alpha-1,2-Mannosidase

Overview
Namealpha-1,2-Mannosidase
Smed IDSMED30014825
Length (bp)1884
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of alpha-1,2-Mannosidase (SMED30014825) t-SNE clustered cells

Violin plots show distribution of expression levels for alpha-1,2-Mannosidase (SMED30014825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of alpha-1,2-Mannosidase (SMED30014825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for alpha-1,2-Mannosidase (SMED30014825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30014825SMESG000006448.1 dd_Smed_v4_6801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014825SMESG000006448.1 dd_Smed_v4_6801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: MAN1A2 (mannosidase alpha class 1A member 2 [Source:HGNC Symbol;Acc:HGNC:6822])

HSP 1 Score: 515.768 bits (1327), Expect = 6.108e-176
Identity = 251/508 (49.41%), Postives = 349/508 (68.70%), Query Frame = 3
Query:  309 KTILDLKAVKEEEKMQIIQLEKTLER--LKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTK--NSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLV 1817
            K+  +++A  + EK +++Q  K  E   L  V   N    L  I+GG+P+D   + +R K+K MMK AW+NY  Y WG NELRPI++ GHS +IFG ++MG +I+D+LDTL+IM L+DEF     WI+  L F + +EVSVFE+ IRF+GGLL A+  + +E+F  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  LS +TG+ TY  KV  IR++L K ++P G+Y NY+ P++  W  +H+S+ GLGDSFYEYLLK ++ S+K D  A KMY  AIEA++   +I  S+ G  ++ +++ G ++ KM HLACF GGMFALG+  ++   +  +L +G  I  TCH+SY  T  KLGPESF F  +VEAVA++  EK Y+LRPE  E+Y+YLWR T D +YR W ++A LA+EK+  V  G SG++DVYS   +HDDVQQSF +AETLKYLYL+FS D LLPL+ WVFNTEAHP P+  L 
Sbjct:  128 KSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPN----LVGIRGGDPEDNDIREKREKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGSSQMGATIVDALDTLYIMGLHDEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKIKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLTGDLTYYKKVMHIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEARKMYDDAIEAIEKH-LIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLHLA 630          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: MAN1A1 (mannosidase alpha class 1A member 1 [Source:HGNC Symbol;Acc:HGNC:6821])

HSP 1 Score: 499.975 bits (1286), Expect = 1.324e-169
Identity = 266/599 (44.41%), Postives = 370/599 (61.77%), Query Frame = 3
Query:   93 IIIVFMTLVILSYRKLSYISDINNVIPKI---SNPDIQKYKDR--------ESLWETIAKDREXXXXXXXXXXXX---XXXEINHLKTILDLKAVKE---EEKMQIIQLEKTLERLKNVQGKNGSISLSEI--------QGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            +++VF   + L +  + ++ D + ++  +   S+P +Q   D         E   E  A+ RE+         L+   A+   NH + + + K   +   EE  + I LEK       ++ K     L  +        +  EP D   + +R K+K MMK AWNNY  YAWG NEL+PISK GHS+S+FG N  G +I+D+LDTLFIME+  EF+ A  W++  L F++  E+SVFE+ IRF+GGLL+A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++GN  +  KV  IR +L K  KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D  A KMY  A++A+++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+      +   +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALE H  V  G SG+RDVY +  S+DDVQQSF +AETLKYLYLIFS+D LLPL  W+FN+EAH  PI
Sbjct:   44 LLLVFSAFITLCFGAIFFLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKIKEMMKHAWNNYKGYAWGLNELKPISKGGHSSSLFG-NIKGATIVDALDTLFIMEMKHEFEEAKSWVEENLDFNVNAEISVFEVNIRFVGGLLSAYYLSGEEIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGNPIFAEKVMNIRTVLNKLEKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQAIETH-LIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADAAPEGMAQHYLELGAEIARTCHESYNRTFMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVMETYMYMWRLTHDPKYRKWAWEAVEALENHCRVNGGYSGLRDVYLLHESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNSEAHLLPI 640          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: MAN1C1 (mannosidase alpha class 1C member 1 [Source:HGNC Symbol;Acc:HGNC:19080])

HSP 1 Score: 450.669 bits (1158), Expect = 1.029e-150
Identity = 223/458 (48.69%), Postives = 309/458 (67.47%), Query Frame = 3
Query:  444 EPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCA-ILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNS--LEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            EP+ ++ +A+R K+K MM+FAW +Y +YA G+NELRP++K G+  ++FG    G ++IDSLDTL++MEL +EF+ A  W+      ++  E S+FE+ IR++GGLL+AF  T +EVF  KAI L   LL AF+  +G+P  +++F    S N+ WA  G + IL+E G+LH+EF  L+E++GN+ +  KV  IR++L K  KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K ++ S K D  A  MY  A+EA+++  ++  S  G  Y+A++R GI+ +KM HLACF GGM ALG+   K      +  +   IT TCH+SY  +D+KLGPE+F F+   EAVA Q  E  Y+LRPE  ESY YLWR T +  YR+W ++ VLALEK+     G SGI+DVYS   +HD+ QQSF +AETLKYLYL+FSED LL L  WVFNTEAHP P+
Sbjct:  166 EPQSQV-RAQREKIKEMMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFG-GLSGATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTGIPKGVVSFK---SGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKIEKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEAIETY-LLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDLLSLEDWVFNTEAHPLPV 617          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: MAN1C1 (mannosidase alpha class 1C member 1 [Source:HGNC Symbol;Acc:HGNC:19080])

HSP 1 Score: 436.802 bits (1122), Expect = 9.042e-148
Identity = 217/442 (49.10%), Postives = 297/442 (67.19%), Query Frame = 3
Query:  492 MMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCA-ILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNS--LEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            MM+FAW +Y +YA G+NELRP++K G+  ++FG    G ++IDSLDTL++MEL +EF+ A  W+      ++  E S+FE+ IR++GGLL+AF  T +EVF  KAI L   LL AF+  +G+P  +++F    S N+ WA  G + IL+E G+LH+EF  L+E++GN+ +  KV  IR++L K  KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K ++ S K D  A  MY  A+EA+++  ++  S  G  Y+A++R GI+ +KM HLACF GGM ALG+   K      +  +   IT TCH+SY  +D+KLGPE+F F+   EAVA Q  E  Y+LRPE  ESY YLWR T +  YR+W ++ VLALEK+     G SGI+DVYS   +HD+ QQSF +AETLKYLYL+FSED LL L  WVFNTEAHP P+
Sbjct:    1 MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFG-GLSGATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTGIPKGVVSFK---SGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKIEKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEAIETY-LLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDLLSLEDWVFNTEAHPLPV 437          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Match: MAN1C1 (mannosidase alpha class 1C member 1 [Source:HGNC Symbol;Acc:HGNC:19080])

HSP 1 Score: 381.333 bits (978), Expect = 5.905e-127
Identity = 191/392 (48.72%), Postives = 258/392 (65.82%), Query Frame = 3
Query:  642 MELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCA-ILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNS--LEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            MEL +EF+ A  W+      ++  E S+FE+ IR++GGLL+AF  T +EVF  KAI L   LL AF+  +G+P  +++F    S N+ WA  G + IL+E G+LH+EF  L+E++GN+ +  KV  IR++L K  KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K ++ S K D  A  MY  A+EA+++  ++  S  G  Y+A++R GI+ +KM HLACF GGM ALG+   K      +  +   IT TCH+SY  +D+KLGPE+F F+   EAVA Q  E  Y+LRPE  ESY YLWR T +  YR+W ++ VLALEK+     G SGI+DVYS   +HD+ QQSF +AETLKYLYL+FSED LL L  WVFNTEAHP P+
Sbjct:    1 MELKEEFQEAKAWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTGIPKGVVSFK---SGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKIEKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEAIETY-LLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPIYREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDLLSLEDWVFNTEAHPLPV 388          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: mans-1 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:P90787])

HSP 1 Score: 428.328 bits (1100), Expect = 9.962e-144
Identity = 226/468 (48.29%), Postives = 305/468 (65.17%), Query Frame = 3
Query:  447 PKDEIN-----KARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKT----EVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFH-SSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN---SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            PK EI      + RR+ VK M+KFAW+ Y KYAWGENELRP S+ GHS+SIFG  K G +IID++DTL+++ L +E+K A +WI     FD KT    ++SVFE  IRF GGLL+AF  T D++FL KA ++A  LL AF+  SG+P +LI+     S  Y+WA G  AILSE G++ +EF +LS +TGN  +  K  +IR++L    KP+G+Y  YI   +    G H  S+  + DS+YEYLLK++I + KKD    + Y  AI A++   +  + +    Y A      +++  +HLACF GGM  L ++  KN   S  ++T+G  I +TCH+SY  + + +GPESF F+ SVEA   + Q+  Y+LRPE  E++FYLWR TKD+KYR WA+D V  LE++   T G SGIR+VY      DDVQQSFL AE  KYLYLIFSED +LPL++WVFNTEAHPF IR
Sbjct:   76 PKPEIGASDDAEGRRIFVKQMIKFAWDGYRKYAWGENELRPNSRSGHSSSIFGYGKTGATIIDAIDTLYLVGLKEEYKEARDWIA---DFDFKTSAKGDLSVFETNIRFTGGLLSAFALTGDKMFLKKAEDVATILLPAFETPSGIPNSLIDAQTGRSKTYSWASGK-AILSEYGSIQLEFDYLSNLTGNPVFAQKADKIRDVLTAMEKPEGLYPIYITMDNPPRWGQHLFSMGAMADSWYEYLLKQWIATGKKDDRTKREYEEAIFAMEKRMLFKSEQSNLWYFAKMNGNRMEHSFEHLACFSGGMVVLHAMNEKNKTISDHYMTLGKEIGHTCHESYARSTTGIGPESFQFTSSVEAKTERRQDSYYILRPEVVETWFYLWRATKDEKYRQWAWDHVQNLEEYCKGTAGYSGIRNVYESSPEQDDVQQSFLFAELFKYLYLIFSEDNILPLDQWVFNTEAHPFRIR 539          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: mans-1 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:P90787])

HSP 1 Score: 428.328 bits (1100), Expect = 9.962e-144
Identity = 226/468 (48.29%), Postives = 305/468 (65.17%), Query Frame = 3
Query:  447 PKDEIN-----KARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKT----EVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFH-SSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN---SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            PK EI      + RR+ VK M+KFAW+ Y KYAWGENELRP S+ GHS+SIFG  K G +IID++DTL+++ L +E+K A +WI     FD KT    ++SVFE  IRF GGLL+AF  T D++FL KA ++A  LL AF+  SG+P +LI+     S  Y+WA G  AILSE G++ +EF +LS +TGN  +  K  +IR++L    KP+G+Y  YI   +    G H  S+  + DS+YEYLLK++I + KKD    + Y  AI A++   +  + +    Y A      +++  +HLACF GGM  L ++  KN   S  ++T+G  I +TCH+SY  + + +GPESF F+ SVEA   + Q+  Y+LRPE  E++FYLWR TKD+KYR WA+D V  LE++   T G SGIR+VY      DDVQQSFL AE  KYLYLIFSED +LPL++WVFNTEAHPF IR
Sbjct:   76 PKPEIGASDDAEGRRIFVKQMIKFAWDGYRKYAWGENELRPNSRSGHSSSIFGYGKTGATIIDAIDTLYLVGLKEEYKEARDWIA---DFDFKTSAKGDLSVFETNIRFTGGLLSAFALTGDKMFLKKAEDVATILLPAFETPSGIPNSLIDAQTGRSKTYSWASGK-AILSEYGSIQLEFDYLSNLTGNPVFAQKADKIRDVLTAMEKPEGLYPIYITMDNPPRWGQHLFSMGAMADSWYEYLLKQWIATGKKDDRTKREYEEAIFAMEKRMLFKSEQSNLWYFAKMNGNRMEHSFEHLACFSGGMVVLHAMNEKNKTISDHYMTLGKEIGHTCHESYARSTTGIGPESFQFTSSVEAKTERRQDSYYILRPEVVETWFYLWRATKDEKYRQWAWDHVQNLEEYCKGTAGYSGIRNVYESSPEQDDVQQSFLFAELFKYLYLIFSEDNILPLDQWVFNTEAHPFRIR 539          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: mans-2 (Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 [Source:UniProtKB/Swiss-Prot;Acc:Q18788])

HSP 1 Score: 422.165 bits (1084), Expect = 1.578e-140
Identity = 220/523 (42.07%), Postives = 326/523 (62.33%), Query Frame = 3
Query:  303 HLKTILDLKAVKEEEKMQIIQLEKTLERLK----NVQGKNGSISLSEIQGGEP------------KDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTE-VSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHM-YMADFRRGIVQNKMDHLACFVGGMFALGSI---YTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            H KT+  ++ V  +EK++I++  +   +      + + +   +  + IQ  E             KDE N  RR KVK MM  AW  Y  Y+WG NELRP+SK  +S +IFG ++M  +I+D+ DTLFIM+L D++K A ++I+        T  +SVFE TIRFLGGLL+ +  T++  ++ KA E+   LL AF+  SG+P + ++  +K + NY WA GG +ILSEIG+LH+EF +LS I+    +  KV ++R+ L KA KP G+Y NYI P +  + G H SL  LGDSFYEYL+K Y++SN  D  A  MY    +A++   MI  SK+ ++ Y  +   G  Q+KM HLACFV GMFAL +I     +  L  +T+   +  TCH+SY+ +++ +GPE F+F++  EA + +  E  Y+ RPE  E +FYLWR+T    YRDW +DAV A+EK+  V +G +G+++VY+     +DV QSF +AE LKY YL F++++L+ L++WVFNTEAHP P+
Sbjct:   67 HAKTVGKIERVVSQEKVEILRPARVESKPPGEKTSTEPEETGVGKAPIQTSEGLEKLIGKIHYENKDEENDLRRQKVKEMMIHAWEGYKNYSWGANELRPMSKKPNSQNIFGGSQMPATIVDAADTLFIMDLKDKYKEARDYIENNFSMAKSTSTLSVFETTIRFLGGLLSLYALTQESFYIEKAREVGEALLPAFNTPSGIPKSNLDVASKHASNYGWANGGQSILSEIGSLHLEFLYLSRISNAPIFEKKVKKVRDALEKAEKPNGLYSNYINPDTGKFTGSHMSLGALGDSFYEYLIKSYVQSNYTDTQAKNMYWDVSDAIQKH-MIKVSKQSNLTYTVELNNGQAQHKMGHLACFVPGMFALQAINEDTEEEKLRIMTLAEELAKTCHESYIRSETHIGPEMFYFNERDEATS-KHSENGYIQRPEVIEGWFYLWRLTGKTMYRDWVWDAVQAIEKYCRVDSGFTGLQNVYNPKAGREDVMQSFFLAEFLKYAYLTFADESLISLDKWVFNTEAHPVPV 587          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: mans-2 (Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 [Source:UniProtKB/Swiss-Prot;Acc:Q18788])

HSP 1 Score: 422.165 bits (1084), Expect = 1.578e-140
Identity = 220/523 (42.07%), Postives = 326/523 (62.33%), Query Frame = 3
Query:  303 HLKTILDLKAVKEEEKMQIIQLEKTLERLK----NVQGKNGSISLSEIQGGEP------------KDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTE-VSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHM-YMADFRRGIVQNKMDHLACFVGGMFALGSI---YTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            H KT+  ++ V  +EK++I++  +   +      + + +   +  + IQ  E             KDE N  RR KVK MM  AW  Y  Y+WG NELRP+SK  +S +IFG ++M  +I+D+ DTLFIM+L D++K A ++I+        T  +SVFE TIRFLGGLL+ +  T++  ++ KA E+   LL AF+  SG+P + ++  +K + NY WA GG +ILSEIG+LH+EF +LS I+    +  KV ++R+ L KA KP G+Y NYI P +  + G H SL  LGDSFYEYL+K Y++SN  D  A  MY    +A++   MI  SK+ ++ Y  +   G  Q+KM HLACFV GMFAL +I     +  L  +T+   +  TCH+SY+ +++ +GPE F+F++  EA + +  E  Y+ RPE  E +FYLWR+T    YRDW +DAV A+EK+  V +G +G+++VY+     +DV QSF +AE LKY YL F++++L+ L++WVFNTEAHP P+
Sbjct:   67 HAKTVGKIERVVSQEKVEILRPARVESKPPGEKTSTEPEETGVGKAPIQTSEGLEKLIGKIHYENKDEENDLRRQKVKEMMIHAWEGYKNYSWGANELRPMSKKPNSQNIFGGSQMPATIVDAADTLFIMDLKDKYKEARDYIENNFSMAKSTSTLSVFETTIRFLGGLLSLYALTQESFYIEKAREVGEALLPAFNTPSGIPKSNLDVASKHASNYGWANGGQSILSEIGSLHLEFLYLSRISNAPIFEKKVKKVRDALEKAEKPNGLYSNYINPDTGKFTGSHMSLGALGDSFYEYLIKSYVQSNYTDTQAKNMYWDVSDAIQKH-MIKVSKQSNLTYTVELNNGQAQHKMGHLACFVPGMFALQAINEDTEEEKLRIMTLAEELAKTCHESYIRSETHIGPEMFYFNERDEATS-KHSENGYIQRPEVIEGWFYLWRLTGKTMYRDWVWDAVQAIEKYCRVDSGFTGLQNVYNPKAGREDVMQSFFLAEFLKYAYLTFADESLISLDKWVFNTEAHPVPV 587          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Match: mans-4 (alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:D3YT22])

