNLDNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L+++  L +W      +I+++++            + N   +K      N L   +D   T L+     F  H  + +   + +C + I+      +S    GL+PISQE+L+L   +I           +F    S DE        + ++++  A+  + K+ + +N G +  G TIEEA+        AC+ QV    C       IV   E+ ++  + +   G        N  S+ +W  GELEFE+ MR L+   Y TGY ++
Sbjct:  135 QTRCKLAALYRLVDLFSWAHFSSSYITVRNTFTVQHFHCSTLSLFNTFTVKV-----NILGDVVDQGSTTLRMDPAGFSPHAAIYSMRPDVRCIVHIHTPVTAAVSSMKCGLLPISQEALILG--DIA----------YFNYQGSLDE-------QEERVELQKALGPSAKVLVLRNHGVVALGETIEEAFHYIYTAQLACEIQVNAFSCAGGVENLIVLDLEKYRSRTQGVAQTGV-------NMASQNKWKIGELEFESLMRMLDNLGYRTGYAYR 381          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 62.7734 bits (151), Expect = 1.047e-10
Identity = 70/278 (25.18%), Postives = 131/278 (47.12%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK-HSIAKNFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNIVF--PSE-ESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL   +++  L  W +     ++++ +S  + F+IV    + S+ S S+ +++NL     D   T L      F +H  +     + +C + I+      +S    GL+PIS E+L L      E+ +++            DE+   ++L++  +   + +L      ++N G +  G T+EEA++    +V AC+ QV+ L+      N+V   P++ ++++     + DGTS           L+W  GE EFEA MR L+   Y TGY ++
Sbjct:  134 LRCKLAAFYRLADLFGWSQLIYNHLTVRLNSEQERFLIVPFGLLYSEVSASSLVKINLQGEIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCIVHIHTPAGAAVSAMKCGLLPISPEALSLG-----EVAYHDYHGILV------DEEE--NVLIQKNLGPTSKVL-----ILRNHGLVSVGETVEEAFYYIHNLVRACEIQVRTLASAGGPDNLVMLDPAKYKARSRHPEPVGDGTS-----------LKWQIGEQEFEALMRMLDNLGYRTGYPYR 382          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Match: add3b (gamma-adducin-like [Source:NCBI gene;Acc:103046517])

HSP 1 Score: 62.3882 bits (150), Expect = 1.364e-10
Identity = 65/277 (23.47%), Postives = 121/277 (43.68%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNLDNFPTELKSISFLI-------HFLVQNT-VNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHS-KNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L+++  L  +      +I+++    ++ +++    +  S+ + ++ +++NL     E  S+ F +       H  V +   + +C + I+      IS    G++PIS E+LLL      E+ +       FT     D+        + ++++  A+    K+ + +N G L  G TIEEA+        AC+ QV    C     N+    +ES   +K       S       +  E+RW  GE EFE+ MR ++   Y TGY ++
Sbjct:  168 QNRCKLASLYRLLDLYGYTHCTSGYITVRVCREQDHVLILPRGLSFSEATAASLMKVNLIGHVVEHGSMGFAVDDAAFKLHAAVYSARPDAKCVIHIHTPATAAISSMKCGILPISHEALLLG-----EVSY-------FTYHGDVDDG-------QERVELQKALGPTTKVLVLRNHGLLAFGETIEEAFHYAYHSQQACEIQVCAVLCAGGVDNLCVLDKES---VKV------SPSASGETEDGEVRWRVGEAEFESLMRMMDNLGYRTGYAYR 416          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 62.003 bits (149), Expect = 2.204e-10
Identity = 70/278 (25.18%), Postives = 131/278 (47.12%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK-HSIAKNFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNIVF--PSE-ESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL   +++  L  W +     ++++ +S  + F+IV    + S+ S S+ +++NL     D   T L      F +H  +     + +C + I+      +S    GL+PIS E+L L      E+ +++            DE+   ++L++  +   + +L      ++N G +  G T+EEA++    +V AC+ QV+ L+      N+V   P++ ++++     + DGTS           L+W  GE EFEA MR L+   Y TGY ++
Sbjct:   95 LRCKLAAFYRLADLFGWSQLIYNHLTVRLNSEQERFLIVPFGLLYSEVSASSLVKINLQGEIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCIVHIHTPAGAAVSAMKCGLLPISPEALSLG-----EVAYHDYHGILV------DEEE--NVLIQKNLGPTSKVL-----ILRNHGLVSVGETVEEAFYYIHNLVRACEIQVRTLASAGGPDNLVMLDPAKYKARSRHPEPVGDGTS-----------LKWQIGEQEFEALMRMLDNLGYRTGYPYR 343          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 62.003 bits (149), Expect = 2.279e-10
