Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative

Overview
NameCentrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative
Smed IDSMED30014820
Length (bp)1693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative (SMED30014820) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative (SMED30014820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative (SMED30014820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative (SMED30014820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014820h1SMcG0015401 SmedASXL_004419SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014820h1SMcG0015401 Contig11108newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014820h1SMcG0015401 Contig11108uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014820h1SMcG0015401 Contig48402uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014820h1SMcG0015401 Contig48402newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
non-ciliated neuronSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014820h1SMcG0015401 dd_Smed_v6_11072_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30014820h1SMcG0015401 Contig11108newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014820h1SMcG0015401 Contig11108uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014820h1SMcG0015401 Contig48402uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014820h1SMcG0015401 Contig48402newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30014820h1SMcG0015401 dd_Smed_v4_11072_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Match: A0A1S3H9T4 (paramyosin isoform X2 OS=Lingula unguis OX=7574 GN=LOC106152721 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.949e-58
Identity = 141/415 (33.98%), Postives = 263/415 (63.37%), Query Frame = 1
Query:  184 LEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALK 1428
            +E+EYIK+LQQQ+Y LELE N+LR+Q  KAT++ P M+AEAE+ML  L+ LQ++V+ L +E  RKEG + +L+ +  +  + L  E  K+ R+K+++M E +  KKD +    E  RK+  +   + D+      L +AE KI++LR QL +++ + + T++ L EK++E+L+  +  RELE+ + +++   ++   ++LRDE+  L++KLK+T  + ++++ LK+KLS+D+S L+KEN+++N+Q++ELQ  +++ER LRE  D R    + E    ++RE +L+ ++   + +L  E+ RV    D+++ Q    +S  +  +  + RL +      +  +EN +L++DK  L ++  +LQ +L++KE EI   +  +  +  ++ +LE++K++D   QS++W E E   D+++
Sbjct:   71 IESEYIKNLQQQVYFLELEANYLREQARKATDMHPQMTAEAERMLGKLRHLQEEVDGLNIENRRKEGDIGMLSVEKTRALETLSAEEAKFNREKRLLMDEIVQLKKDNEMMSLENIRKDTELSNARSDVESTRHALRNAEGKIDLLRNQLDQRIEQHKITQLALEEKRAEVLRTETNLRELEDKYYSSTVQLKDKAMQDLRDEIRMLRQKLKETEMMADQDRFLKNKLSDDSSHLVKENALINQQVLELQKQLDRERELREATDTRRSVNAVELAASKDRESKLQFELNNTKEQLRQEQDRVRHYMDQLSAQGSTLTSTELNASSTRSRLVELESVHRSTEDENAQLRRDKALLTDHTADLQRQLQEKEAEILRLHASVTSLGQQLNELEHIKNIDSAYQSRKWQEFEQLADSMR 485          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Match: A0A267EBS8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013940g2 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.804e-57
Identity = 155/431 (35.96%), Postives = 257/431 (59.63%), Query Frame = 1
Query:  148 SFNTASTDSTTVLEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELE-ESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQA 1437