HSP 1 Score: 265.774 bits (678), Expect = 3.093e-81
Identity = 179/474 (37.76%), Postives = 259/474 (54.64%), Query Frame = 3
Query:  447 PKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDESG--LPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYK--ANKPQGIYMNYIQPKSHTWCGFHSSLAGLG---DSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQ--NKMDHLACFVGGMFALGSIYTKNSL----EWLTIGINITNTCHDSYMYTDSKLGPESFHF-----SDSVEA-VAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMV-TNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDT-LLPLNRWVFNTEAHPFPI 1805
            P +E  KA    +    + AW+ Y KYAWG +ELRP+SK    +  FG   +G++IIDSLDT  IM L +E +   EWI+  L       V+VFE TIR LGGLL+ +  T +E  L KA +L +NL+ AF +S   +P + +N DN  + + N      + L+E  TL +EF  L+ +TG++ Y +      E ++     K  G+   YI  K      F  S   LG   DS+YEYL+K+++++ K        +I +I A+K   +   S+   ++       + Q   KMDHL CF+ G   L  +   N L    E L +  NI N CH  Y    + LGPE  HF     SD  +A   ++  +   LLRPE  E++FYL+R+TKD+KY++W + A  ++EK+A V T G S I +V    +   D  +SF +AETLKYLYL+ ++D  +LPL+RWV NTEAHP PI
Sbjct:   60 PTNERQKA----IVRAFQHAWSGYKKYAWGHDELRPVSKRFDDS--FG---LGLTIIDSLDTAIIMGLEEETRDGVEWIRENLNVSPARSVNVFETTIRVLGGLLSGYHLTGEEALLEKATQLGDNLIKAFTKSSSLIPKSDVNLDNGNACSPN---RDLSSLAEATTLQLEFRDLTALTGDQKYEDVAFGASEHVHNVGCKKMDGLCPFYIDGKGE----FKKSSITLGARADSYYEYLIKQWLQTKKSIDWLRDDFIQSIAAMKKH-LYRQSQPNSIWFLGEITELAQFYPKMDHLVCFLSGSLVLSHL---NGLDHDNEHLEMAKNIGNVCHKMYE-NPTGLGPEIIHFNMEDSSDMTQADTYVKNLDAHSLLRPEAIEAWFYLYRVTKDKKYQEWGWKAFESIEKYAKVETGGYSSIDNVLRKKIKRRDKMESFFLAETLKYLYLLMADDQEILPLDRWVLNTEAHPLPI 512          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: alpha-Man-Ia (gene:FBgn0259170 transcript:FBtr0300515)

HSP 1 Score: 506.523 bits (1303), Expect = 2.886e-172
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: alpha-Man-Ia (gene:FBgn0259170 transcript:FBtr0300514)

HSP 1 Score: 506.523 bits (1303), Expect = 2.886e-172
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: alpha-Man-Ia (gene:FBgn0259170 transcript:FBtr0300513)

HSP 1 Score: 506.523 bits (1303), Expect = 2.886e-172
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: alpha-Man-Ia (gene:FBgn0259170 transcript:FBtr0299632)

HSP 1 Score: 506.523 bits (1303), Expect = 2.886e-172
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Match: alpha-Man-Ia (gene:FBgn0259170 transcript:FBtr0300516)

HSP 1 Score: 506.523 bits (1303), Expect = 2.886e-172
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: man1a2 (mannosidase, alpha, class 1A, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-390])

HSP 1 Score: 503.827 bits (1296), Expect = 1.974e-171
Identity = 244/506 (48.22%), Postives = 338/506 (66.80%), Query Frame = 3
Query:  324 LKAVKEEEKMQIIQLE-KTLERLKNVQGKNGSISLSE-----IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDL 1814
            L+  KEE K +I   + K  E LK   G      +       +  G+P D   K +R K++ MMK AW++Y +Y WG NEL+P++K GHS +IFG ++MG +I+D+LDTL+IM L+DEFK   EWI+  L F +  EVSVFE+ IRF+GGLL A+  +  EVF  KA++LA  LL AF+  +G+P+A++N  +    N+ WA GG +IL+E GTLHMEF  L+ +TGN  Y  KV  IR++L K ++P G+Y NY+ P++  W   H+S+ GLGDSFYEYLLK ++ S+K D  A K Y  AIEA++   +I  S  G  ++ +++ G ++ KM HL CF GGMFALG+  + +  +  +L +G  I +TCH+SY  T  KLGPE+F F   +EAVA++  EK Y+LRPE  E+Y+Y+WR T D KYR W ++A  A++KH  V+ G SG++DVYS   ++DDVQQSF +AETLKYLYL+FS D LLPL  WVFNTEAHP P+  L
Sbjct:  129 LRKSKEELKAEIQTAKAKVSEDLKKKDGPKPLPPVPMPKLVGVNDGDPGDPDTKEKRDKIREMMKHAWDSYRQYGWGHNELKPLAKKGHSTNIFGNSQMGATIVDALDTLYIMGLHDEFKDGQEWIEQNLDFSVNAEVSVFEVNIRFIGGLLAAYYLSGQEVFKLKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASGGSSILAEFGTLHMEFVHLTYLTGNPAYYQKVMHIRKLLAKMDRPNGLYPNYLNPRTGRWGQHHTSVGGLGDSFYEYLLKAWLMSDKTDAEARKTYDDAIEAIERH-LIRKSNGGLTFIGEWKNGHLERKMGHLTCFAGGMFALGADGSPDDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKFDSGLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKHCRVSGGFSGVKDVYSSNPTYDDVQQSFFLAETLKYLYLLFSSDELLPLENWVFNTEAHPLPVLHL 633          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: man1a2 (mannosidase, alpha, class 1A, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-390])

HSP 1 Score: 503.827 bits (1296), Expect = 1.974e-171
Identity = 244/506 (48.22%), Postives = 338/506 (66.80%), Query Frame = 3
Query:  324 LKAVKEEEKMQIIQLE-KTLERLKNVQGKNGSISLSE-----IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDL 1814
            L+  KEE K +I   + K  E LK   G      +       +  G+P D   K +R K++ MMK AW++Y +Y WG NEL+P++K GHS +IFG ++MG +I+D+LDTL+IM L+DEFK   EWI+  L F +  EVSVFE+ IRF+GGLL A+  +  EVF  KA++LA  LL AF+  +G+P+A++N  +    N+ WA GG +IL+E GTLHMEF  L+ +TGN  Y  KV  IR++L K ++P G+Y NY+ P++  W   H+S+ GLGDSFYEYLLK ++ S+K D  A K Y  AIEA++   +I  S  G  ++ +++ G ++ KM HL CF GGMFALG+  + +  +  +L +G  I +TCH+SY  T  KLGPE+F F   +EAVA++  EK Y+LRPE  E+Y+Y+WR T D KYR W ++A  A++KH  V+ G SG++DVYS   ++DDVQQSF +AETLKYLYL+FS D LLPL  WVFNTEAHP P+  L
Sbjct:  129 LRKSKEELKAEIQTAKAKVSEDLKKKDGPKPLPPVPMPKLVGVNDGDPGDPDTKEKRDKIREMMKHAWDSYRQYGWGHNELKPLAKKGHSTNIFGNSQMGATIVDALDTLYIMGLHDEFKDGQEWIEQNLDFSVNAEVSVFEVNIRFIGGLLAAYYLSGQEVFKLKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASGGSSILAEFGTLHMEFVHLTYLTGNPAYYQKVMHIRKLLAKMDRPNGLYPNYLNPRTGRWGQHHTSVGGLGDSFYEYLLKAWLMSDKTDAEARKTYDDAIEAIERH-LIRKSNGGLTFIGEWKNGHLERKMGHLTCFAGGMFALGADGSPDDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKFDSGLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKHCRVSGGFSGVKDVYSSNPTYDDVQQSFFLAETLKYLYLLFSSDELLPLENWVFNTEAHPLPVLHL 633          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: man1a2 (mannosidase, alpha, class 1A, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-390])

HSP 1 Score: 503.827 bits (1296), Expect = 1.974e-171
Identity = 244/506 (48.22%), Postives = 338/506 (66.80%), Query Frame = 3
Query:  324 LKAVKEEEKMQIIQLE-KTLERLKNVQGKNGSISLSE-----IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDL 1814
            L+  KEE K +I   + K  E LK   G      +       +  G+P D   K +R K++ MMK AW++Y +Y WG NEL+P++K GHS +IFG ++MG +I+D+LDTL+IM L+DEFK   EWI+  L F +  EVSVFE+ IRF+GGLL A+  +  EVF  KA++LA  LL AF+  +G+P+A++N  +    N+ WA GG +IL+E GTLHMEF  L+ +TGN  Y  KV  IR++L K ++P G+Y NY+ P++  W   H+S+ GLGDSFYEYLLK ++ S+K D  A K Y  AIEA++   +I  S  G  ++ +++ G ++ KM HL CF GGMFALG+  + +  +  +L +G  I +TCH+SY  T  KLGPE+F F   +EAVA++  EK Y+LRPE  E+Y+Y+WR T D KYR W ++A  A++KH  V+ G SG++DVYS   ++DDVQQSF +AETLKYLYL+FS D LLPL  WVFNTEAHP P+  L
Sbjct:  129 LRKSKEELKAEIQTAKAKVSEDLKKKDGPKPLPPVPMPKLVGVNDGDPGDPDTKEKRDKIREMMKHAWDSYRQYGWGHNELKPLAKKGHSTNIFGNSQMGATIVDALDTLYIMGLHDEFKDGQEWIEQNLDFSVNAEVSVFEVNIRFIGGLLAAYYLSGQEVFKLKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASGGSSILAEFGTLHMEFVHLTYLTGNPAYYQKVMHIRKLLAKMDRPNGLYPNYLNPRTGRWGQHHTSVGGLGDSFYEYLLKAWLMSDKTDAEARKTYDDAIEAIERH-LIRKSNGGLTFIGEWKNGHLERKMGHLTCFAGGMFALGADGSPDDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKFDSGLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKHCRVSGGFSGVKDVYSSNPTYDDVQQSFFLAETLKYLYLLFSSDELLPLENWVFNTEAHPLPVLHL 633          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: man1a1 (mannosidase, alpha, class 1A, member 1 [Source:ZFIN;Acc:ZDB-GENE-041014-321])

HSP 1 Score: 498.049 bits (1281), Expect = 1.425e-169
Identity = 234/459 (50.98%), Postives = 321/459 (69.93%), Query Frame = 3
Query:  438 GGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            G EP D   KA+R K+K MM+FAW+NY  YAWG NELRP+SK GHS+++FG  K G +I+D+LDTL+IME+ DEF+ A EW++  L F++  E+SVFE+ IRF+GGLL+A+  +  EVF  KA+EL   LL AF   +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G   +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D+   K+Y  A++A++ + +I  S  G  Y+A+++ G++++KM HL CF GGM ALG+     + +   + +   I  TCH+SY+ T+ KLGPE+F F   VEA+A +  EK ++LRPE  E+Y Y+WR T D KYR W ++AV ALEKH  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D  LP + WVFNTEAHP P+
Sbjct:  149 GHEPADPDIKAKRAKIKEMMQFAWDNYKHYAWGSNELRPVSKQGHSSNLFGSLK-GATIVDALDTLYIMEMYDEFEAATEWVEKNLDFNMNAEISVFEVNIRFVGGLLSAYYLSGKEVFRKKAVELGEKLLPAFKTPTGVPWALLNLKSGVGRNWPWASGGSSILAEYGTLHLEFMHLSALSGRPVFAEKVMNIRKVLTRLDKPQGLYPNYLNPNSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKIDEEGKKLYYDALQAIEKN-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMIALGADGAPDEKTGHQMELAAEIARTCHESYVRTNLKLGPEAFRFDGGVEAIATRQNEKYFILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKHCRVEGGYSGVRDVYSNNPNHDDVQQSFYLAETLKYLYLLFSDDDHLPFDHWVFNTEAHPLPV 605          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Match: MAN1C1 (si:ch73-373m9.1 [Source:ZFIN;Acc:ZDB-GENE-110411-115])

HSP 1 Score: 400.593 bits (1028), Expect = 1.578e-134
Identity = 191/391 (48.85%), Postives = 265/391 (67.77%), Query Frame = 3
Query:  642 MELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            M L +E++ A EW+++ L  +   E S+FE+ IR++GGLL+AF  T  E+F  K +EL   LL AF+  +G+P  +IN  +  S ++ WA  G +IL+E GTLH+EF  LSE++GN  +  KV  IR++L K  KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K ++ S+K D+ A KMY +A+EA++ + ++  S  G  Y+A++R GI+ +KM HLACF GGM  +G+          +L +   IT+TCH+SY  + +KLGPE+F F    EA A +  ++ Y+LRPE  ESY Y+WR+T D KYR+W ++AV ALEKH  V  G SGIRDVY+   SHD++QQSF ++ETLKYLYL+FSED LLPL  WVFNTEAHP PI
Sbjct:    1 MGLMEEYEEAKEWVQSNLDLNSNGEASLFEVNIRYVGGLLSAFYLTGAEIFKQKVLELGEKLLPAFNTPTGIPRGVINLGSGTSWSWGWASAGSSILAEFGTLHLEFVHLSELSGNPVFTEKVMNIRKLLDKIEKPHGLYPNFLSPVSGNWVQHHVSIGGLGDSFYEYLIKSFLMSDKTDEEAKKMYYSAMEAIEMN-LVQKSPGGLTYVAEWRGGILDHKMGHLACFCGGMIGIGAEDAPAGQKQHYLDLAGQITHTCHESYSRSATKLGPEAFRFDGGAEATATRLSDRYYILRPEVVESYMYMWRLTHDPKYREWGWEAVEALEKHCRVDAGFSGIRDVYASSDSHDNMQQSFFLSETLKYLYLLFSEDDLLPLEDWVFNTEAHPLPI 390          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: psmb2 (proteasome subunit beta 2 [Source:Xenbase;Acc:XB-GENE-946101])

HSP 1 Score: 501.516 bits (1290), Expect = 5.214e-171
Identity = 236/461 (51.19%), Postives = 324/461 (70.28%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            + G EP D   K +R  +K MMKF+W+NY +YAWG NEL+PI K GHS+++FG N  G +I+D+LDTL+IM + DEFK A EW++  L+F++  EVSVFE+ IRF+GGLL+A+  + +EVF  KA+EL   LL AF+  +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  L++++GN  +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDS+YEYLLK ++ S+K D+ A KMY  +++AV++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR T D KYR W ++AV ALEK+  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D LLPL  W+FNTEAHP PI
Sbjct:  134 VVGKEPSDPAVKQKRDTIKEMMKFSWDNYKRYAWGMNELKPIQKQGHSSNLFG-NIQGATIVDALDTLYIMGMMDEFKDAKEWVEKNLEFNVNAEVSVFEVNIRFVGGLLSAYYISGEEVFRRKAVELGEKLLPAFNTPTGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFMHLTQVSGNPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSYYEYLLKAWLMSDKTDEEAKKMYYESVQAVETH-LIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEDKTGHHIELAAEIARTCHESYDRTTMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKYCRVEGGYSGVRDVYSAHPNHDDVQQSFYLAETLKYLYLLFSDDDLLPLEHWIFNTEAHPLPI 592          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: psmb2 (proteasome subunit beta 2 [Source:Xenbase;Acc:XB-GENE-946101])