Identity = 70/278 (25.18%), Postives = 131/278 (47.12%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK-HSIAKNFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVK-LSHCIHSKNIVF--PSE-ESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL   +++  L  W +     ++++ +S  + F+IV    + S+ S S+ +++NL     D   T L      F +H  +     + +C + I+      +S    GL+PIS E+L L      E+ +++            DE+   ++L++  +   + +L      ++N G +  G T+EEA++    +V AC+ QV+ L+      N+V   P++ ++++     + DGTS           L+W  GE EFEA MR L+   Y TGY ++
Sbjct:   95 LRCKLAAFYRLADLFGWSQLIYNHLTVRLNSEQERFLIVPFGLLYSEVSASSLVKINLQGEIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCIVHIHTPAGAAVSAMKCGLLPISPEALSLG-----EVAYHDYHGILV------DEEE--NVLIQKNLGPTSKVL-----ILRNHGLVSVGETVEEAFYYIHNLVRACEIQVRTLASAGGPDNLVMLDPAKYKARSRHPEPVGDGTS-----------LKWQIGEQEFEALMRMLDNLGYRTGYPYR 343          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Sea Lamprey
Match: add1 (adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909-2])

HSP 1 Score: 61.2326 bits (147), Expect = 6.895e-11
Identity = 69/279 (24.73%), Postives = 127/279 (45.52%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAK---NFIIVNNPKIKSDNSPSNFLELNL-----DNFPTELK--SISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKT--ILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            L+ KL  ++++  L  W   + I+  I   + K   +F+I+    + S+ + S+ +++NL     D   T L      F +H  +     + +C + ++      +S    GL+PISQES++L      E+ +++             E  + D   K  ++ N  +   +K+ I +N G +  G T+EEA+     +V AC+ QV+      S + V   +E K  ++T  I+  G  N+  ++       W  GE E EA MR ++   Y TGY ++
Sbjct:  145 LRCKLAAVYRLVDLYGW--SQLIYNHISARVNKEQEHFLIIPFGLLFSEVTASSLVKVNLQGEIVDRGSTNLGINQAGFTLHSAIYAARPDIKCVIHVHTPAGTAVSAMKCGLLPISQESMILG-----EVTYHDY------------EGILVDDEEKANLQKN--LGPTSKVLILRNHGLVALGETVEEAFHYLYNLVMACEVQVRTLASAGSVDNVILLDEEKLRVRTQGIVTHGNVNMAGLHT------WGVGEQELEALMRMMDSMGYRTGYAYR 396          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Nematostella
Match: EDO42734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I1])

HSP 1 Score: 59.6918 bits (143), Expect = 2.848e-10
Identity = 63/263 (23.95%), Postives = 119/263 (45.25%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIK------HSIAKNFIIVNNPKIKSDNSPSNFLELNLDNFPTELK--SISFLIHFLVQNTV-NCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLE 808
            L+ KL  ++++  L  W  G    I+ +      H +   F ++ N    S     +F    +D   T L       ++H  V +   +  C + I+    V ++    G++PI+QE+ +L      EI +++         + +++D+I + L +          K+  + ++N G ++ G TIEEA+    + V +C+ QV+ +      N++  SE+ +   K + + G  N   I + K   +W  GELEFEA MR L+
Sbjct:   88 LRCKLAAVYRLVDLFGWSIGIYGHITARASNDEDHYLLNPFGLLYNEVTASSLVKVDFAGNIVDGGSTNLGVNRAGLVLHSAVHSARKDIACVIHIHQPACVAVASTEYGILPITQEASMLG-----EIAYHDFRGILL---DENEKDAIINELGE----------KSKVMVLRNHGMVIAGDTIEEAFMLAHMCVLSCEYQVR-AMSAGVDNLIKVSEQVRE--KVLEVTGGEN---ITDSKGS-KWKHGELEFEAWMRMLD 325          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Nematostella
Match: EDO42733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0I0])

HSP 1 Score: 49.2914 bits (116), Expect = 8.728e-7
Identity = 44/187 (23.53%), Postives = 88/187 (47.06%), Query Frame = 2
Query:  293 CALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSK--NIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLK 847
            C +++  T+V  +S    G++PIS E+       I EI ++ L +    K     E     L +    KV         + ++N+G +  G+++EEA++   L+  AC+ Q   ++ + +   N++   +E +  I   + +G      +N  K ++     ++ FEA MR L+   + TGY+F ++