            SF  +   ST  LE EYIKSLQQQ+YLLELENNHLR Q +KATE+ P M+AEAEKML  LK LQ KV++L+LE FRKEG  ++L+ K+  LT++L      +  +++    ++   +++ D ++R++ R  + + EL++D     S+L ++E K+  LR QL+  + K    +  L+E++++  ++ ++ R LE E  +TN+   + NI RELRDE + LKE+L+       +E  L+ K  E+ S L+K+N+ L ++++EL+  IE ER    ++      ESDE  R+REREK LE ++     E+   R +V +LT ++ +  +   +  I+  V ++RL +      ++ ++  +L++DK  L+ +VD+LQ EL K+E E +     +   E R+ +L+   +    +Q+ RW E+E   D L+S A
Sbjct:   60 SFADSIRTSTGALEQEYIKSLQQQVYLLELENNHLRSQAVKATELHPTMAAEAEKMLRELKALQAKVDALQLENFRKEGAAEVLHQKVNGLTQKLAQYEASHSEERERFDKDSAEARRERDMYQRDVGRLQMRLGELQEDFDHKLSDLKASETKVATLRGQLEAALDKLAAADSALTEERAQTARLEARVRVLEVELASTNTKGLERNI-RELRDENLALKERLRREQSKAHEETLLRSKTFEETSALVKQNAALEQKVVELERQIEAERDKSHQWAGHASVESDELVRLREREKTLEYQVSSGVEEVAKLRLKVQQLTQQLNEASETKDAGTIDLTVARRRLEEAENSQASLSDQLSRLQRDKAELVAHVDSLQQELMKRESEKDGLARALDRAELRLNELQGEVTRLQQLQATRWSEVEKMADTLRSAA 489          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Match: A0A1I8J735 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013940g1 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 2.242e-57
Identity = 155/431 (35.96%), Postives = 256/431 (59.40%), Query Frame = 1
Query:  148 SFNTASTDSTTVLEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELE-ESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQA 1437
            SF  +   ST  LE EYIKSLQQQ+YLLELENNHLR Q +KATE+ P M+AEAEKML  LK LQ KV++L+LE FRKEG  ++L  K+  LT++L      +  +++    ++   +++ D ++R++ R  + + EL++D     S+L ++E K+  LR QL+  + K    +  L+E++++  ++ ++ R LE E  +TN+   + NI RELRDE + LKE+L+       +E  L+ K  E+ S L+K+N+ L ++++EL+  IE ER    ++      ESDE  R+REREK LE ++     E+   R +V +LT ++ +  +   +  I+  V ++RL +      ++ ++  +L++DK  L+ +VD+LQ EL K+E E +     +   E R+ +L+   +    +Q+ RW E+E   D L+S A
Sbjct:   60 SFADSIRTSTGALEQEYIKSLQQQVYLLELENNHLRSQAVKATELHPTMAAEAEKMLRELKALQAKVDALQLENFRKEGAAEVLQQKVNGLTQKLTQYEASHSEERERFDKDSAEARRERDMYQRDVGRLQMRLGELQEDFDHKLSDLKASETKVATLRGQLEAALDKLAAADSALTEERAQTARLEARVRVLEVELASTNTKGLERNI-RELRDENLALKERLRREQSKAHEETLLRSKTFEETSALVKQNAALEQKVVELERQIEAERDKSHQWAGHASVESDELVRLREREKTLEYQVSSGVEEVAKLRLKVQQLTQQLNEASETKDAGTIDLTVARRRLQEAENSQASLSDQLSRLQRDKAELVAHVDSLQQELMKRESEKDGLARALDRAELRLNELQGEVTRLQQLQATRWSEVEKMADTLRSAA 489          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Match: A0A1I8GG80 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.566e-57
Identity = 155/431 (35.96%), Postives = 256/431 (59.40%), Query Frame = 1
Query:  148 SFNTASTDSTTVLEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELE-ESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQA 1437
            SF  +   ST  LE EYIKSLQQQ+YLLELENNHLR Q +KATE+ P M+AEAEKML  LK LQ KV++L+LE FRKEG  ++L  K+  LT++L      +  +++    ++   +++ D ++R++ R  + + EL++D     S+L ++E K+  LR QL+  + K    +  L+E++++  ++ ++ R LE E  +TN+   + NI RELRDE + LKE+L+       +E  L+ K  E+ S L+K+N+ L ++++EL+  IE ER    ++      ESDE  R+REREK LE ++     E+   R +V +LT ++ +  +   +  I+  V ++RL +      ++ ++  +L++DK  L+ +VD+LQ EL K+E E +     +   E R+ +L+   +    +Q+ RW E+E   D L+S A