HSP 1 Score: 502.286 bits (1292), Expect = 5.370e-171
Identity = 236/461 (51.19%), Postives = 324/461 (70.28%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            + G EP D   K +R  +K MMKF+W+NY +YAWG NEL+PI K GHS+++FG N  G +I+D+LDTL+IM + DEFK A EW++  L+F++  EVSVFE+ IRF+GGLL+A+  + +EVF  KA+EL   LL AF+  +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  L++++GN  +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDS+YEYLLK ++ S+K D+ A KMY  +++AV++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR T D KYR W ++AV ALEK+  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D LLPL  W+FNTEAHP PI
Sbjct:  156 VVGKEPSDPAVKQKRDTIKEMMKFSWDNYKRYAWGMNELKPIQKQGHSSNLFG-NIQGATIVDALDTLYIMGMMDEFKDAKEWVEKNLEFNVNAEVSVFEVNIRFVGGLLSAYYISGEEVFRRKAVELGEKLLPAFNTPTGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFMHLTQVSGNPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSYYEYLLKAWLMSDKTDEEAKKMYYESVQAVETH-LIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEDKTGHHIELAAEIARTCHESYDRTTMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKYCRVEGGYSGVRDVYSAHPNHDDVQQSFYLAETLKYLYLLFSDDDLLPLEHWIFNTEAHPLPI 614          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: psmb2 (proteasome subunit beta 2 [Source:Xenbase;Acc:XB-GENE-946101])

HSP 1 Score: 502.286 bits (1292), Expect = 7.584e-171
Identity = 236/461 (51.19%), Postives = 324/461 (70.28%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            + G EP D   K +R  +K MMKF+W+NY +YAWG NEL+PI K GHS+++FG N  G +I+D+LDTL+IM + DEFK A EW++  L+F++  EVSVFE+ IRF+GGLL+A+  + +EVF  KA+EL   LL AF+  +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  L++++GN  +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDS+YEYLLK ++ S+K D+ A KMY  +++AV++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR T D KYR W ++AV ALEK+  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D LLPL  W+FNTEAHP PI
Sbjct:  161 VVGKEPSDPAVKQKRDTIKEMMKFSWDNYKRYAWGMNELKPIQKQGHSSNLFG-NIQGATIVDALDTLYIMGMMDEFKDAKEWVEKNLEFNVNAEVSVFEVNIRFVGGLLSAYYISGEEVFRRKAVELGEKLLPAFNTPTGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFMHLTQVSGNPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSYYEYLLKAWLMSDKTDEEAKKMYYESVQAVETH-LIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEDKTGHHIELAAEIARTCHESYDRTTMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKYCRVEGGYSGVRDVYSAHPNHDDVQQSFYLAETLKYLYLLFSDDDLLPLEHWIFNTEAHPLPI 619          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: psmb2 (proteasome subunit beta 2 [Source:Xenbase;Acc:XB-GENE-946101])

HSP 1 Score: 502.286 bits (1292), Expect = 1.350e-170
Identity = 236/461 (51.19%), Postives = 324/461 (70.28%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            + G EP D   K +R  +K MMKF+W+NY +YAWG NEL+PI K GHS+++FG N  G +I+D+LDTL+IM + DEFK A EW++  L+F++  EVSVFE+ IRF+GGLL+A+  + +EVF  KA+EL   LL AF+  +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  L++++GN  +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDS+YEYLLK ++ S+K D+ A KMY  +++AV++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR T D KYR W ++AV ALEK+  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D LLPL  W+FNTEAHP PI
Sbjct:  172 VVGKEPSDPAVKQKRDTIKEMMKFSWDNYKRYAWGMNELKPIQKQGHSSNLFG-NIQGATIVDALDTLYIMGMMDEFKDAKEWVEKNLEFNVNAEVSVFEVNIRFVGGLLSAYYISGEEVFRRKAVELGEKLLPAFNTPTGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFMHLTQVSGNPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSYYEYLLKAWLMSDKTDEEAKKMYYESVQAVETH-LIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEDKTGHHIELAAEIARTCHESYDRTTMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKYCRVEGGYSGVRDVYSAHPNHDDVQQSFYLAETLKYLYLLFSDDDLLPLEHWIFNTEAHPLPI 630          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Match: psmb2 (proteasome subunit beta 2 [Source:Xenbase;Acc:XB-GENE-946101])

HSP 1 Score: 496.508 bits (1277), Expect = 6.488e-169
Identity = 235/461 (50.98%), Postives = 320/461 (69.41%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            + G EP D   K +R  +K MMKF+W+NY +YAWG NEL+PI K GHS+++FG N  G +I+D+LDTL+IM + DEFK A EW++  L+F++  EVSVFE+ IRF+GGLL+A+  + +EVF  KA+EL   LL AF+  +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  L++++GN  +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDS+YEYLLK ++ S+K D+ A KMY    E+   + +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR T D KYR W ++AV ALEK+  V  G SG+RDVYS   +HDDVQQSF +AETLKYLYL+FS+D LLPL  W+FNTEAHP PI
Sbjct:  139 VVGKEPSDPAVKQKRDTIKEMMKFSWDNYKRYAWGMNELKPIQKQGHSSNLFG-NIQGATIVDALDTLYIMGMMDEFKDAKEWVEKNLEFNVNAEVSVFEVNIRFVGGLLSAYYISGEEVFRRKAVELGEKLLPAFNTPTGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFMHLTQVSGNPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSYYEYLLKAWLMSDKTDEEAKKMYY---ESAVETHLIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEDKTGHHIELAAEIARTCHESYDRTTMKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRFTHDPKYRQWGWEAVQALEKYCRVEGGYSGVRDVYSAHPNHDDVQQSFYLAETLKYLYLLFSDDDLLPLEHWIFNTEAHPLPI 595          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Man1a2 (mannosidase, alpha, class 1A, member 2 [Source:MGI Symbol;Acc:MGI:104676])

HSP 1 Score: 514.227 bits (1323), Expect = 1.680e-175
Identity = 247/506 (48.81%), Postives = 345/506 (68.18%), Query Frame = 3
Query:  309 KTILDLKAVKEEEKMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLV 1817
            K+  +++A  + EK ++ Q  KT E    V           + GG+P+D   K +R K+K MMK AW+NY  Y WG NELRPI++ GHS +IFG ++MG +I+D+LDTL+IM L+DEF     WI+  L F + +EVSVFE+ IRF+GGLL A+  + +E+F  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  LS +TG+ TY NKV  IR++L K  +P G+Y NY+ P++  W  +H+S+ GLGDSFYEYLLK ++ S+K D  A +MY  A+EA++   +I  S+ G +++ +++ G ++ KM HLACF GGMFALG+  ++   +  +L +G  I  TCH+SY  T  KLGPESF F  +VEAVA++  EK Y+LRPE  E+Y+YLWR T D +YR W ++A LA+EK   V+ G SG++DVY+    HDDVQQSF +AETLKYLYL+FS D LLPL+ WVFNTEAHP P+  L 
Sbjct:  128 KSREEIRAEIQTEKNKVAQAMKTKE--TRVLPPVPVPQRVGVSGGDPEDMEIKKKRDKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSTNIFGSSQMGATIVDALDTLYIMGLHDEFMDGQRWIEENLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKTKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLSYLTGDLTYYNKVMHIRKLLQKMERPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEARRMYDDAVEAIEKH-LIKKSRGGLVFIGEWKNGHLERKMGHLACFAGGMFALGADGSRKDKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKSCRVSGGFSGVKDVYAPTPVHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLRLA 630          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Man1a (mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:104677])

HSP 1 Score: 503.056 bits (1294), Expect = 4.823e-171
Identity = 242/461 (52.49%), Postives = 321/461 (69.63%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            ++  EP D   + +R K+K MM  AWNNY +YAWG NEL+PISK GHS+S+FG N  G +I+D+LDTLFIM +  EF+ A  WIK  L F++  EVSVFE+ IRF+GGLL+A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G+  +  KV +IR +L K +KP+G+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D  A KMY  A++A+++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +  +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALE H  V  G SG+RDVY    S+DDVQQSF +AETLKYLYLIFS+D LLPL  W+FNTEAHPFPI
Sbjct:  184 VENREPADATIREKRAKIKEMMTHAWNNYKRYAWGLNELKPISKEGHSSSLFG-NIKGATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGEEIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGDPVFAEKVMKIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQAIETH-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPI 642          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Man1a (mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:104677])

HSP 1 Score: 503.056 bits (1294), Expect = 4.823e-171
Identity = 242/461 (52.49%), Postives = 321/461 (69.63%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            ++  EP D   + +R K+K MM  AWNNY +YAWG NEL+PISK GHS+S+FG N  G +I+D+LDTLFIM +  EF+ A  WIK  L F++  EVSVFE+ IRF+GGLL+A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G+  +  KV +IR +L K +KP+G+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D  A KMY  A++A+++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +  +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALE H  V  G SG+RDVY    S+DDVQQSF +AETLKYLYLIFS+D LLPL  W+FNTEAHPFPI
Sbjct:  184 VENREPADATIREKRAKIKEMMTHAWNNYKRYAWGLNELKPISKEGHSSSLFG-NIKGATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGEEIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGDPVFAEKVMKIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQAIETH-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPI 642          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Man1a (mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:104677])

HSP 1 Score: 503.827 bits (1296), Expect = 4.190e-170
Identity = 271/611 (44.35%), Postives = 377/611 (61.70%), Query Frame = 3
Query:   57 FRYLKNFSILISIIIVFMTLVILSYRKLSYISDINNVIPKI---SNPDIQKYKDR--------ESLWETIAKDREXXXXXXXXXXXX---XXXEINHLKTILDLKAVKE---EEKMQIIQLEKTLERLKNVQGKNGSISLSEI--------QGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAF-DESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            FR  + F +L+    VF   + L +  + ++ D + ++  +   SNP +Q   +         E   E   + RE+         L+   A+   NH + + + K   +   EE  + I LEK       ++ K+    L ++        +  EP D   + +R K+K MM  AWNNY +YAWG NEL+PISK GHS+S+FG N  G +I+D+LDTLFIM +  EF+ A  WIK  L F++  EVSVFE+ IRF+GGLL+A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G+  +  KV +IR +L K +KP+G+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D  A KMY  A++A+++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +  +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALE H  V  G SG+RDVY    S+DDVQQSF +AETLKYLYLIFS+D LLPL  W+FNTEAHPFPI
Sbjct:  129 FRLTEKFVLLL----VFSAFITLCFGAIFFLPDSSKLLSGVLFHSNPALQPPAEHKPGLGARAEDAAEGRVRHREEGAPGDPGAGLEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKEKVAQDQLRDKDLFRGLPKVDFLPPVGVENREPADATIREKRAKIKEMMTHAWNNYKRYAWGLNELKPISKEGHSSSLFG-NIKGATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGEEIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGDPVFAEKVMKIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQAIETH-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPI 733          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Match: Man1c1 (mannosidase, alpha, class 1C, member 1 [Source:MGI Symbol;Acc:MGI:2446214])

HSP 1 Score: 451.825 bits (1161), Expect = 1.906e-151
Identity = 222/451 (49.22%), Postives = 305/451 (67.63%), Query Frame = 3
Query:  465 KARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCA-ILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLE--WLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            +A+R K+K MM+F+W NY +YA G+NELRP++K G   S+FG    G +IIDSLDTL++MEL +EF+ A  W++     ++  E S+FE+ IR++GGLL+AF  T +EVF  KAI+L   LL AF+  +G+P  ++NF    S ++ WA  G + IL+E G+LH+EF  L+E++GN  +  KV  IR++L + +KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K ++ S K D  A  MY  A+EA+++  ++  S  G  Y+A++R GI+ +KM HLACF GGM ALG+   K      +  +   IT TCH+SY  +D+KLGPE+F F+   EAVA Q  E  Y+LRPE  ESY YLWR T D  YR+W ++ V+ALEKH     G SGI+DVYS   +HD+ QQSF +AETLKYLYL+FSED +L L  WVFNTEAHP P+
Sbjct:  167 RAQREKIKEMMRFSWQNYRRYAMGKNELRPLTKDGFEGSMFG-GLSGATIIDSLDTLYLMELKEEFQEAKAWVQDSFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRVKAIKLGEKLLPAFNTPTGIPKGVVNFK---SGSWGWATAGSSSILAEFGSLHLEFLHLTELSGNPVFAEKVKHIRKVLREIDKPFGLYPNFLSPTSGNWVQHHVSVGGLGDSFYEYLIKSWLMSAKTDMEAKNMYYEALEAIETY-LVNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGADDAKEDKRAYYRELAAQITRTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHDPIYREWGWEVVMALEKHCRTEAGFSGIQDVYSSNPNHDNRQQSFFLAETLKYLYLLFSEDNVLSLEDWVFNTEAHPLPV 612          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|O60476|MA1A2_HUMAN (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1)

HSP 1 Score: 515.768 bits (1327), Expect = 2.933e-175
Identity = 251/508 (49.41%), Postives = 349/508 (68.70%), Query Frame = 3
Query:  309 KTILDLKAVKEEEKMQIIQLEKTLER--LKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTK--NSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLV 1817
            K+  +++A  + EK +++Q  K  E   L  V   N    L  I+GG+P+D   + +R K+K MMK AW+NY  Y WG NELRPI++ GHS +IFG ++MG +I+D+LDTL+IM L+DEF     WI+  L F + +EVSVFE+ IRF+GGLL A+  + +E+F  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  LS +TG+ TY  KV  IR++L K ++P G+Y NY+ P++  W  +H+S+ GLGDSFYEYLLK ++ S+K D  A KMY  AIEA++   +I  S+ G  ++ +++ G ++ KM HLACF GGMFALG+  ++   +  +L +G  I  TCH+SY  T  KLGPESF F  +VEAVA++  EK Y+LRPE  E+Y+YLWR T D +YR W ++A LA+EK+  V  G SG++DVYS   +HDDVQQSF +AETLKYLYL+FS D LLPL+ WVFNTEAHP P+  L 
Sbjct:  128 KSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPN----LVGIRGGDPEDNDIREKREKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGSSQMGATIVDALDTLYIMGLHDEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKIKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLTGDLTYYKKVMHIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEARKMYDDAIEAIEKH-LIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLHLA 630          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|P39098|MA1A2_MOUSE (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 1.175e-174
Identity = 247/506 (48.81%), Postives = 345/506 (68.18%), Query Frame = 3
Query:  309 KTILDLKAVKEEEKMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLV 1817
            K+  +++A  + EK ++ Q  KT E    V           + GG+P+D   K +R K+K MMK AW+NY  Y WG NELRPI++ GHS +IFG ++MG +I+D+LDTL+IM L+DEF     WI+  L F + +EVSVFE+ IRF+GGLL A+  + +E+F  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  LS +TG+ TY NKV  IR++L K  +P G+Y NY+ P++  W  +H+S+ GLGDSFYEYLLK ++ S+K D  A +MY  A+EA++   +I  S+ G +++ +++ G ++ KM HLACF GGMFALG+  ++   +  +L +G  I  TCH+SY  T  KLGPESF F  +VEAVA++  EK Y+LRPE  E+Y+YLWR T D +YR W ++A LA+EK   V+ G SG++DVY+    HDDVQQSF +AETLKYLYL+FS D LLPL+ WVFNTEAHP P+  L 
Sbjct:  128 KSREEIRAEIQTEKNKVAQAMKTKE--TRVLPPVPVPQRVGVSGGDPEDMEIKKKRDKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSTNIFGSSQMGATIVDALDTLYIMGLHDEFMDGQRWIEENLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKTKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLSYLTGDLTYYNKVMHIRKLLQKMERPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEARRMYDDAVEAIEKH-LIKKSRGGLVFIGEWKNGHLERKMGHLACFAGGMFALGADGSRKDKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALAIEKSCRVSGGFSGVKDVYAPTPVHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLRLA 630          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|O02773|MA1A1_PIG (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa OX=9823 GN=MAN1A1 PE=1 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 1.393e-171
Identity = 269/610 (44.10%), Postives = 382/610 (62.62%), Query Frame = 3
Query:   57 FRYLKNFSILISIIIVFMTLVILSYRKLSYISDINNVIPKI---SNPDIQKYKDRE----SLWETIAKDREXXXXXXXXXXXXXXXEIN-------HLKTILDLKAVKE---EEKMQIIQLEK---TLERLKNVQG-KNGSISLSEIQGG---EPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAF-DESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            FR  + F +L+    VF   + L +  + ++ D + ++  +   S+P +Q   D +    +  E  A  R +           A  E N       H + +++ K   +   EE  + I +EK     +++ N  G +   + L  + G    EP D   + +R K+K MMK AWNNY  YAWG+NEL+P+SK GHS+S+FG N  G +I+D+LDTLFIM++ +EF+ A  W++  L F++  EVSVFE+ IRF+GGL++A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++GN  +  KV  IR++L    KPQG+Y NY+ P S  W  +H S+ GLGDSFYEYLLK ++ S+K D  A KMY  AI+A+++  +I  S+ G  Y+A+++ G++++KM HL CF GGMFALG+    + L   +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALEKH  V  G SG+RDVY    ++DDVQQSF +AETLKYLYLIFS+D LLPL  W+FNTEAHP P+
Sbjct:   43 FRLTEKFVLLL----VFSAFITLCFGAIFFLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAADGRARPGEEGAPGDPAAALEDNLARIRENHERALMEAKETLQKLPEEIQRDILMEKEKVAQDQMSNRMGFRLPPVYLVPLIGAIDREPADAAVREKRAKIKEMMKHAWNNYKLYAWGKNELKPVSKGGHSSSLFG-NIKGATIVDALDTLFIMKMKNEFEEAKAWVEEHLNFNVNAEVSVFEVNIRFIGGLISAYYLSGEEIFRKKAVELGVKLLPAFYTPSGIPWALLNIKSGIGRNWPWASGGSSILAEFGTLHLEFIHLSYLSGNPFFAEKVMNIRKVLNNLEKPQGLYPNYLNPNSGQWGQYHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAIKAIETH-LIRKSRNGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADDAPDGLTQHYLQLGAEIARTCHESYSRTFVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVVETYLYMWRLTHDPKYRKWAWEAVEALEKHCRVNGGYSGLRDVYVSAQTYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPLPV 646          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|P53624|MA1A1_DROME (Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2)