Sbjct:  322 CVVVLCSTNVKAVSAMDCGVLPISHEAAA-----IGEIVYHTLGSIVLDKA----EKEALTLKLSAVDKV---------LVLRNMGAVCVGKSVEEAFYNAFLLHKACENQ---AYAVRAGINNLIKLDDEVREKIYKSVQEGDD----VNQNKRKV----ADVHFEAWMRMLDARGHKTGYEFSIQ 479          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Match: add3b (gamma-adducin [Source:NCBI gene;Acc:101170613])

HSP 1 Score: 68.1662 bits (165), Expect = 2.081e-12
Identity = 71/286 (24.83%), Postives = 124/286 (43.36%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTEL--KSISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLD-----------GTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L+++  L NW R    +I+++ S  ++ I+++   +  ++ + +N +++N+     D   TEL      F  H  + +   + +C + I+      +S    G++PISQE+LLL      ++  Y     +    ++ +E   F   +    KV         + + N G L  G T+EEA+        AC+ QV    C            S NA    LLD             + VV+ N    E++W  GE EFE+ +R L+   Y TGY ++
Sbjct:  136 QSRCKLASLYRLVDLFNWARFTSAYITVRVSKEQDHILISPRGLSFAEVTAANLVKVNIVGEVVDQGSTELGIDHFGFAPHAAIYSMRPDVRCIIHIHTPATTAVSSMKCGILPISQEALLLG-----DVSCYG----YHGSLDNKEEMVEFQKALGPTSKV---------MMLSNHGLLALGETVEEAFHYVYHSQLACEIQVHSLRC------------SGNADNLTLLDRQKFKPLTQGVAAAGVVIDN----EVKWKVGEAEFESLLRMLDNLGYRTGYAYR 387          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Match: add3b (gamma-adducin [Source:NCBI gene;Acc:101170613])

HSP 1 Score: 67.781 bits (164), Expect = 2.278e-12
Identity = 70/287 (24.39%), Postives = 123/287 (42.86%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTEL--KSISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIF-IKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLD-----------GTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L+++  L NW R    +I+++ S  ++ I+++   +  ++ + +N +++N+     D   TEL      F  H  + +   + +C + I+      +S    G++PISQE+LLL      ++  Y        K              +  ++   A+   +K+  + N G L  G T+EEA+        AC+ QV    C            S NA    LLD             + VV+ N    E++W  GE EFE+ +R L+   Y TGY ++
Sbjct:  137 QSRCKLASLYRLVDLFNWARFTSAYITVRVSKEQDHILISPRGLSFAEVTAANLVKVNIVGEVVDQGSTELGIDHFGFAPHAAIYSMRPDVRCIIHIHTPATTAVSSMKCGILPISQEALLLG-----DVSCYGYHGSLDNK--------------EEMVEFQKALGPTSKVMMLSNHGLLALGETVEEAFHYVYHSQLACEIQVHSLRC------------SGNADNLTLLDRQKFKPLTQGVAAAGVVIDN----EVKWKVGEAEFESLLRMLDNLGYRTGYAYR 388          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Match: add3b (gamma-adducin [Source:NCBI gene;Acc:101170613])

HSP 1 Score: 67.781 bits (164), Expect = 2.278e-12
Identity = 70/287 (24.39%), Postives = 123/287 (42.86%), Query Frame = 2
Query:   44 QLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTEL--KSISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIF-IKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLD-----------GTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            Q + KL  L+++  L NW R    +I+++ S  ++ I+++   +  ++ + +N +++N+     D   TEL      F  H  + +   + +C + I+      +S    G++PISQE+LLL      ++  Y        K              +  ++   A+   +K+  + N G L  G T+EEA+        AC+ QV    C            S NA    LLD             + VV+ N    E++W  GE EFE+ +R L+   Y TGY ++
Sbjct:  137 QSRCKLASLYRLVDLFNWARFTSAYITVRVSKEQDHILISPRGLSFAEVTAANLVKVNIVGEVVDQGSTELGIDHFGFAPHAAIYSMRPDVRCIIHIHTPATTAVSSMKCGILPISQEALLLG-----DVSCYGYHGSLDNK--------------EEMVEFQKALGPTSKVMMLSNHGLLALGETVEEAFHYVYHSQLACEIQVHSLRC------------SGNADNLTLLDRQKFKPLTQGVAAAGVVIDN----EVKWKVGEAEFESLLRMLDNLGYRTGYAYR 388          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Match: add3a (gamma-adducin [Source:NCBI gene;Acc:101164133])

HSP 1 Score: 66.6254 bits (161), Expect = 6.287e-12
Identity = 70/276 (25.36%), Postives = 123/276 (44.57%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +I+ + S  ++ I++    +  ++ S SN +++N+     D   T L   S  F  H  + +   + +C + ++      +S    G++PISQE+L+L      +I +Y       T   S D+      L K       A+    K+ + +N G +  G T+EEA+       YAC+ QV    C       IV   E+ ++ +  +     ++   IN    + RW  GELEFE+ MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHFANSYITGRVSKEQDHILIIPRGLSFAEASASNLVKVNIIGDVIDQGSTSLSINSSGFSPHAAIYSMRPDIRCIIHVHTPAAAAVSSMKCGILPISQEALILG-----DIAYY-------TYHGSLDDQEERRELQK-------ALGPTAKVLVLRNHGVVALGETMEEAFHYIYNAQYACEIQVNAISCAGGVENLIVLDQEKYRSRVFAV-----ASAAAIN-MAGQYRWKIGELEFESLMRMLDNLGYRTGYTYR 388          
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Match: add3a (gamma-adducin [Source:NCBI gene;Acc:101164133])

HSP 1 Score: 66.2402 bits (160), Expect = 9.311e-12
Identity = 70/276 (25.36%), Postives = 123/276 (44.57%), Query Frame = 2
Query:   50 KSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIK-SDNSPSNFLELNL-----DNFPTELK--SISFLIHFLVQN-TVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKN--IVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFK 841
            + KL  L+++  L  W      +I+ + S  ++ I++    +  ++ S SN +++N+     D   T L   S  F  H  + +   + +C + ++      +S    G++PISQE+L+L      +I +Y       T   S D+      L K       A+    K+ + +N G +  G T+EEA+       YAC+ QV    C       IV   E+ ++ +  +     ++   IN    + RW  GELEFE+ MR L+   Y TGY ++
Sbjct:  138 RCKLASLYRLVDLFGWAHFANSYITGRVSKEQDHILIIPRGLSFAEASASNLVKVNIIGDVIDQGSTSLSINSSGFSPHAAIYSMRPDIRCIIHVHTPAAAAVSSMKCGILPISQEALILG-----DIAYY-------TYHGSLDDQEERRELQK-------ALGPTAKVLVLRNHGVVALGETMEEAFHYIYNAQYACEIQVNAISCAGGVENLIVLDQEKYRSRVFAV-----ASAAAIN-MAGQYRWKIGELEFESLMRMLDNLGYRTGYTYR 388          
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Match: SMESG000044944.1 (SMESG000044944.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 273/279 (97.85%), Postives = 275/279 (98.57%), Query Frame = 2
Query:   23 MSENSINQLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIKSDNSPSNFLELNLDNFPTELKSISFLIHFLVQNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK 859
            M ENSINQLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIKSDN+PSNFL+LNLDNFPTEL SISFLIHFLVQNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYE  NEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK
Sbjct:    1 MPENSINQLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNNPKIKSDNNPSNFLKLNLDNFPTELNSISFLIHFLVQNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYEFVNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK 279          
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Match: SMESG000027670.1 (SMESG000027670.1)

HSP 1 Score: 115.161 bits (287), Expect = 4.126e-32
Identity = 50/105 (47.62%), Postives = 72/105 (68.57%), Query Frame = 2
Query:  545 VGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK 859
            +G  VTG+TIEE WF   +  YAC+TQ+KL  CIHS+N++ P  E++  +      G S+ +++NN    + WL G+LEFEA MR LEY++  +GYDFK+K+IWK
Sbjct:    1 MGAFVTGKTIEETWFNCYIFDYACQTQMKLGKCIHSENVIVPGIEAQKNVLKQFKGGISSTLMLNNPNDNVEWLPGQLEFEALMRDLEYNESSSGYDFKIKSIWK 105          
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Match: SMESG000059133.1 (SMESG000059133.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.750e-12
Identity = 67/275 (24.36%), Postives = 126/275 (45.82%), Query Frame = 2