HSP 1 Score: 506.523 bits (1303), Expect = 2.893e-171
Identity = 239/456 (52.41%), Postives = 326/456 (71.49%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-LKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSL--EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            D   + RR KVK MM+ AW+NY  YAWG+NELRP+S+  HSASIFG   +G +I+D LDTL+IM L  E++   +WI+ K   D +  E+SVFE  IRF+GG+LT + FT D ++  KA  +A+ LL AF   +G+PYAL+N     + NY WA GG +ILSE GTLH+EFA+LS+ITGN  Y  +V  IR++L +  KP+G+Y N++ PK+  W   H SL  LGDS+YEYLLK +++S + D+ A +M+  A+ A+    M+ TS  G  Y++D +   +++KMDHLACF GG+FALG+   +N    +++ +G  ITNTCH+SY+   ++LGPE+F FS++VEA A++ QEK Y+LRPETFESYF LWR+T DQKYRDW ++AVLALEKH    +G  G+R+VY      DDVQQSF +AETLKYLYL+FS+D++LPL+ WVFNTEAHP PI+
Sbjct:  194 DATLEERRQKVKEMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYREGRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFTGDPLYKEKAQHVADKLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQTIRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKAWLQSGQTDEEAREMFDEAMLAILDK-MVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQNDYTDKYMEVGKGITNTCHESYIRAPTQLGPEAFRFSEAVEARALRSQEKYYILRPETFESYFVLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLFSDDSVLPLDEWVFNTEAHPLPIK 648          
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Match: sp|P45700|MA1A1_MOUSE (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 3.374e-170
Identity = 242/461 (52.49%), Postives = 321/461 (69.63%), Query Frame = 3
Query:  432 IQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            ++  EP D   + +R K+K MM  AWNNY +YAWG NEL+PISK GHS+S+FG N  G +I+D+LDTLFIM +  EF+ A  WIK  L F++  EVSVFE+ IRF+GGLL+A+  + +E+F  KA+EL   LL AF   SG+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G+  +  KV +IR +L K +KP+G+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D  A KMY  A++A+++  +I  S  G  Y+A+++ G++++KM HL CF GGMFALG+       +  +L +G  I  TCH+SY  T  KLGPE+F F   VEA+A +  EK Y+LRPE  E+Y Y+WR+T D KYR WA++AV ALE H  V  G SG+RDVY    S+DDVQQSF +AETLKYLYLIFS+D LLPL  W+FNTEAHPFPI
Sbjct:  184 VENREPADATIREKRAKIKEMMTHAWNNYKRYAWGLNELKPISKEGHSSSLFG-NIKGATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGEEIFRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGDPVFAEKVMKIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQAIETH-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQNEKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIARESYDDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPI 642          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A1I8JBY2 (alpha-1,2-Mannosidase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003262g1 PE=3 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 286/611 (46.81%), Postives = 384/611 (62.85%), Query Frame = 3
Query:   60 RYLKNFSILISIIIVFMTLVILSYRKLSYISDINNVIPKIS-------NP---DIQKYKDRESLWETIAKDREXXXXXXXXXXXXXXXEINHLKTILDLKAVKEEEKMQIIQLEKT--LERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRG-IVQNKMDHLACFVGGMFALGSIYTKNSL--------------EWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            R  +   +L+ I+  F+    L+Y  L  ++        I         P   D    +D+ +L+  I  D+ +     Q        E   +K    L+   E EK+++  L +   L+ +     +    +        P +    A R KV++MM+FAW +Y +YAWG NELRP+SKIGH+ +IFG   +G +I+D++DTL++M L DEFK A +WIK  L+FD  T+VSVFEM IRF+GGLL+ +  + D +F+ KA++LA+ LL AF+  +G+PYAL+N   K   NYNWA G C+ILSEIGTLHMEFA LSEITGN  Y++KV +IR IL KANKP G+Y NYI P + +WC  HSSLAGLGDSFYEYL+KE++RS K D  A +++  ++  ++   +  +     +Y+AD + G I + KMDHLACF GGMFALG+  T+ S               +W+ IG  IT TC +SY  T  KLGPESF F   VEAVA++  EK+Y+LRPET ESYFY+WR+T DQKYRDWA+D V ALE +     G SG+RDVYS     DDVQQS+ +AETLKYLYLIFS+D+  PL+RWVFNTEAHP PIR
Sbjct:    8 RRAQRHCLLLLIVAAFLGFAFLAYLWLPELATAGTGADNIGLAGGRHGGPLEIDPHALQDKRALYGKIQADQMRQAAYRQLIDRLHLAETELVK----LRKQIEVEKLKLTNLTRQAGLQPMHPEHHQQQQPAPPAAASAGPVNHTVLAMRDKVRDMMRFAWTSYERYAWGMNELRPVSKIGHTTTIFGSQPIGATIVDAVDTLYMMNLQDEFKKARDWIKDNLQFDKDTQVSVFEMNIRFIGGLLSVYYMSGDRLFVDKAVQLADRLLPAFNTPTGIPYALVNLKTKVGKNYNWAAGSCSILSEIGTLHMEFAALSEITGNSVYLDKVLKIRSILAKANKPNGLYPNYIHPSTASWCQQHSSLAGLGDSFYEYLIKEWLRSGKADAEAKQLFDESLPGIERHMLRTSDSARLLYLADVKFGRIAEKKMDHLACFAGGMFALGAHETRQSAASSSTSTSAEAFANKWIQIGARITATCRESYERTAVKLGPESFRFDSGVEAVAVRVPEKVYILRPETVESYFYMWRLTHDQKYRDWAWDVVRALETYCRAEAGYSGLRDVYSPSPGKDDVQQSYFLAETLKYLYLIFSDDSFFPLDRWVFNTEAHPLPIR 614          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A210Q064 (alpha-1,2-Mannosidase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07629 PE=3 SV=1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 253/458 (55.24%), Postives = 335/458 (73.14%), Query Frame = 3
Query:  435 QGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            QGGEPKDE    RR +++ MM  AWNNY K++WG NELRPI+K GHSASIFG   +G +I+D+ DTL+IM L DE+K A +WI T L F+  TE+SVFE  IRF+GGLL+ +  T D+++  KA  +A+ LL AF   +G+P +++N     S N+ WA GGC+IL+E G+ H+EFA+LSEITG+K Y+ KV +IRE L    KP G+Y NY+ P++  W   H+S+  LGDSFYEYLLK +I S KKD  A +MY AA++A+    ++ TS  G  Y+A+F+ G ++NKMDHLACF GGMFA+G+  + N  ++L +G +ITNTCH+SY  + +KLGPE+F F  + EA +I+  EK Y+LRPE  E+YFYLWR+TK+QKYRDWA++A  AL KH  V  G SG+RDVY    S DDVQQSF +AETLKYLYLIFSED L+P+++WVFNTEAHPFP+
Sbjct:  188 QGGEPKDEETAERRAEIRRMMLHAWNNYEKHSWGANELRPITKRGHSASIFGTLSLGATIVDAADTLYIMGLQDEYKKARDWIATSLSFEGATELSVFETNIRFVGGLLSLYGLTGDQIYKTKAKNVADKLLPAFKTATGIPQSMVNTKTGSSRNWGWASGGCSILAEFGSFHLEFAYLSEITGDKVYLEKVMKIRETLNSLEKPNGLYPNYLNPRTGRWGQQHTSVGALGDSFYEYLLKAWILSGKKDTQAREMYDAAVKAIDEK-LVKTSPGGLRYLAEFKSGRIENKMDHLACFSGGMFAMGAEGSDNKEKYLKLGADITNTCHESYDRSATKLGPEAFRFDGNTEAKSIRQNEKYYILRPEVIEAYFYLWRVTKEQKYRDWAWEAAQALNKHCRVDGGFSGLRDVYQEKPSLDDVQQSFFLAETLKYLYLIFSEDDLIPIDKWVFNTEAHPFPV 644          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: R7VF66 (alpha-1,2-Mannosidase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228579 PE=3 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 249/465 (53.55%), Postives = 344/465 (73.98%), Query Frame = 3
Query:  414 SISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            +++++E    E KDE N  RR KVK MMKF+W+ Y  YAWG NEL+PIS+ GHSASIFG + +G +I+D LDTL+IM L DEFK   +W+ T L+F   +++SVFE  IRF+GGLLT + FT D++F  KA+E+AN LL AF+  +G+PYA++N     SHNY WA GG +IL+E GTLH+EFA+LS+ITG+  Y++KVT+IR +L + +KP G+Y NY+ PK+  W   H+S+  LGDSFYEYLLK +I+S   D  A +MY  A++ +++  ++ TS+ G  Y +D++ G +++KMDHLACF GGM ALGS  + +  ++L  G +IT+TCH++Y  T +KLGPE+F F  + +A +++  EK Y+LRPET ESYFYLWR+TKDQKYRDW ++AV ALE H    +G SGIRDVY+   + DDVQQSF +AETLKYLYL+F++D+++ L+ WVFNTEAHP PI
Sbjct:  128 AVAVAEPNDSE-KDEENAKRREKVKEMMKFSWDQYATYAWGHNELKPISRKGHSASIFGNSALGATIVDGLDTLYIMGLMDEFKKGRDWVATALQFQGASDLSVFEANIRFVGGLLTCYAFTGDQIFKNKAVEIANKLLPAFNTPTGIPYAIVNMKTGSSHNYGWASGGQSILAEFGTLHLEFAYLSKITGDSVYLDKVTKIRNVLQQIDKPNGLYPNYLNPKTGRWGQQHTSIGALGDSFYEYLLKAWIQSGGVDTEARQMYDGAVQGLENK-LLQTSRTGLKYFSDYKNGRLEHKMDHLACFSGGMLALGSAGSSDPGKYLQYGADITHTCHEAYDRTAAKLGPEAFRFDANTDAKSVRQNEKYYILRPETVESYFYLWRLTKDQKYRDWGWEAVQALENHCRTASGFSGIRDVYNANPAKDDVQQSFFLAETLKYLYLLFADDSVISLDEWVFNTEAHPLPI 590          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: G4VP10 (alpha-1,2-Mannosidase OS=Schistosoma mansoni OX=6183 GN=Smp_018150 PE=3 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 281/598 (46.99%), Postives = 384/598 (64.21%), Query Frame = 3
Query:   57 FRYLKNFSILISIIIVFMTLVILS-YRKLSYISDINNVIPK---ISNPDIQKYKDRESLWETIAKDREXXXXXXXXXXXXXXXEINHLKTI-LDLKAVKEEEKMQIIQLEKTLERLKNVQG-KNGS-ISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHM-YMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLVHL 1823
            FR  + F +++ +II+F+T  +L+ Y     I  + +V+PK   I  P      D++S                         +I     I ++  A++   K+ + Q     E+L ++    NG+ IS  EIQGG P +E   + R KV+ MMKFAWN Y  YAWG NELRP+SK GH   + G   +G S+IDSLDTL+IM LN EF  A EWI+T L F+  T+VSVFE  IR++GGLL+A+ F++  + L KA ELA  LL AFD  SG+P +LIN       N+ WA G C+ILSE GTLHMEF +LSE+TGN  Y  KV  IR+IL + ++P G+++N++ P + +WCG  + L+ LGDSFYEYLLKE+IR++ KD  AL++Y +++E+    G+   S + ++ Y+ +++ G + N MDHLACFVGGM +LG+  +  +  W   G+ IT+TC  SY    + LGPE F F+D   A+AI    K+YLLRPET ESYFYLWR+TKD KYR WA+D V A+EK+A    G SG+ DVYS+  + DDVQQS+ +AETLKYLYLIFSEDTLLPL+RWVFN+EAHP PI++ V L
Sbjct:    8 FRCRRIFHLILVVIIIFVTTSLLNNYLFEEKILKLPSVVPKPQIIGPPPNIPESDQDS------------------------RQIQPPAQIPIETDALENATKV-LTQTLPISEKLPSIAAFNNGTLISKEEIQGGFPVNETVASIRDKVREMMKFAWNGYATYAWGSNELRPVSKTGHLPFVLGNEPLGASVIDSLDTLYIMNLNKEFNTAVEWIETNLDFNKNTQVSVFEFNIRYIGGLLSAYTFSRKPILLTKAAELAQRLLPAFDTPSGIPMSLINLKTGDKRNFVWANGRCSILSEFGTLHMEFKYLSELTGNPVYSEKVDAIRKILEEVDRPNGLFLNFMNPNTKSWCGNEAGLSALGDSFYEYLLKEWIRTDHKDVKALELYNSSLESFLKVGLFHKSPQHNLLYVGNYKYGAISNSMDHLACFVGGMLSLGA--SDKNDPWFQRGVEITDTCRRSYDSASTGLGPEIFSFTDQSSAIAITQSHKMYLLRPETVESYFYLWRLTKDPKYRVWAWDVVQAIEKYARTNAGYSGLHDVYSINSTLDDVQQSYFLAETLKYLYLIFSEDTLLPLDRWVFNSEAHPLPIQNKVKL 578          
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Match: A0A2T7P4A2 (alpha-1,2-Mannosidase OS=Pomacea canaliculata OX=400727 GN=C0Q70_10842 PE=3 SV=1)

HSP 1 Score: 535.413 bits (1378), Expect = 1.904e-180
Identity = 249/459 (54.25%), Postives = 334/459 (72.77%), Query Frame = 3
Query:  435 QGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIR 1808
            QGG+P D   K +R +VK MMK AW+NYVKY+WG+NELRPIS+ GHSASIFG + +G +I+D++DTL+IME+++EFK+A +WI   L F+  +E+SVFE  IRF+GGLL A+  T D++F  K+  +A+ LL AFD  +G+PY+++N     S N+ WA GGC+ILSE G++H+EF +LS IT +K Y+ K  +IRE+L +  KP G+Y NY+ PK+  W   H S+  LGDSFYEYLLK Y+ S K+D  A +MY  A++ V    ++ TSK G  Y A+++ G +++KMDHL CF+GG  ALG+    +S ++  +G +I +TCH SY  T  KLGPE+F F  S EA A +  EK Y+LRPE  E+YFY+WR+TK+QKYRDWA++A +ALEKH  V  G SGIRDVY    + DDVQQSF +AETLKYLYLIFSED LLPL++WV NTEAHPFPI+
Sbjct:  178 QGGQPADPEVKGKRDRVKQMMKHAWDNYVKYSWGDNELRPISRKGHSASIFGTSSLGATIVDAIDTLYIMEMDEEFKMARDWIAEHLDFEGSSELSVFETNIRFVGGLLAAYALTGDQMFKTKSKVIADKLLPAFDTPTGIPYSMVNIKTGSSRNWGWASGGCSILSEFGSMHLEFYYLSAITQDKKYLEKAQKIRELLKQLEKPGGLYPNYLNPKTGRWGQQHVSIGALGDSFYEYLLKAYLLSGKEDVEAKEMYEEALKNVVEK-LLQTSKSGMKYFAEYKSGRLEHKMDHLGCFIGGTIALGAKEFNDSKKYTDLGADIAHTCHQSYDRTAVKLGPEAFRFDSSTEAQATRSNEKYYILRPEVIETYFYMWRMTKEQKYRDWAWEATMALEKHCRVEGGYSGIRDVYQENPTLDDVQQSFFLAETLKYLYLIFSEDDLLPLDKWVLNTEAHPFPIK 635          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: man1a1 (mannosidase alpha class 1A member 1 [Source:NCBI gene;Acc:103042818])