Query:   47 LKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVN-NPKIKSDNSPSNFLELNLD----NFPTELKSISFLIHFLV-QNTVNCQCALLINHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWLAGELEFEATMRQLEYSDYITGYDFKLKNI 853
            L+ KL  ++++     W  G  +  S++ +   N  + N +  +  + + SN +++NL     N  + +   S+++H  + Q+    +C + +    VV +S    GLI I++E++ L +     +  YE  +       +S      + L   Q  +  A+     I ++N G L  G+T+EEAWF   L V+AC+TQV+L+  + S N+             +L +       I +Q         EL+FE+ MR L+ + + TGY ++   I
Sbjct:  135 LRCKLASVYRLIDFHGWASGMMLHASVRINRESNEFLTNCHGLMNHEITASNLVKVNLKGEVLNAHSRIDLASWVLHSSIHQSDPRFKCVIHVRTPAVVAVSCMRSGLIKINEEAVKLGN-----VPIYEWGS-------ASVNVGPGERLSVEQSTLTEAIGHRKCILVRNQGLLARGKTVEEAWFYAGLAVHACETQVRLASSVGSVNL-------------LLANEEEREPEIEDQTI-------ELQFESLMRTLDAAGHRTGYLYRHAPI 377          
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Match: SMESG000012838.1 (SMESG000012838.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.223e-12
Identity = 61/221 (27.60%), Postives = 112/221 (50.68%), Query Frame = 2
Query:  233 ELKSISFLIHFLVQNTVNCQCALL-INHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI----KTILLDGTSNVVL--INNQKSE----LRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK 859
            E   ++++IH  + +  +   A+L +     + IS    GL+PI +E++LL S  I++             F  S+  SI  ++      + + ++ N+KI I  N G L+ G  IEEAW   M    AC+TQ+KL + +   ++  P +  +  +    ++  L G + + +  ++ + SE     +W  GELEFEA MR ++ + Y TGY ++ +NI++
Sbjct:  201 EANPLAWMIHSAIYSCQHSIRAILELKTPAALAISSLEHGLLPICREAILLGSTVILD---------NLPGF-VSESKSISLIMTDLNNYLTSVIVPNSKILIVPNCGFLICGEHIEEAWHLLMNCQIACETQMKLGN-LTIDDLYIPDKNCQADLFHQWRSTDLGGVTKIEIDSVSYENSEHVPQAQWRIGELEFEALMRHMDNNGYRTGYMYRQENIYQ 410          
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Match: SMESG000012838.1 (SMESG000012838.1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.326e-12
Identity = 61/221 (27.60%), Postives = 112/221 (50.68%), Query Frame = 2
Query:  233 ELKSISFLIHFLVQNTVNCQCALL-INHTDVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDSIFDLLMKYQIKVNAAMLKNNKIFI-KNVGCLVTGRTIEEAWFEGMLVVYACKTQVKLSHCIHSKNIVFPSEESKNAI----KTILLDGTSNVVL--INNQKSE----LRWLAGELEFEATMRQLEYSDYITGYDFKLKNIWK 859
            E   ++++IH  + +  +   A+L +     + IS    GL+PI +E++LL S  I++             F  S+  SI  ++      + + ++ N+KI I  N G L+ G  IEEAW   M    AC+TQ+KL + +   ++  P +  +  +    ++  L G + + +  ++ + SE     +W  GELEFEA MR ++ + Y TGY ++ +NI++
Sbjct:  201 EANPLAWMIHSAIYSCQHSIRAILELKTPAALAISSLEHGLLPICREAILLGSTVILD---------NLPGF-VSESKSISLIMTDLNNYLTSVIVPNSKILIVPNCGFLICGEHIEEAWHLLMNCQIACETQMKLGN-LTIDDLYIPDKNCQADLFHQWRSTDLGGVTKIEIDSVSYENSEHVPQAQWRIGELEFEALMRHMDNNGYRTGYMYRQENIYQ 410          
The following BLAST results are available for this feature:
BLAST of Aldolase_II domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADD31.568e-1326.45adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD31.568e-1326.45adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD32.534e-1326.45adducin 3 [Source:HGNC Symbol;Acc:HGNC:245][more]
ADD11.179e-824.73adducin 1 [Source:HGNC Symbol;Acc:HGNC:243][more]
ADD11.211e-824.73adducin 1 [Source:HGNC Symbol;Acc:HGNC:243][more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add-23.495e-2224.54Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.095e-2024.54Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.095e-2024.54Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-21.095e-2024.54Adducin-related protein 2 [Source:UniProtKB/Swiss... [more]
add-18.954e-1324.73Adducin-related protein 1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hts7.691e-1324.92gene:FBgn0263391 transcript:FBtr0309105[more]
hts7.691e-1324.92gene:FBgn0263391 transcript:FBtr0309103[more]
hts7.691e-1324.92gene:FBgn0263391 transcript:FBtr0309107[more]
hts1.417e-1225.00gene:FBgn0263391 transcript:FBtr0309102[more]
hts1.584e-1228.13gene:FBgn0263391 transcript:FBtr0309115[more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3a9.685e-1525.54adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a9.685e-1525.54adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a1.265e-1425.54adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a1.351e-1425.54adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add3a1.351e-1425.54adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atr2.822e-1324.00ATR serine/threonine kinase [Source:Xenbase;Acc:XB... [more]
atr3.916e-1323.91ATR serine/threonine kinase [Source:Xenbase;Acc:XB... [more]
atr4.115e-1323.91ATR serine/threonine kinase [Source:Xenbase;Acc:XB... [more]
atr4.634e-1323.91ATR serine/threonine kinase [Source:Xenbase;Acc:XB... [more]
atr5.045e-1323.91ATR serine/threonine kinase [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Add31.529e-1325.00adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add31.529e-1325.00adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add31.529e-1325.00adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add31.529e-1325.00adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
Add31.529e-1325.00adducin 3 (gamma) [Source:MGI Symbol;Acc:MGI:13516... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20952|ADD2_CAEEL1.393e-1924.54Adducin-related protein 2 OS=Caenorhabditis elegan... [more]
sp|Q9UEY8|ADDG_HUMAN1.217e-1226.45Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1... [more]
sp|Q9QYB5|ADDG_MOUSE1.437e-1225.00Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=... [more]
sp|Q9U9K0|ADD1_CAEEL1.470e-1124.73Adducin-related protein 1 OS=Caenorhabditis elegan... [more]
sp|Q02645|HTS_DROME1.903e-1125.17Protein hu-li tai shao OS=Drosophila melanogaster ... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1ZXU21.318e-1824.54Aldolase_II domain-containing protein OS=Caenorhab... [more]
A0A1I7TP002.182e-1825.00Aldolase_II domain-containing protein OS=Caenorhab... [more]
A0A2G5TGG34.292e-1724.00Aldolase_II domain-containing protein OS=Caenorhab... [more]
A8Y4445.220e-1723.64Protein CBR-ADD-2 OS=Caenorhabditis briggsae OX=62... [more]
A0A2H2IJW51.338e-1623.99Aldolase_II domain-containing protein OS=Caenorhab... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3a9.379e-1124.46adducin 3 (gamma) a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
add11.047e-1025.18adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
add3b1.364e-1023.47gamma-adducin-like [Source:NCBI gene;Acc:103046517... [more]
add12.204e-1025.18adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
add12.279e-1025.18adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
add16.895e-1124.73adducin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030909... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO427342.848e-1023.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427338.728e-723.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
add3b2.081e-1224.83gamma-adducin [Source:NCBI gene;Acc:101170613][more]
add3b2.278e-1224.39gamma-adducin [Source:NCBI gene;Acc:101170613][more]
add3b2.278e-1224.39gamma-adducin [Source:NCBI gene;Acc:101170613][more]
add3a6.287e-1225.36gamma-adducin [Source:NCBI gene;Acc:101164133][more]