HSP 1 Score: 503.056 bits (1294), Expect = 1.403e-171
Identity = 243/501 (48.50%), Postives = 340/501 (67.86%), Query Frame = 3
Query:  342 EEKMQIIQLEKTLERLKNVQGK--NGSISLSEIQ--------GGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            +++ + I+ +   E+  +VQG+      SL EI+        G EP D   + RR KVK MM+FAW NY +YAWG NELRP+SK GHS+++FG  K G +I+D+LDTL+IME+ DEF+ A EW++  L F++  E+SVFE+ IRF+GGLL+A+  +  EVF  KAIEL   LL AF   +G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS ++G   +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K+D+   K+Y  A++A++++ +I  S  G  Y+A+++ G++++KM HL CF GGM ALG+    +  +   + +   I  TCH+SY  T+ KLGPESF F   VEA+A +  EK ++LRPE  E+Y Y+WR T D KYR W ++AV ALE+H  +  G SG+RDVY+   SHDDVQQSF +AETLKYLYL+FS+D  LP + WVFNTEAHP P+
Sbjct:  113 QKRAEDIKHDIKSEKENDVQGRARGRDDSLPEIEFARPPGATGHEPSDPETRERRAKVKEMMQFAWGNYKRYAWGSNELRPVSKQGHSSNLFGSLK-GATIVDALDTLYIMEMYDEFEAATEWVEKNLDFNMNAEISVFEVNIRFVGGLLSAYYLSGKEVFRRKAIELGEKLLPAFKTPTGIPWALLNLKSGIGRNWPWASGGSSILAEYGTLHLEFMHLSRLSGKPVFAEKVMNIRKVLNRLDKPQGLYPNYLNPNSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKRDEEGKKLYYDALKAIETN-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMIALGADGAPDDKTGHQMELAAEIARTCHESYARTNLKLGPESFRFDGGVEAIATRQNEKYFILRPEVIETYMYMWRFTHDPKYRMWGWEAVQALEQHCRLEAGYSGVRDVYASSPSHDDVQQSFYLAETLKYLYLLFSDDDHLPFDHWVFNTEAHPLPV 611          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: man1a2 (mannosidase, alpha, class 1A, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-390])

HSP 1 Score: 481.871 bits (1239), Expect = 1.306e-165
Identity = 225/444 (50.68%), Postives = 310/444 (69.82%), Query Frame = 3
Query:  492 MMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDL 1814
            MMK AW++Y +Y WG NEL+PI+K GHS +IFG ++MG +I+D+LD+L+IM L+DEFK   EWI+  L F +  EVSVFE+ IRF+GGLL A+  +  EVF  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  L+ +TGN  Y  KV  IR++L K ++P G+Y NY+ P++  W   H+S+ GLGDSFYEYLLK ++ S+K D  A K Y  AIEA++   +I  S  G  ++ +++ G ++ KM HL CF GGMFALG+  +    +  +L +G  I +TCH+SY  T  KLGPE+F F   +EAVA++  EK Y+LRPE  E+Y+Y+WR T D KYR W ++A  A++K+  V+ G SG++DVYS   ++DDVQQSF +AETLKYLYL+FS D LLPL  WVFNTEAHP P+  L
Sbjct:    1 MMKHAWDSYRQYGWGHNELKPIAKKGHSTNIFGNSQMGATIVDALDSLYIMGLHDEFKDGQEWIEQNLDFSVNAEVSVFEVNIRFIGGLLAAYYLSGQEVFKVKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLTYLTGNPAYYQKVMHIRKLLAKMDRPNGLYPNYLNPRTGRWGQHHTSVGGLGDSFYEYLLKAWLMSDKTDAEARKTYDDAIEAIERH-LIRKSNGGLTFIGEWKNGHLERKMGHLTCFAGGMFALGADGSPGDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKFDSGLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKYCRVSGGFSGVKDVYSSNPTYDDVQQSFFLAETLKYLYLLFSSDELLPLESWVFNTEAHPLPVLHL 443          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: si:ch73-373m9.1 (mannosidase alpha class 1C member 1 [Source:HGNC Symbol;Acc:HGNC:19080])

HSP 1 Score: 433.721 bits (1114), Expect = 8.284e-147
Identity = 219/441 (49.66%), Postives = 303/441 (68.71%), Query Frame = 3
Query:  492 MMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            MMKFAW+NY  YAWG+NELRP+++ GH   +      G +IIDSLDTL+IM L +++K A EW++  L  +   E S+FE+ IR++GGLL+A+  T +EVF  K +EL   LL AF   +G+P  +IN  +     + WA  G +IL+E GTLH+EF  LSE++GN  Y  KV  IR++L K  KP G+Y N++ P S  W   H SL GLGDSFYEYL+K Y+ S+K D+ A +MY +A+EA++++ ++  S  G  Y+A++R G++ +KM HLACF GGM  +G+     +    +L +   IT+TCH+SY  + +KLGPE+F F    EA A +  ++ Y+LRPE  ESY Y+WR+T D KYR W ++AV ALEKH  V +G SGIRDVY+  VSHD++QQSF ++ETLKYLYL+FS+D LLPL+ WVFNTEAHP P+
Sbjct:    1 MMKFAWDNYKSYAWGKNELRPLTRNGHIGGL-----RGATIIDSLDTLYIMGLTEDYKEAKEWVQNNLDLNSNGEASLFEVNIRYVGGLLSAYYLTGEEVFKQKVLELGEKLLPAFGTPTGIPRGVINLGS-----WGWASAGSSILAEFGTLHLEFVHLSELSGNPIYTEKVMNIRKLLDKIEKPHGLYPNFLSPVSGNWVQHHVSLGGLGDSFYEYLIKSYLMSDKTDEEAKRMYYSALEAIETN-LVQKSPGGLTYVAEWRGGVLDHKMGHLACFSGGMVGIGADDGAPEKRQHYLDLAAEITHTCHESYSRSATKLGPEAFRFDGGAEATATRLSDRYYILRPEVIESYMYMWRLTHDPKYRQWGWEAVEALEKHCRVEDGFSGIRDVYASTVSHDNMQQSFFLSETLKYLYLLFSDDDLLPLDDWVFNTEAHPLPV 430          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: man1b1b (mannosidase alpha class 1B member 1 [Source:NCBI gene;Acc:103022471])

HSP 1 Score: 289.271 bits (739), Expect = 1.055e-88
Identity = 170/472 (36.02%), Postives = 275/472 (58.26%), Query Frame = 3
Query:  435 QGGEPKDE--INKARRLK-VKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRI-REILYKANKPQGIYMNYIQPKSH--TWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHF---SDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNG----ISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSED-TLLPLNRWVFNTEAHPFPI 1805
            +  EP+D   + +  RL+ V+   + AW  Y  +AWG +EL+P+SK  HS   FG   +G+++ID+LDT++I+ L +EF+ A EW+  +L F+   +V++FE TIR LGGLL+ +  T D +FL KA ++ + L+ AF   S +PY+ +N     +H   W     + ++E+ ++ +EF  LS +TG+  Y   V  + R++     K  G+   +I   S   T  G + +L    DS+YEYLLK++I+  KK+   L+ Y+ A+E VK + +  +S  G  ++ +   G    KMDHL CF+ G  ALG+ +  ++ E + +   +  TC+  Y   D+ L PE  HF   + S + V ++  ++  LLRPET ES FY++R TKD+KY++W ++ + +  K+  V  G    I+ +RD  +   S  D  +SF + ETLKY YL+FS+D  L+ L+++VFNTEAH  PI
Sbjct:  166 KAAEPEDPSAVQQESRLEAVREAFRHAWKGYKDFAWGHDELKPVSK-SHS-EWFG---LGLTLIDALDTMWILGLKEEFQEAREWVDKELSFNKNVDVNLFESTIRILGGLLSTYHLTGDVLFLEKAKDIGSRLMPAFSTPSKIPYSDVNIGKGTAHPPRWTSD--STVAEVTSIQLEFRELSRLTGDPKYQAAVMEVMRQVHKLEGKQDGLVPMFINTNSGQFTHLGIY-TLGARADSYYEYLLKQWIQGGKKETELLEDYLQAVEGVKKNLLKKSSPLGLTFVGELSHGHFSPKMDHLVCFLPGTLALGAHHGLDA-EHMELAKQLMETCYQMYAQMDTGLAPEIAHFNMQTGSAQDVDVKLADRHNLLRPETVESLFYMYRFTKDKKYQNWGWEILQSFNKYTRVETGGYTSINNVRDPKN--PSPRDKMESFFLGETLKYFYLLFSDDPNLVSLDKYVFNTEAHALPI 626          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Match: man1b1a (endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase [Source:NCBI gene;Acc:103024141])

HSP 1 Score: 289.271 bits (739), Expect = 1.896e-88
Identity = 168/499 (33.67%), Postives = 281/499 (56.31%), Query Frame = 3
Query:  357 IIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKA---RRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKAN-KPQGIYMNYIQPKSHTWCGFHSSLAGLG---DSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHF---SDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNG----ISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDT-LLPLNRWVFNTEAHPFPI 1805
            +I+ E+  E   +   K  +   +E++G  P   ++     R   V+   + AW  Y  +AWG +EL+PISK       FG   +G+++ID+LDT++I+ L +EF+ + EW++ +L F    +V++FE TIR LGGLL+ +  T D +FL KA ++ + L+ AF   S +P++ +N     +H   W     + ++E+ ++ +EF  LS +T +  Y   V  I   +++ + K  G+   +I   S  +   H  +  LG   DS+YEYLLK++++  K++   L+ YI A+E VK + +  T+    +++ +   G +  KMDHL CF+ G  ALG+ +     + + + + +  TCH  Y+  ++ L PE  HF   + +   V ++P ++  LLRPET ES FY++R T+D KYRDW ++ + +  K   V +G    I  +RD   V     D  +SF + ETLKYL+L+FS+D  L+ L+++VFNTEAHP PI
Sbjct:  177 MIEAEQGTEPQPSAHAKEAA-GPAEVEGAAPLQPVSVKPVDRAEAVREAFRHAWKGYKAFAWGHDELKPISKT--HGEWFG---LGLTLIDALDTMWILGLKEEFEESREWVEKELSFSKNVDVNLFESTIRILGGLLSTYHLTGDALFLEKAKDIGSRLMPAFKTPSKIPFSDVNIGKGTAHPPRWTTD--STVAEVTSIQLEFRELSRLTQDPQYQKAVDEIMGQVHRLDGKHDGLVPMFINTNSGKFT--HRGVYTLGARADSYYEYLLKQWLQGGKQEPELLEDYIQAVEGVKKNLLKQTAPSKLLFVGELSHGRLNPKMDHLVCFLPGTLALGA-HNGLPADHMELAVQLIETCHQMYVQMETGLSPEIAHFNLQNHNGRDVDVKPADRHNLLRPETVESLFYMYRFTQDSKYRDWGWEILQSFNKFTRVPSGGYTSIGNVRD--PVNPGPRDKMESFFLGETLKYLFLLFSDDPDLISLDKYVFNTEAHPLPI 662          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: man1b1a (mannosidase, alpha, class 1B, member 1a [Source:ZFIN;Acc:ZDB-GENE-091116-34])

HSP 1 Score: 272.322 bits (695), Expect = 6.176e-83
Identity = 163/460 (35.43%), Postives = 265/460 (57.61%), Query Frame = 3
Query:  468 ARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSAS-IFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRI-REILYKANKPQGIYMNYIQPKSHTW--CGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHM-YMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHF---SDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMV-TNGISGIRDVYSV--PVSHDDVQQSFLMAETLKYLYLIFSED-TLLPLNRWVFNTEAHPFPIR 1808
             R+  V      AW  Y ++AWG +EL+P+S   HS S  FG   +G++I+D+LDT++IM L +EF+ A +W+ TKL F    +V++FE TIR +GGLL  F  T D++FL KA++L N L+ AF+  S +PY+ +N     +H   W     + ++E+ ++ +EF  LS +TG+  Y      +   +L  + K  G+   +I   S  +   G + ++    DS+YEYLLK++++  K++K  L  Y+ A+  ++   ++ TS+  H+ ++ +   G ++ KMDHL CF+ G  ALG+ +  +    + +   +  TC+  Y   ++ L PE  HF   + S   + ++P ++  LLRPET ES FYL R T   KY+DW ++   + +++  V T G S I +V S   P   D + +SF + ETLKY +L+FS++  LL  ++ VFNTEAH FPIR
Sbjct:  188 PRQQAVVEAFLHAWRGYREFAWGHDELKPLS---HSFSEWFG---LGLTILDALDTMWIMGLENEFEEARQWVSTKLNFAKNVDVNLFESTIRIMGGLLGTFHLTGDKLFLDKAVDLGNRLMPAFNTPSKVPYSDVNLRTGQAHPPKWTSD--SSVAEVTSIQLEFRELSHLTGDPKYKGAADAVTHHVLGLSGKLDGLVPMFINTHSGQFSRSGVY-TMGARADSYYEYLLKQWLQGGKREKHLLNSYLEAMSGMQKH-LLGTSQPNHLTFIGELISGALKPKMDHLVCFLPGTLALGARHGLDPSH-MELAEKLLETCYQMYQQMETGLSPEISHFNMQAGSTHDIEVKPADRHNLLRPETVESLFYLHRFTDKVKYQDWGWEIFQSFQRYTRVATGGYSSINNVRSPSNPEPRDKM-ESFFLGETLKYFFLLFSDNKALLSPDKHVFNTEAHAFPIR 635          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004139.1 (pep scaffold:Pmarinus_7.0:GL482877:594:8467:-1 gene:ENSPMAG00000003776.1 transcript:ENSPMAT00000004139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 9.002e-57
Identity = 92/223 (41.26%), Postives = 136/223 (60.99%), Query Frame = 3
Query:  786 EVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEW----------LTIGINITNTCHDSY 1421
            + F  KA+EL   LL AF+  +G+P+A++N       N+ WA GGC+ILSE GTLH+EF  LS+++GN  +  KV +IR  L K  KP G+Y NY+ P S  W   H S+ GLGDSFYEYL+K ++ S++ D  A ++Y  A++A+++  ++  S+ G  +  ++R G ++ KM HLACF GGMFALG+    +              L +   I +TCH+SY
Sbjct:    1 QFFRTKAVELGERLLPAFNTPTGIPWAMVNLKTGVGRNWGWASGGCSILSEFGTLHLEFEHLSQLSGNPVFREKVVKIRNALDKMTKPNGLYPNYLHPNSGNWGQHHVSVGGLGDSFYEYLIKAWLMSDRTDTQARRLYDDAMQAIEAH-LLRRSEGGLTFFGEWRSGYLERKMGHLACFTGGMFALGADGASSPQAGAQGAEATGGHLALAAEIAHTCHESY 222          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001013.1 (pep scaffold:Pmarinus_7.0:GL480056:18427:26430:1 gene:ENSPMAG00000000921.1 transcript:ENSPMAT00000001013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 4.195e-30
Identity = 50/103 (48.54%), Postives = 72/103 (69.90%), Query Frame = 3
Query:  786 EVFLYKAIELANNLLHAF-DESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTW 1091
            +VF  +A+ELA  LL AF   +G+P+AL+N  +    N+NWA  GC+IL+E GTLH+EFA LS +TG  +YI+ V +IR IL K ++P G+Y NY+ P++  W
Sbjct:    1 QVFKIRAVELAEKLLPAFRTPTGIPWALLNLKSGVGRNWNWASSGCSILAEFGTLHLEFAHLSYLTGESSYIDLVMKIRGILQKMDRPNGLYPNYLHPRTGRW 103          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006166.1 (pep scaffold:Pmarinus_7.0:GL476535:951795:959705:-1 gene:ENSPMAG00000005553.1 transcript:ENSPMAT00000006166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 2.043e-28
Identity = 114/419 (27.21%), Postives = 184/419 (43.91%), Query Frame = 3
Query:  657 EFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDE------------VFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLAL-KMYIAAIEAVKSSG---MIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFAL-GSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLG--PESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLL------------PLNR-------WVFNTEAHP 1796
            EF+  + +++  + F+    VSVFE  IR +GGLL+A + +K                L  A ++A  LL AF   +G+PY  +N      H  +  E      + +GT  +EF+ LS +TG+  + +   R    L+      G+  N+I  K+  W    + +    DS++EYL+K  I  ++ + + + K Y  AIE         +     KG + M  F+          L  +  G+ +L G+I +               T H+ Y     + G  PE ++   S        + + Y LRPE  ES  YL+R TKD    +   D + A+EK+A V  G + +++V    +  ++  +SF +AET KYLYL+F  D  L            P          ++FNTEAHP
Sbjct:    7 EFQRVSLFLEDAINFNQDVNVSVFETNIRVVGGLLSAHLLSKQAGVELEDGWPCSGPLLRMAEQVARKLLPAFQTATGMPYGTVNL----RHGVHPTETSVTCTAGVGTFILEFSALSRLTGDPVFEDTARRALLSLWTTRSEIGLVGNHIDVKTSAWVAQDAGIGAGIDSYFEYLVKGAILLHEPEYMEMFKEYSEAIEKYMKHDDWYVWVHMSKGTVSMPVFQS---------LDAYWPGLQSLVGNIDSA------------MKTLHN-YHQVWRQFGGLPEFYNIPHSTTV----DKREGYPLRPELVESAMYLYRATKDPFLLELGQDILEAIEKNARVECGYATVKNVQDQRL--ENRMESFFLAETTKYLYLLFDPDNFLHNSGEVSDSVSTPFGECILGAGGYIFNTEAHP 393          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Match: edem1 (ER degradation enhancer, mannosidase alpha-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-808])

HSP 1 Score: 108.612 bits (270), Expect = 3.631e-25
Identity = 121/490 (24.69%), Postives = 196/490 (40.00%), Query Frame = 3
Query:  450 KDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGI---------SIIDSLDTLFIMELNDEFKVAAEWIKTKLKFD-------LKTEVSVFEMTIRFLGGLLTAFIFTKDEV--------------FLYKAIELANNLLHAFDES--GLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTR-IREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYT---DSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLN--RWVFNTEAHPFPI 1805
             D++    R   + M    ++NY+ +A+  +EL PI   G    +   + + I         ++ID+LDTL +M    +   A         F+                   R LG LL+A +   D                 L+ A ELA+ LL AF+ +  G+PY  +N         + +E  C   +  G+L +EF  LS + G+ TY     R +R +        G+  N I  +S  W G  S L    DSFYEYLLK  +    K  + L  Y   +   + S  +     G ++ + F     +N    L           S  T   L  +  G      C  ++ Y      +  PE +++          P    Y LRPE  ES + L++ TK+  Y       + ++EKH  V  G + +  V  +  S +D  +SF ++ET KYL+L+F  +  + +    ++F TE H  P+
Sbjct:   46 PDQLRVQLREDARRMFYVGYDNYMSHAFPADELNPIDCRGRGPDVDNPSNININDVLGNYSLTLIDALDTLAVMGNASQNGDAHTQCDDNTHFEHFGLFLCAHAAAHACPGACRVLGSLLSAHLIITDTAQPFGDMALPDYEDELLHMAHELASRLLPAFENTNTGIPYPRVNLRRGVP--LDVSEETCT--AGAGSLLVEFGVLSRLLGDPTYEGAARRAVRSLWALRCNTTGLLGNVINVQSGQWVGSQSGLGAELDSFYEYLLKLKVIFFFKFLILLFKY---LRFQRESSCLRLCNHGLVFPSLF-----ENCPKVL-----------STSTITPLVQVLAGDVEEAICLHAFYYAIWQRFEALPERYNWQLKA------PDVHFYPLRPELVESTYLLYQATKNPFYLHVGQKILQSIEKHTRVRCGYATLHHV--IDKSKEDRMESFFLSETCKYLFLLFDIENPVHVGGRAFIFTTEGHLLPV 504          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Match: MNS1 (Alpha-1,2-mannosidase; involved in ER-associated protein degradation (ERAD); catalyzes the removal of one mannose residue from a glycosylated protein, converting the modification from Man9GlcNAc to Man8GlcNAc; catalyzes the last step in glycoprotein maturation in the ER and is critical for ER protein degradation [Source:SGD;Acc:S000003892])

HSP 1 Score: 246.514 bits (628), Expect = 2.810e-74
Identity = 166/503 (33.00%), Postives = 260/503 (51.69%), Query Frame = 3
Query:  474 RLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIM---------ELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFT------KDEVFLYKAIELANNLLHAF--DESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKP----QGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHM-YMADFRRGI---VQNKMDHLACFVGGMFALG-----SIYTKNSLEWLTIGI----------NITNTCHDSYMYTDSKLGPESFHFSD-----------SVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIR------DVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRD 1811
            R ++++M   +W +Y K+ WG +   PI    H+    G   +G  I+DS+DTL +M         E   E + +  WI   L FD+  EV+VFE TIR LGGLL+A+  +         V+L KAI+L + L  AF   ++G+PY+ IN  +  +   N A+GG +  +E  TL MEF +L+ +TGN+TY   V R+ E LYK N       G+   Y  P +  +          GDSFYEYLLK+Y+ ++  + L   +Y  ++E +K   ++A SK   + Y+ +  +G+   +  KMDHL CF+GG+ A G     SI+      + ++ +           IT+TC+  Y  + S L PE   F+D           SV    ++P ++  L RPET ES  +++ ++ D KYR+W  +   +  ++  V      +R      D  ++P    +  +SF +AETLKYLY++F ++    L + VFNTEAHPFP+ D
Sbjct:   39 RDRIESMFLESWRDYSKHGWGYDVYGPIEHTSHNMPR-GNQPLGWIIVDSVDTLMLMYNSSTLYKSEFEAEIQRSEHWINDVLDFDIDAEVNVFETTIRMLGGLLSAYHLSDVLEVGNKTVYLNKAIDLGDRLALAFLSTQTGIPYSSINLHSGQAVK-NHADGGASSTAEFTTLQMEFKYLAYLTGNRTYWELVERVYEPLYKNNDLLNTYDGLVPIYTFPDTGKFGASTIRFGSRGDSFYEYLLKQYLLTH--ETLYYDLYRKSMEGMKKH-LLAQSKPSSLWYIGEREQGLHGQLSPKMDHLVCFMGGLLASGSTEGLSIHEARRRPFFSLSLERKSDWDLAKGITDTCYQMYKQSSSGLAPEIVVFNDGNIKQDGWWRSSVGDFFVKPLDRHNLQRPETVESIMFMYHLSHDHKYREWGAEIATSFFENTCVDCNDPKLRRFTSLSDCITLPTKKSNNMESFWLAETLKYLYILFLDE--FDLTKVVFNTEAHPFPVLD 534          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Match: MNL1 (Alpha-1,2-specific exomannosidase of the endoplasmic reticulum; involved in glycan trimming of both folded and misfolded glycoproteins; complexes with Pdi1p, and trims a mannose from Man8GlcNac2 glycans to generate Man7GlcNac2, an oligosaccharide signal on glycoproteins destined for ER-associated protein degradation; requires Pdi1p for stability and substrate recognition; human homolog EDEM1 can complement yeast null mutant [Source:SGD;Acc:S000001247])

HSP 1 Score: 120.939 bits (302), Expect = 4.890e-29
Identity = 131/499 (26.25%), Postives = 225/499 (45.09%), Query Frame = 3
Query:  465 KARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMG---------ISIIDSLDTLFIMELNDEFKVAAEWIKTKLK---FDLKTEVSVFEMTIRFLGGLLTAFIFTKDEV------------FLYKAIELANNLLHAF-DESGLPYALINFDNKFS----HNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANK-----------PQGIYMNYIQPKSHTWCGFHSSLAGLG---DSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSG------MIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTK---NSLEWLTIGINITNTCHDSYMYTDSKLGPES-FHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLL--PLNRWVFNTEAHP 1796
            KA + +VK +  F ++NY+++ +  +E++PIS +    +       G         I++IDSL T+ I+E   +F  A   ++       FD+ + + VFE+TIR +G LL++ ++  D               L  A  +A+ LL A+   +GLP    N   K+       +   E   A ++   +   EF  LS +TG+  Y  KVTR     Y  +K           P   +   + P        ++ + G+G   DS +EY LK  I  +  D   ++++  A EA+K++           +  GH+++           +D L+ F  G+  L         N L +L +  N      + + ++  +  P S    S +V    I P E  Y LRPE FES ++L+R TKD  Y +     +  L++      G +G ++V +  +   D  ++F+++ETLKYLYL+F E+  L    +  +F+TEAHP
Sbjct:   33 KAYKQEVKELFYFGFDNYLEHGYPYDEVKPISCVPKKRNFEDPTDQGTNDILGNFTITLIDSLTTIAILEDRPQFLKAVRLVERTFPDGNFDIDSTIQVFEITIRVIGSLLSSHLYATDPTKAVYLGDDYDGSLLRLAQNMADRLLPAYLTSTGLPMPRRNIKRKWDVSEFPEFLETENNVAAMA---SPMFEFTILSYLTGDPKY-EKVTR-----YAFDKTWSLRTGLDLLPMSFHPEKLTP--------YTPMTGIGASIDSLFEYALKGAILFD--DSELMEVWNVAYEALKTNCKNDWFFANVMADTGHLFVP---------WIDSLSAFFSGLQVLAGDLDDAIANHLMFLKMW-NTFGGIPERWNFSPPEFPPLSPLERSGAVALDNILPLE-WYPLRPEFFESTYFLYRATKDPFYLNIGVHLLKDLKQRFKSNCGFAGFQNVITGELQ--DRMETFVLSETLKYLYLLFDEENELHNSASDVIFSTEAHP 499          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO38861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV5])

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 236/442 (53.39%), Postives = 318/442 (71.95%), Query Frame = 3
Query:  483 VKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            V  MMK AWN YV YAWG NELRPIS  GHSASIFG+  MG +++D+L TL +M +N+EF+   +W+   L F+  +++SVFEMTIRFLGGLL+A+  + +EVF  KA EL + LL AF+  +G+P+A++N  +   HN+ WA GGC+IL+E GTLH+EF +LS ITGN+ Y  KV R+RE++ +  KP G+Y NY+ P++  W   H SL  LGDSFYEYLLK +I S K DK A  MY  A+EA++   +  + K    Y+A+++ G +++KMDHLACF  GMFALG+  +KN   +L +G  + NTCH++Y  T + +GPESF F  + EAVAI+  E+ Y+LRPE  E +FY+WR T+D KYRDWA++A   +EKH  V  G SGIRDV +  V+HDDVQQSF +AETLKYLY+IFS+D+LLPL++WV NTEAHP P+
Sbjct:    3 VLQMMKHAWNGYVTYAWGSNELRPISHTGHSASIFGRGSMGATVVDALSTLKLMGMNEEFERGRKWVAQNLNFNQASDISVFEMTIRFLGGLLSAYALSGEEVFKVKAKELGDKLLPAFNTPTGIPWAMVNLASGSGHNWGWASGGCSILAEFGTLHLEFVYLSHITGNQVYAKKVHRVREVVDQVQKPNGLYPNYLNPRTGVWGSQHVSLGALGDSFYEYLLKSWIMSGKMDKKARDMYDKAVEAIERMLVQRSRKSNLTYLAEYKYGRLEHKMDHLACFTAGMFALGAKESKNEKHYLQLGAELANTCHEAYKRTATGIGPESFRFEGNAEAVAIRNNERYYILRPEVIEGWFYMWRFTRDSKYRDWAWEAAQNIEKHCRVDGGYSGIRDVTNPNVAHDDVQQSFFLAETLKYLYMIFSDDSLLPLDKWVINTEAHPLPV 444          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO30560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0F0])

HSP 1 Score: 198.749 bits (504), Expect = 2.787e-58
Identity = 115/344 (33.43%), Postives = 190/344 (55.23%), Query Frame = 3
Query:  468 ARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTW-CGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRG-IVQNKMDHLACFVGGMFALGSIYTKNSLE--WLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAV 1484
            +R+  V    + AW  Y ++AWG +EL+PISK     S      +G++IIDSLDT+ ++ L DEF+ A +W+   L FD   +V++FE+TIR LGGLL+A+  + D++FL KA+EL + LL  F+ +SG+P++ +N   +  H   W  G  + +SE+ T+ +EF  LS +TGN  Y   V ++   L+   K  G+   ++   +  +  G   +L   GDS+YEYLLK+++++ KK+    + +  ++  V S     +     +Y+ +   G     KMDHL CF+ G  AL +    N L+  +L    ++  TC+  Y    S+L PE  +F+ +  A 
Sbjct:    3 SRQKAVIEAFRHAWKGYKQFAWGHDELKPISK-----SFSEWFNIGLTIIDSLDTMLLLNLKDEFREARDWVANSLSFDKNVDVNLFEVTIRVLGGLLSAYHLSNDDIFLNKAVELGDRLLPCFNSQSGIPFSDVNLMTRQVHPPRW--GPDSSVSEVSTIQLEFRDLSYVTGNDKYKQAVDKVMRHLHSLPKKNGLVPIFVNANTGQFRPGATITLGARGDSYYEYLLKQWLQTGKKEDWLKEDFTNSMNGVTSLLARRSHPNKLLYVGELLHGNSFSPKMDHLVCFLPGTMALAA---HNGLDPKYLEFAKDMMETCYQMYARMPSRLSPEIAYFNQNPPAT 336          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO46917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU8])

HSP 1 Score: 140.198 bits (352), Expect = 1.063e-35
Identity = 127/474 (26.79%), Postives = 209/474 (44.09%), Query Frame = 3
Query:  492 MMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGI---------SIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEV--------------FLYKAIELANNLLHAFDES--GLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILY-KANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKD----------KLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLL--PLNRWVFNTEAHPF 1799
            M  F + +Y++YA+  +EL PI   G          + I         +++++L TL +M  + EFK+A + +   + FD K+ V VFE  IR LG LL+A +  KD +               L  A +LAN L+ AF++S  G+PY  +N  +  +      +     L+  G+L +EF  LS + G+ ++ N   +   +L+ + +   G++ N I  ++  W G  S L    DSFYEYLLK YI   + +          +L L +    ++ ++ SG        +M  A      V +     A F       G I        L             +++   +  PE F++         QP    Y LRPE  ES + L++ T    Y     + +  LE HA    G + I +V  +  S +D  +SF ++ET KYLYL+F  +  +    + ++F+TE H F
Sbjct:    1 MFYFGYESYMRYAFPHDELDPIHCTGRGPDRKNPTNININDVLGDYSLTLVEALGTLAVMGNSTEFKLAVQHVIDNVHFDRKSTVQVFEANIRVLGSLLSAHMIIKDPLQPFGDMSPDDYDDELLTLAHDLANRLVDAFNKSPTGIPYPRVNLTSGEA----LRDRSDTCLAGAGSLLLEFGVLSRLLGDPSFENLARKAVNMLWAQRSASTGLFGNVIDVRTKEWIGKMSGLGAGLDSFYEYLLKGYILFGEVEDLKRFNDIYKQLHLHLRKGRLKCLEGSGETPVYVNVNMNTAKIENAWVDSLH---ASFAAVQVLKGDISEAICTHALFY-----------HIWRKYQALPERFNWH------LKQPDVYFYPLRPELAESTYVLYQATHHPFYLHVGREMLRDLETHARAECGYATIHNV--LDKSQEDRMESFFLSETCKYLYLLFDHENHVNQDASNYIFSTEGHLF 448          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO26074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY5])

HSP 1 Score: 89.7373 bits (221), Expect = 8.420e-22
Identity = 42/92 (45.65%), Postives = 62/92 (67.39%), Query Frame = 3
Query:  495 MKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAF 770
             + AW  Y ++AWG +EL+PISK     S      +G++IIDSLDT+ ++ L DEF+ A +W+   L FD   +V++FE+TIR LGGLL+A+
Sbjct:    1 FRHAWKGYKQFAWGHDELKPISK-----SFSEWFNIGLTIIDSLDTMLLLNLKDEFREARDWVANSLSFDKNVDVNLFEVTIRVLGGLLSAY 87          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Match: EDO36928 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH71])

HSP 1 Score: 92.8189 bits (229), Expect = 1.160e-19
Identity = 84/298 (28.19%), Postives = 132/298 (44.30%), Query Frame = 3
Query:  939 GTLHMEFAFLSEITGNKTYINKVTRIREILYK-ANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYI---------RSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFAL-GSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDT--LLPLNRWVFNTEAH 1793
            GT+ MEF  LS +TG+  +  K  +  E L+K  ++   +    I   +  W    S +    DS+YEY LK YI         R NK  K ++  YI       S  M    +  H Y            MD L  F  G+  L G +     +  +   +   +T       TD ++     H+ +             + LRPE  ES ++L+  T D  Y +   + V  + +HA V  G + ++DV +  +SH+D   SF++AET KYLYL+F++ +   LP+N ++  TEAH
Sbjct:  291 GTMIMEFGALSRLTGDPIFEEKAKKAMESLWKFRSRASDLVGTVINIHNGDWVRRDSGVGAGIDSYYEYCLKAYILLGDDTYLDRFNKHYK-SIMQYINQGAMFLSVQMHQPERTSHAY------------MDALQAFWPGLQVLKGDLKKAIEMHHMLYEVAKKHTFLPEAFTTDFEV-----HWGE-------------HPLRPELVESTYFLYEATLDPYYLEVGRNIVEKINEHARVPCGFAALKDVRT--LSHEDRMDSFVLAETFKYLYLLFTDKSEWTLPMNDFILTTEAH 555          