add3a9.311e-1225.36gamma-adducin [Source:NCBI gene;Acc:101164133][more]
back to top
BLAST of Aldolase_II domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044944.10.000e+097.85SMESG000044944.1[more]
SMESG000027670.14.126e-3247.62SMESG000027670.1[more]
SMESG000059133.11.750e-1224.36SMESG000059133.1[more]
SMESG000012838.12.223e-1227.60SMESG000012838.1[more]
SMESG000012838.12.326e-1227.60SMESG000012838.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014826 ID=SMED30014826|Name=Aldolase_II domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=879bp
TTTTATATAAAATTGAATGGTTATGTCTGAAAATTCAATAAATCAATTGA
AATCTAAGTTATGTTGTTTGCATAAAATTGGAAGCCTCGATAATTGGTTT
AGGGGCGAAGAAATTTTCATAAGTATTAAACATTCTATTGCAAAAAATTT
TATAATTGTAAACAACCCAAAAATAAAGTCTGATAACAGTCCTTCTAACT
TTTTGGAATTAAATTTGGATAATTTTCCAACTGAATTAAAATCAATTTCT
TTCTTAATCCATTTTCTCGTACAAAATACAGTTAATTGCCAATGCGCTCT
ATTAATAAATCATACCGATGTCGTTAAGATATCACAAAATGGAATCGGTT
TAATTCCAATCAGTCAAGAATCGTTGCTGTTAAAGAGTCATGAAATTGTT
GAAATTGAATTTTATGAACTTTTCAATGAATTCTTCACAAAATTCAATTC
ATCAGATGAGGATTCTATTTTTGATTTACTTATGAAATATCAAATTAAAG
TTAATGCAGCCATGTTAAAAAATAATAAAATTTTTATAAAAAATGTTGGA
TGCTTAGTGACTGGGAGAACAATTGAGGAGGCATGGTTCGAGGGAATGCT
GGTGGTGTATGCGTGCAAAACCCAGGTAAAACTTTCGCATTGTATTCATT
CGAAAAATATTGTCTTTCCAAGCGAGGAATCCAAAAATGCAATTAAAACA
ATTCTACTTGATGGGACTTCTAATGTAGTGTTGATAAATAATCAGAAATC
GGAACTCAGGTGGTTGGCTGGGGAATTGGAATTCGAGGCCACAATGAGAC
AGCTTGAATATTCGGATTACATAACCGGATACGATTTCAAATTGAAAAAT
ATCTGGAAATAAAAGATTTCTTTTGTGGT
back to top

protein sequence of SMED30014826-orf-1

>SMED30014826-orf-1 ID=SMED30014826-orf-1|Name=SMED30014826-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MVMSENSINQLKSKLCCLHKIGSLDNWFRGEEIFISIKHSIAKNFIIVNN
PKIKSDNSPSNFLELNLDNFPTELKSISFLIHFLVQNTVNCQCALLINHT
DVVKISQNGIGLIPISQESLLLKSHEIVEIEFYELFNEFFTKFNSSDEDS
IFDLLMKYQIKVNAAMLKNNKIFIKNVGCLVTGRTIEEAWFEGMLVVYAC
KTQVKLSHCIHSKNIVFPSEESKNAIKTILLDGTSNVVLINNQKSELRWL
AGELEFEATMRQLEYSDYITGYDFKLKNIWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036409Aldolase_II/adducin_N_sf
IPR001303Aldolase_II/adducin_N
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005811lipid particle
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0016328lateral plasma membrane
GO:0035183female germline ring canal inner rim
GO:0045169fusome
GO:0045170spectrosome
GO:0045172germline ring canal
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007282cystoblast division
GO:0007294germarium-derived oocyte fate determination
GO:0007411axon guidance
GO:0007527adult somatic muscle development
GO:0008302female germline ring canal formation, actin assembly
GO:0030154cell differentiation
GO:0030723ovarian fusome organization
GO:0030724testicular fusome organization
GO:0031987locomotion involved in locomotory behavior
GO:0045214sarcomere organization
GO:0045478fusome organization
GO:0048134germ-line cyst formation
GO:0048135female germ-line cyst formation
GO:0048477oogenesis
GO:0051297centrosome organization
GO:0061572actin filament bundle organization
GO:0070050neuron cellular homeostasis
GO:0072499photoreceptor cell axon guidance
GO:0000212meiotic spindle organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036409Class II aldolase/adducin N-terminal domain superfamilyGENE3DG3DSA:3.40.225.10coord: 4..268
e-value: 1.4E-17
score: 65.6
IPR036409Class II aldolase/adducin N-terminal domain superfamilySUPERFAMILYSSF53639AraD/HMP-PK domain-likecoord: 8..205
IPR001303Class II aldolase/adducin N-terminalPFAMPF00596Aldolase_IIcoord: 34..203
e-value: 1.4E-5
score: 25.1
NoneNo IPR availablePANTHERPTHR10672ADDUCINcoord: 9..274