HSP 2 Score: 64.3142 bits (155), Expect = 9.862e-11
Identity = 50/171 (29.24%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  453 DEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQ-----NKMG---ISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTK------------DEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYN 902
            DE  K R  +VK M + A+N+Y+ +A+  +EL P+S  G    +        + +G   ++++D+LDTL ++    EF+ A + +   + FD    VSVFE  IR +GGLL   +               +   L  A +     L AF+  +G+PY  +    K SH Y+
Sbjct:   29 DEKRKMRG-QVKEMFRHAYNSYMSFAYPADELMPLSCKGRVRGVDPSRGDVDDALGMFSLTLVDTLDTLAVLGEVSEFEKAVKLVIKDVHFDTDVVVSVFETNIRIVGGLLGGHVAADSLKKSGKGLSWYNGELLALAKKAGECQLPAFNTTTGIPYPKV---RKPSHQYH 195          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: man1a1 (mannosyl-oligosaccharide 1,2-alpha-mannosidase IA [Source:NCBI gene;Acc:101158740])

HSP 1 Score: 505.368 bits (1300), Expect = 2.048e-172
Identity = 237/459 (51.63%), Postives = 322/459 (70.15%), Query Frame = 3
Query:  438 GGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDES-GLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            G EP+D   + RR KVK MMK AW++Y +YAWG NELRP+SK GHS+++FG  K G +I+D+LDTLFIME+++EF  A EW++  L F++  EVSVFE+ IRF+GGLL+A+  +  EVF  KA+EL   LL AF  S G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS+++GN+ +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D+   KMY  +++A+++S +I  S  G  Y+A+++ G++++KM HL CF GGM ALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK ++LRPE  E+Y Y+WR T D KYR+W ++AV ALE+H  V  G SG+RDVYS   S DDVQQSF +AETLKYLYL+FSED  LP + WVFNTEAHP P+
Sbjct:  152 GSEPRDPETRERRAKVKEMMKHAWDSYRRYAWGSNELRPVSKQGHSSNLFGSIK-GATIVDALDTLFIMEMSEEFNAATEWVEKNLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGKEVFRQKAVELGEKLLPAFRTSTGIPWALLNLKSGVGRNWPWASGGSSILAEYGTLHLEFMHLSKLSGNQEFAQKVMNIRKVLNRLDKPQGLYPNYLNPNSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDEEGKKMYYDSLQAIETS-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMIALGADGAPGDKTGHQMELAAEIARTCHESYARTALKLGPEAFRFDGGVEAIATRQNEKYFILRPEVIETYMYMWRFTHDPKYREWGWEAVQALERHCKVEGGYSGVRDVYSSNPSLDDVQQSFFLAETLKYLYLLFSEDDQLPFDHWVFNTEAHPLPV 608          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: man1a2 (mannosidase alpha class 1A member 2 [Source:NCBI gene;Acc:101162719])

HSP 1 Score: 496.893 bits (1278), Expect = 8.778e-169
Identity = 230/461 (49.89%), Postives = 322/461 (69.85%), Query Frame = 3
Query:  441 GEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKN--SLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDL 1814
            GEP +   K +R K++ MMK AW++Y +Y WG NEL+PI+K GHS +IFG ++MG +I+D+LDTL+IM L++EFK   EWI+  L F +  EVSVFE+ IRF+GGLL A+  +  EVF  KA++LA  LL AF+  +G+P+A++N  +    N+ WA  G +IL+E GTLHMEF  L+ +TGN  Y  KV  IR++L K ++P G+Y NY+ P++  W   H+S+ GLGDSFYEYLLK ++ S+K D  A K Y  A+EA++   ++  S  G  ++ +++ G ++ KM HLACF GGMFALG+  + +  +  +L +G  I +TCH+SY  T  KLGPE+F F   +EAVA++  EK Y+LRPE  E+Y+Y+WR T D KYR W ++A  A++K+  V+ G SG++DVYS   ++DDVQQSF +AETLKYLYL+FS D LLPL  WVFNTEAHP P+  L
Sbjct:  176 GEPPEPDAKEKRDKIREMMKHAWDSYRQYGWGHNELKPIAKKGHSTNIFGSSQMGATIVDALDTLYIMGLHEEFKDGQEWIEQNLDFSVNAEVSVFEVNIRFIGGLLAAYYLSGQEVFKLKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFVHLTYLTGNPVYYQKVMHIRKLLAKMDRPNGLYPNYLNPRTGRWGQHHTSVGGLGDSFYEYLLKAWLMSDKTDTEARKTYDDAVEAIERH-LVRKSNGGLTFIGEWKNGHLERKMGHLACFAGGMFALGADGSPDDKAGHYLQLGAEIAHTCHESYDRTVLKLGPEAFKFDSGLEAVAVRQNEKYYILRPEVIETYWYMWRFTHDPKYRQWGWEAAQAIDKYCRVSGGFSGVKDVYSSNPTYDDVQQSFFLAETLKYLYLLFSSDDLLPLESWVFNTEAHPLPVLHL 635          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: man1a1 (mannosyl-oligosaccharide 1,2-alpha-mannosidase IA [Source:NCBI gene;Acc:101158740])

HSP 1 Score: 484.567 bits (1246), Expect = 9.599e-167
Identity = 228/441 (51.70%), Postives = 311/441 (70.52%), Query Frame = 3
Query:  492 MMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDES-GLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            MMK AW++Y +YAWG NELRP+SK GHS+++FG  K G +I+D+LDTLFIME+++EF  A EW++  L F++  EVSVFE+ IRF+GGLL+A+  +  EVF  KA+EL   LL AF  S G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS+++GN+ +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D+   KMY  +++A+++S +I  S  G  Y+A+++ G++++KM HL CF GGM ALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK ++LRPE  E+Y Y+WR T D KYR+W ++AV ALE+H  V  G SG+RDVYS   S DDVQQSF +AETLKYLYL+FSED  LP + WVFNTEAHP P+
Sbjct:    1 MMKHAWDSYRRYAWGSNELRPVSKQGHSSNLFGSIK-GATIVDALDTLFIMEMSEEFNAATEWVEKNLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGKEVFRQKAVELGEKLLPAFRTSTGIPWALLNLKSGVGRNWPWASGGSSILAEYGTLHLEFMHLSKLSGNQEFAQKVMNIRKVLNRLDKPQGLYPNYLNPNSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDEEGKKMYYDSLQAIETS-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMIALGADGAPGDKTGHQMELAAEIARTCHESYARTALKLGPEAFRFDGGVEAIATRQNEKYFILRPEVIETYMYMWRFTHDPKYREWGWEAVQALERHCKVEGGYSGVRDVYSSNPSLDDVQQSFFLAETLKYLYLLFSEDDQLPFDHWVFNTEAHPLPV 439          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: si:ch73-373m9.1 (mannosidase alpha class 1C member 1 [Source:NCBI gene;Acc:101155716])

HSP 1 Score: 479.559 bits (1233), Expect = 3.416e-162
Identity = 229/458 (50.00%), Postives = 317/458 (69.21%), Query Frame = 3
Query:  441 GEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSI--YTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPI 1805
            G+P D     RR KVK MMKFAW+NY  YAWG+NELRP++K GH  ++FG  + G SIIDSLDTL+IM L DE+  A EW++  L  +   E S+FE+ IR++GGLL A+  T +E++  KA+EL   LL AF+  +G+P  +IN  +  S ++ WA  G +IL+E GTLH+EF  L+E++ N  Y  KV  IR++L K  KP G+Y N++ P S  W   H S+ GLGDSFYEYL+K Y+ S+K D+ A  MY +A++A++++ ++  S  G  Y+A++R GI+ +KM HLACF GGM  +G+     +    +L +   IT+TCH+SY  +D+KLGPE+F F    EA A +  ++ Y+LRPE  ESY Y+WR+T D KYR+W ++AV ALE++  V +G SGIRDVYS+ VSHD++QQSF ++ETLKYLYL+FS+D LL L  WVFNTEAHP PI
Sbjct:  162 GKPADPKTNERREKVKEMMKFAWDNYKTYAWGKNELRPLTKNGHIGNMFGGLR-GASIIDSLDTLYIMGLMDEYYEAQEWVQNNLDLNSNGEASLFEVNIRYVGGLLAAYYLTGEELYKNKALELGEKLLPAFNTPTGIPRGVINLGSGTSWSWGWASAGSSILAEFGTLHLEFVHLTELSNNPIYTEKVMNIRKLLNKIEKPHGLYPNFLSPVSGNWVQHHVSIGGLGDSFYEYLIKSYLMSDKTDEEAKDMYYSALQAIEAN-LVQKSPGGLTYVAEWRGGILDHKMGHLACFSGGMIGIGADDGEPEKRQHYLDLAAEITHTCHESYTRSDTKLGPEAFRFDSGAEATANRLSDRYYILRPEVIESYMYMWRLTHDPKYREWGWEAVEALERYCRVESGFSGIRDVYSMTVSHDNMQQSFFLSETLKYLYLLFSDDDLLSLEDWVFNTEAHPLPI 617          
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Match: man1a1 (mannosyl-oligosaccharide 1,2-alpha-mannosidase IA [Source:NCBI gene;Acc:101158740])

HSP 1 Score: 458.373 bits (1178), Expect = 2.820e-154
Identity = 217/431 (50.35%), Postives = 299/431 (69.37%), Query Frame = 3
Query:  438 GGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDES-GLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGS--IYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLK 1721
            G EP+D   + RR KVK MMK AW++Y +YAWG NELRP+SK GHS+++FG  K G +I+D+LDTLFIME+++EF  A EW++  L F++  EVSVFE+ IRF+GGLL+A+  +  EVF  KA+EL   LL AF  S G+P+AL+N  +    N+ WA GG +IL+E GTLH+EF  LS+++GN+ +  KV  IR++L + +KPQG+Y NY+ P S  W   H S+ GLGDSFYEYLLK ++ S+K D+   KMY  +++A+++S +I  S  G  Y+A+++ G++++KM HL CF GGM ALG+       +   + +   I  TCH+SY  T  KLGPE+F F   VEA+A +  EK ++LRPE  E+Y Y+WR T D KYR+W ++AV ALE+H  V  G SG+RDVYS   S DDVQQSF +AETLK
Sbjct:  152 GSEPRDPETRERRAKVKEMMKHAWDSYRRYAWGSNELRPVSKQGHSSNLFGSIK-GATIVDALDTLFIMEMSEEFNAATEWVEKNLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGKEVFRQKAVELGEKLLPAFRTSTGIPWALLNLKSGVGRNWPWASGGSSILAEYGTLHLEFMHLSKLSGNQEFAQKVMNIRKVLNRLDKPQGLYPNYLNPNSGQWGQHHVSVGGLGDSFYEYLLKAWLMSDKTDEEGKKMYYDSLQAIETS-LIRKSSGGLTYIAEWKGGLLEHKMGHLTCFAGGMIALGADGAPGDKTGHQMELAAEIARTCHESYARTALKLGPEAFRFDGGVEAIATRQNEKYFILRPEVIETYMYMWRFTHDPKYREWGWEAVQALERHCKVEGGYSGVRDVYSSNPSLDDVQQSFFLAETLK 580          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000006448.1 (SMESG000006448.1)

HSP 1 Score: 1149.81 bits (2973), Expect = 0.000e+0
Identity = 572/572 (100.00%), Postives = 572/572 (100.00%), Query Frame = 3
Query:  108 MTLVILSYRKLSYISDINNVIPKISNPDIQKYKDRESLWETIAKDREXXXXXXXXXXXXXXXEINHLKTILDLKAVKEEEKMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLVHL 1823
            MTLVILSYRKLSYISDINNVIPKISNPDIQKYKDRESLWETIAKDREKDLNLLQNDLLKAKDEINHLKTILDLKAVKEEEKMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLVHL
Sbjct:    1 MTLVILSYRKLSYISDINNVIPKISNPDIQKYKDRESLWETIAKDREKDLNLLQNDLLKAKDEINHLKTILDLKAVKEEEKMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYKAIELANNLLHAFDESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLVHL 572          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000014213.1 (SMESG000014213.1)

HSP 1 Score: 166.392 bits (420), Expect = 6.161e-43
Identity = 152/494 (30.77%), Postives = 224/494 (45.34%), Query Frame = 3
Query:  474 RLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQ--------NKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFI----------------------------FTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAE-GGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILY-KANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKL--------ALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFAL-GSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLN--RWVFNTEAHPFPI 1805
            RLK K M   A+N+Y+KYA+  +EL P+S  G    +               +++IDSLDTLFIM+  +EF+ A + +   + FD    VSVFE+ IR +GGLL A I                            +  DE+ L+ A E+   LL AF+  +G+P+  IN     +   N ++   C   +  GT+ +EFA LS +TGN  +  K  R    L+ + N+   +    I      W    S +    DS+YEYLLK Y+       L        A++ YI+  E   SS  +    K H  +        +N MD L  F  G+  L G I  KN++ +  I          S +       PE+F                 +LLRPE  ES ++L+  T D  Y +     +  LE HA V  G + I+DV    ++H D   SF++AET KYLYL+F+E   LP+N  +++F TE H  P+
Sbjct:   29 RLKSKEMFLHAYNSYMKYAYPADELMPLSCKGRYREVEPTRGDIDDILGNFSLTLIDSLDTLFIMKEFNEFEKAVKLVINNVHFDSNVTVSVFEVNIRIIGGLLGAHIGALELKKYSTGTRNKEKNKLLNDTNHMMWYNDEL-LWMADEVGKKLLPAFNTHTGIPHPRINLKYGTTSGDNLSDVSTCTACA--GTMILEFAALSRLTGNPVFEEKAARAMTYLWEQRNRFSNLMGTVINIHDGNWMRKESGVGAGIDSYYEYLLKAYVLLGDDTYLHRFNTHYAAIQRYISTAEL--SSFPLFLDVKMHQPLQR-----TKNFMDSLLAFWPGLQVLFGDI--KNAIAFHEIL---------SQVMQRHSFLPEAF-------TTDFHVYWGHHLLRPEFIESNYFLYHSTGDTYYLEIGEQVLNNLEMHARVKCGFAAIQDVRI--MNHSDQMDSFVLAETFKYLYLLFAEPDQLPINLDKYLFTTEGHLLPL 492          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000014213.1 (SMESG000014213.1)

HSP 1 Score: 166.392 bits (420), Expect = 7.448e-43
Identity = 152/494 (30.77%), Postives = 224/494 (45.34%), Query Frame = 3
Query:  474 RLKVKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQ--------NKMGISIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFI----------------------------FTKDEVFLYKAIELANNLLHAFD-ESGLPYALINFDNKFSHNYNWAE-GGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILY-KANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIRSNKKDKL--------ALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFAL-GSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLN--RWVFNTEAHPFPI 1805
            RLK K M   A+N+Y+KYA+  +EL P+S  G    +               +++IDSLDTLFIM+  +EF+ A + +   + FD    VSVFE+ IR +GGLL A I                            +  DE+ L+ A E+   LL AF+  +G+P+  IN     +   N ++   C   +  GT+ +EFA LS +TGN  +  K  R    L+ + N+   +    I      W    S +    DS+YEYLLK Y+       L        A++ YI+  E   SS  +    K H  +        +N MD L  F  G+  L G I  KN++ +  I          S +       PE+F                 +LLRPE  ES ++L+  T D  Y +     +  LE HA V  G + I+DV    ++H D   SF++AET KYLYL+F+E   LP+N  +++F TE H  P+
Sbjct:    2 RLKSKEMFLHAYNSYMKYAYPADELMPLSCKGRYREVEPTRGDIDDILGNFSLTLIDSLDTLFIMKEFNEFEKAVKLVINNVHFDSNVTVSVFEVNIRIIGGLLGAHIGALELKKYSTGTRNKEKNKLLNDTNHMMWYNDEL-LWMADEVGKKLLPAFNTHTGIPHPRINLKYGTTSGDNLSDVSTCTACA--GTMILEFAALSRLTGNPVFEEKAARAMTYLWEQRNRFSNLMGTVINIHDGNWMRKESGVGAGIDSYYEYLLKAYVLLGDDTYLHRFNTHYAAIQRYISTAEL--SSFPLFLDVKMHQPLQR-----TKNFMDSLLAFWPGLQVLFGDI--KNAIAFHEIL---------SQVMQRHSFLPEAF-------TTDFHVYWGHHLLRPEFIESNYFLYHSTGDTYYLEIGEQVLNNLEMHARVKCGFAAIQDVRI--MNHSDQMDSFVLAETFKYLYLLFAEPDQLPINLDKYLFTTEGHLLPL 465          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000012919.1 (SMESG000012919.1)

HSP 1 Score: 137.887 bits (346), Expect = 1.701e-37
Identity = 79/178 (44.38%), Postives = 113/178 (63.48%), Query Frame = 3
Query: 1302 MDHLACFVGGMFALGSIYTKNSLEWLTIGINITNTCHDSYMYTDSKLGPESFHFSDSV---EAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVT-NGISGIRDVYSVPVSHDDVQQ-----SFLMAETLKYLYLIFSED-TLLPLNRWVFNTEAHPFPI 1805
            MDHL CFV GM ALG ++  NS   L +   + +TC+  Y    + L PE  +F+ +    E + ++  +K  L RPET ES+FYL+R TK++KY+DW ++   + +K++ V  +G  GI DV +   SH +VQQ     SF  +ETLKY YL+F++D T+LPLNR+VFNTE HP PI
Sbjct:    1 MDHLVCFVPGMLALGVMHGMNSNH-LELAEQLASTCYQMYRRMKTGLSPEIVYFNQNPLEKEDIIVKDYDKFNLQRPETIESFFYLYRATKNKKYQDWGWEIFKSFQKYSKVPWSGYVGISDVSN---SH-NVQQRTKCESFWFSETLKYFYLLFNDDQTILPLNRFVFNTEGHPLPI 173          
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Match: SMESG000061196.1 (SMESG000061196.1)

HSP 1 Score: 138.658 bits (348), Expect = 1.401e-34
Identity = 144/494 (29.15%), Postives = 219/494 (44.33%), Query Frame = 3
Query:  465 KARRLK-VKNMMKFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGI---------SIIDSLDTLFIMELNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFLYK--------------AIELANNLLHAFDE--SGLPYALINFDNKFSHNYNWAEGGCAILSEIGTLHMEFAFLSEITGNKTYINKVTRIREILYK-ANKPQGIYMNYIQPKSHTWCGFHSSLAGLGDSFYEYLLKEYIR-SNKKDKLALKMYIAAIEAVKSSGMIATSKKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTK--NSLEWLTIGINITN------TCHDSYMYT---DSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFYLWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQSFLMAETLKYLYLIFSEDTLLPLN--RWVFNTEAHPFPIRDLVHL 1823
            K+  LK VK+M  F + NY+ +A   +EL PI   G       ++ + I         +++D+LDTL I+    EFK A + I   L F+  T V VFE TIR +G LL+A +   DE  L+               A +LA+ LL AF++  +G+P+  +N         N     C  L+   TL +EF  LS +  +  + N   R    L++  +   G+  N I   +  W    S L    DSFYEYLLK Y+   N K     K++  A+ +V+             YM   R+    N       FV      G I     +SL+    GI   N       C  +Y Y      ++ PE F++         +P    Y LRPE  ES ++L+  TK+  Y     + V  L  +  V  G + + DV +  +S +D  +SF ++ET KYLYL+F E+ ++  N   ++F T+ H   I+ L  L
Sbjct:   23 KSETLKIVKSMFYFGYENYMNFAHPFDELDPIHCKGRGHDYDNRDNININDALGDYQLTLVDTLDTLVIINDIPEFKRAVKIIIDSLHFNQNTTVQVFEATIRIIGSLLSAHLLIIDETKLFGDLKPTGYTNELLMLARDLASRLLSAFEQTNTGIPHPRVNLLTGIP--LNSVNETC--LAGATTLLLEFGVLSRLIQDPVFENVADRTINTLWRLKSNVTGLPGNVINIHTGKWISEMSGLGAGQDSFYEYLLKSYVVFGNLKYN---KLFNEAMGSVR------------YYMRKGRQKCSGNN-GLPPFFVNVQMKNGDIDNHWIDSLQAALPGILTLNGDLDEAICVHAYYYAIWKKFRVLPERFNWYHK------RPDVNFYPLRPEFAESTYFLYMATKNPFYLHVGEEIVSNLNIYTKVKCGYATVHDVLN--MSLEDRMESFFLSETCKYLYLLFDENNMINKNVEDYIFTTQGHILSIKQLRKL 488          
The following BLAST results are available for this feature:
BLAST of alpha-1,2-Mannosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAN1A26.108e-17649.41mannosidase alpha class 1A member 2 [Source:HGNC S... [more]
MAN1A11.324e-16944.41mannosidase alpha class 1A member 1 [Source:HGNC S... [more]
MAN1C11.029e-15048.69mannosidase alpha class 1C member 1 [Source:HGNC S... [more]
MAN1C19.042e-14849.10mannosidase alpha class 1C member 1 [Source:HGNC S... [more]
MAN1C15.905e-12748.72mannosidase alpha class 1C member 1 [Source:HGNC S... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mans-19.962e-14448.29alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
mans-19.962e-14448.29alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
mans-21.578e-14042.07Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52... [more]
mans-21.578e-14042.07Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52... [more]
mans-43.093e-8137.76alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alpha-Man-Ia2.886e-17252.41gene:FBgn0259170 transcript:FBtr0300515[more]
alpha-Man-Ia2.886e-17252.41gene:FBgn0259170 transcript:FBtr0300514[more]
alpha-Man-Ia2.886e-17252.41gene:FBgn0259170 transcript:FBtr0300513[more]
alpha-Man-Ia2.886e-17252.41gene:FBgn0259170 transcript:FBtr0299632[more]
alpha-Man-Ia2.886e-17252.41gene:FBgn0259170 transcript:FBtr0300516[more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man1a21.974e-17148.22mannosidase, alpha, class 1A, member 2 [Source:ZFI... [more]
man1a21.974e-17148.22mannosidase, alpha, class 1A, member 2 [Source:ZFI... [more]
man1a21.974e-17148.22mannosidase, alpha, class 1A, member 2 [Source:ZFI... [more]
man1a11.425e-16950.98mannosidase, alpha, class 1A, member 1 [Source:ZFI... [more]
MAN1C11.578e-13448.85si:ch73-373m9.1 [Source:ZFIN;Acc:ZDB-GENE-110411-1... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmb25.214e-17151.19proteasome subunit beta 2 [Source:Xenbase;Acc:XB-G... [more]
psmb25.370e-17151.19proteasome subunit beta 2 [Source:Xenbase;Acc:XB-G... [more]
psmb27.584e-17151.19proteasome subunit beta 2 [Source:Xenbase;Acc:XB-G... [more]
psmb21.350e-17051.19proteasome subunit beta 2 [Source:Xenbase;Acc:XB-G... [more]
psmb26.488e-16950.98proteasome subunit beta 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Man1a21.680e-17548.81mannosidase, alpha, class 1A, member 2 [Source:MGI... [more]
Man1a4.823e-17152.49mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:10... [more]
Man1a4.823e-17152.49mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:10... [more]
Man1a4.190e-17044.35mannosidase 1, alpha [Source:MGI Symbol;Acc:MGI:10... [more]
Man1c11.906e-15149.22mannosidase, alpha, class 1C, member 1 [Source:MGI... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60476|MA1A2_HUMAN2.933e-17549.41Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB ... [more]
sp|P39098|MA1A2_MOUSE1.175e-17448.81Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB ... [more]
sp|O02773|MA1A1_PIG1.393e-17144.10Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
sp|P53624|MA1A1_DROME2.893e-17152.41Mannosyl-oligosaccharide alpha-1,2-mannosidase IA ... [more]
sp|P45700|MA1A1_MOUSE3.374e-17052.49Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JBY20.000e+046.81alpha-1,2-Mannosidase OS=Macrostomum lignano OX=28... [more]
A0A210Q0640.000e+055.24alpha-1,2-Mannosidase OS=Mizuhopecten yessoensis O... [more]
R7VF660.000e+053.55alpha-1,2-Mannosidase OS=Capitella teleta OX=28390... [more]
G4VP100.000e+046.99alpha-1,2-Mannosidase OS=Schistosoma mansoni OX=61... [more]
A0A2T7P4A21.904e-18054.25alpha-1,2-Mannosidase OS=Pomacea canaliculata OX=4... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man1a11.403e-17148.50mannosidase alpha class 1A member 1 [Source:NCBI g... [more]
man1a21.306e-16550.68mannosidase, alpha, class 1A, member 2 [Source:ZFI... [more]
si:ch73-373m9.18.284e-14749.66mannosidase alpha class 1C member 1 [Source:HGNC S... [more]
man1b1b1.055e-8836.02mannosidase alpha class 1B member 1 [Source:NCBI g... [more]
man1b1a1.896e-8833.67endoplasmic reticulum mannosyl-oligosaccharide 1,2... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man1b1a6.176e-8335.43mannosidase, alpha, class 1B, member 1a [Source:ZF... [more]
ENSPMAT00000004139.19.002e-5741.26pep scaffold:Pmarinus_7.0:GL482877:594:8467:-1 gen... [more]
ENSPMAT00000001013.14.195e-3048.54pep scaffold:Pmarinus_7.0:GL480056:18427:26430:1 g... [more]
ENSPMAT00000006166.12.043e-2827.21pep scaffold:Pmarinus_7.0:GL476535:951795:959705:-... [more]
edem13.631e-2524.69ER degradation enhancer, mannosidase alpha-like 1 ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MNS12.810e-7433.00Alpha-1,2-mannosidase; involved in ER-associated p... [more]
MNL14.890e-2926.25Alpha-1,2-specific exomannosidase of the endoplasm... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388610.000e+053.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305602.787e-5833.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469171.063e-3526.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260748.420e-2245.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369281.160e-1928.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man1a12.048e-17251.63mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
man1a28.778e-16949.89mannosidase alpha class 1A member 2 [Source:NCBI g... [more]
man1a19.599e-16751.70mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
si:ch73-373m9.13.416e-16250.00mannosidase alpha class 1C member 1 [Source:NCBI g... [more]
man1a12.820e-15450.35mannosyl-oligosaccharide 1,2-alpha-mannosidase IA ... [more]
back to top
BLAST of alpha-1,2-Mannosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006448.10.000e+0100.00SMESG000006448.1[more]
SMESG000014213.16.161e-4330.77SMESG000014213.1[more]
SMESG000014213.17.448e-4330.77SMESG000014213.1[more]
SMESG000012919.11.701e-3744.38SMESG000012919.1[more]
SMESG000061196.11.401e-3429.15SMESG000061196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014825 ID=SMED30014825|Name=alpha-1,2-Mannosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1884bp
CATAAAACCTCAATATTTGATATTGATTTATACTAAATAATAATTTCATG
TATCATTTTCGATATTTAAAAAATTTTTCTATTTTAATATCCATCATTAT
AGTCTTTATGACATTAGTCATATTGTCTTACAGAAAACTCTCTTATATTA
GCGATATAAATAATGTAATTCCTAAAATTAGCAATCCTGATATTCAGAAA
TACAAAGACAGAGAAAGTCTTTGGGAAACAATTGCCAAAGACAGAGAAAA
GGATTTGAATTTATTACAAAATGATTTGTTAAAAGCTAAAGATGAAATAA
ATCATCTAAAAACTATTCTAGATTTAAAAGCTGTAAAAGAAGAAGAAAAG
ATGCAAATAATACAATTAGAAAAAACATTGGAACGCCTTAAAAATGTCCA
AGGTAAAAATGGCTCTATCTCGTTGTCTGAAATTCAAGGAGGAGAACCAA
AAGATGAGATTAACAAAGCTCGAAGATTGAAAGTCAAAAACATGATGAAA
TTTGCTTGGAATAATTATGTAAAGTATGCTTGGGGAGAAAACGAATTACG
ACCGATTTCTAAAATCGGCCATTCTGCATCAATTTTTGGACAAAATAAAA
TGGGAATTTCTATAATCGATAGTCTTGATACATTATTCATTATGGAATTA
AATGATGAATTTAAAGTAGCAGCGGAATGGATAAAAACCAAGCTAAAATT
CGATTTGAAAACTGAAGTTTCAGTTTTCGAAATGACTATTCGATTTTTGG
GAGGTCTTTTAACGGCATTTATATTCACAAAAGATGAAGTATTTCTTTAC
AAAGCAATAGAGCTAGCTAACAATTTATTGCATGCATTCGATGAATCCGG
CTTACCATACGCACTAATTAACTTTGACAACAAGTTTAGTCATAATTACA
ATTGGGCTGAAGGTGGATGTGCAATTCTATCAGAAATAGGAACTCTCCAC
ATGGAATTTGCTTTTCTTAGTGAAATTACTGGAAATAAAACTTATATAAA
TAAAGTGACTAGAATTCGTGAAATTCTATACAAAGCCAATAAACCACAAG
GAATATATATGAATTACATACAGCCAAAAAGCCATACCTGGTGTGGGTTT
CACTCGAGTCTGGCTGGTCTAGGTGACTCATTCTATGAATACCTTTTGAA
AGAATATATCAGAAGTAATAAAAAGGACAAACTTGCATTGAAAATGTACA
TTGCTGCTATTGAAGCCGTCAAATCATCGGGTATGATAGCTACAAGTAAA
AAGGGGCACATGTATATGGCAGATTTCAGAAGGGGGATCGTTCAAAATAA
GATGGATCATCTAGCATGTTTTGTCGGTGGAATGTTTGCTTTGGGTTCTA
TTTATACCAAAAACTCCTTGGAATGGTTGACTATTGGTATTAATATTACA
AACACTTGCCATGACAGCTACATGTACACTGACTCAAAATTGGGCCCGGA
ATCATTTCATTTCAGTGACAGTGTTGAAGCTGTTGCGATACAACCCCAAG
AAAAAATATATTTATTGCGCCCTGAGACTTTTGAAAGTTATTTCTATTTA
TGGCGAATTACAAAAGATCAAAAATATCGAGATTGGGCTTATGATGCTGT
TTTGGCTCTAGAGAAACATGCAATGGTGACAAATGGAATCTCAGGAATTA
GAGATGTTTATTCAGTTCCTGTTTCGCATGATGATGTGCAACAAAGCTTT
TTAATGGCTGAGACTTTGAAATATTTATATTTGATTTTTTCTGAAGATAC
TCTTCTACCTTTAAATAGGTGGGTTTTCAATACTGAAGCCCACCCCTTCC
CTATTCGTGATTTGGTGCATTTGTAATTTCAAATAAGTTCGGTTTTTATT
ATCAAAATTAAAATATTTTTATTACAACATTTGG
back to top

protein sequence of SMED30014825-orf-1

>SMED30014825-orf-1 ID=SMED30014825-orf-1|Name=SMED30014825-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MYHFRYLKNFSILISIIIVFMTLVILSYRKLSYISDINNVIPKISNPDIQ
KYKDRESLWETIAKDREKDLNLLQNDLLKAKDEINHLKTILDLKAVKEEE
KMQIIQLEKTLERLKNVQGKNGSISLSEIQGGEPKDEINKARRLKVKNMM
KFAWNNYVKYAWGENELRPISKIGHSASIFGQNKMGISIIDSLDTLFIME
LNDEFKVAAEWIKTKLKFDLKTEVSVFEMTIRFLGGLLTAFIFTKDEVFL
YKAIELANNLLHAFDESGLPYALINFDNKFSHNYNWAEGGCAILSEIGTL
HMEFAFLSEITGNKTYINKVTRIREILYKANKPQGIYMNYIQPKSHTWCG
FHSSLAGLGDSFYEYLLKEYIRSNKKDKLALKMYIAAIEAVKSSGMIATS
KKGHMYMADFRRGIVQNKMDHLACFVGGMFALGSIYTKNSLEWLTIGINI
TNTCHDSYMYTDSKLGPESFHFSDSVEAVAIQPQEKIYLLRPETFESYFY
LWRITKDQKYRDWAYDAVLALEKHAMVTNGISGIRDVYSVPVSHDDVQQS
FLMAETLKYLYLIFSEDTLLPLNRWVFNTEAHPFPIRDLVHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0005509calcium ion binding
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR0123416hp_glycosidase-like_sf
IPR036026Seven-hairpin_glycosidases
IPR001382Glyco_hydro_47
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 63..117
NoneNo IPR availablePANTHERPTHR11742MANNOSYL-OLIGOSACCHARIDE ALPHA-1,2-MANNOSIDASE-RELATEDcoord: 51..586
NoneNo IPR availablePANTHERPTHR11742:SF31MANNOSYL-OLIGOSACCHARIDE 1,2-ALPHA-MANNOSIDASE IAcoord: 51..586
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR001382Glycoside hydrolase family 47PRINTSPR00747GLYHDRLASE47coord: 418..434
score: 57.7
coord: 223..241
score: 64.16
coord: 261..280
score: 26.19
coord: 356..373
score: 56.88
coord: 489..513
score: 57.52
coord: 149..169
score: 55.33
coord: 186..200
score: 54.6
coord: 550..570
score: 64.4
IPR001382Glycoside hydrolase family 47PFAMPF01532Glyco_hydro_47coord: 149..586
e-value: 3.4E-137
score: 458.1
IPR012341Six-hairpin glycosidase-like superfamilyGENE3DG3DSA:1.50.10.10coord: 125..591
e-value: 5.2E-171
score: 571.4
IPR036026Seven-hairpin glycosidasesSUPERFAMILYSSF48225Seven-hairpin glycosidasescoord: 135..586