Sbjct:   60 SFADSIRTSTGALEQEYIKSLQQQVYLLELENNHLRSQAVKATELHPTMAAEAEKMLRELKALQAKVDALQLENFRKEGAAEVLQQKVNGLTQKLAQYEASHSEERERFDKDSAEARRERDMYQRDVGRLQMRLGELQEDFDHKLSDLKASETKVATLRGQLEAALDKLAAADSALTEERAQTARLEARVRVLEVELASTNTKGLERNI-RELRDENLALKERLRREQSKAHEETLLRSKTFEETSALVKQNAALEQKVVELERQIEAERDKSHQWAGHASVESDELVRLREREKTLEYQVSSGVEEVAKLRLKVQQLTQQLNEASETKDAGTIDLTVARRRLQEAENSQASLSDQLSRLQRDKAELVAHVDSLQQELMKRESEKDGLARALDRAELRLNELQGEVTRLQQLQATRWSEVEKMADTLRSAA 489          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Match: A0A2C9LY91 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106058911 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.949e-57
Identity = 151/420 (35.95%), Postives = 267/420 (63.57%), Query Frame = 1
Query:  184 LEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSD-DNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXI---NSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKS 1431
            +EAEYIK+LQQQIY LELE+N+LR+Q  KATE+ P M+ EAEKML  L+ +Q +++++++E+ RKE  + +  S+  +L ++L HE D + R+K+++  E I  KKD D  +REL  K+  + E K ++ R++  L +AE KI  L+AQL++++ +   T++ L EK++++L   ++ RE EE + +++   ++ + ++LRDE+  L +K+K+T    EK++ L+ K+SE+ S L++ENS LN++++EL   +E+E+ LRE  D+RH Q   E        K+   +I +L+ EL +E+ R  +  +++  ++  +    ++ N  K RL++ D +R++ +  ENE+LK+DK  L+++V  +Q +L+ K+++I    SS G + E +FR   L+    +D   Q  RW E     D++KS
Sbjct:  124 IEAEYIKNLQQQIYFLELESNYLREQARKATEMHPQMTHEAEKMLQKLREMQTQIDNMDMEMKRKESSIGIHTSEKERLQEQLQHEKDNHLREKRLLTDELITMKKDKDRLQRELAHKDEQLLEAKSEIDRSALALKNAELKINTLKAQLEQRIEQHNLTQLALEEKRTQLLSTETQLRETEEKYYSSTVTIKDKLTQDLRDEIRLLHQKVKETELSAEKDRFLRDKISEEMSSLVQENSALNQRVMELTKQLEREKELRETTDHRHKQSIGEV----VSLKDRLQEIDRLRDELRLEKERSRQYLEQLTNEESTHKRTDLQINTLKSRLTESDGMRSV-MEAENEQLKKDKVLLVDHVAEMQRKLEDKDRDIYMLKSSVGEL-ETKFRSLGLQKTVEVDQ--QRLRWEEFSRLADSMKS 535          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Nematostella
Match: EDO46278 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQF2])

HSP 1 Score: 88.9669 bits (219), Expect = 3.768e-19
Identity = 110/432 (25.46%), Postives = 214/432 (49.54%), Query Frame = 1
Query:  160 ASTDSTTVLEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLE-----ENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQAR 1440
            +ST     +E EYI++LQQQ+Y LELE N+L           P                      L +EL R+E  + +L ++     KR+    +++  +K+ ++ E ++ KK  D  ER+  RK +  ++ K +  +  ++L  AE +I+  RA+L  +        +EL EK++E L++ ++ +E+++ +  +    +E + RELR                          + +D + LIKEN+ L  Q++ELQ  I+ +R+ R++ D R H    E    +E EK+L+ ++ K +  L +E++ +    D+++++++      +E N+ + +L ++ +  + +L+     EN  L +DK  L + V +L+  L +K+ E++S    ++E E R AQLE    +   ++S +W E E     +K+ +R
Sbjct:    3 SSTADMGNIENEYIRNLQQQVYFLELEANYL----------YP----------------------LTIELSRRESKILMLEAEKDTAIKRMRDSEEEHAAEKRQLVNEIVSLKKLRDMSERDSTRKVLQAQQFKAEAEKGLTSLQDAERRIQNYRAELDRKSEDFNSLRIELEEKRAECLRLKTQLQEMDDRYFDSQAKTKEQLSRELR--------------------------VQDDCTALIKENAALAAQVVELQKHIDMDRAHRDEKDVRRHANIQELISTKENEKQLKTELEKTRELLRLEQSALRDALDKLSREEQA----SLEANLRRTQLRNE-LSEVELLQDSTANENVSLNRDKLLLSDEVTSLRARLDEKDDELDSMRLRLEEAEARNAQLEGKVRMQRNLESIKWEEFEKLATTMKAFSR 371          
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Planmine SMEST
Match: SMESG000052451.1 (SMESG000052451.1)

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 1
Query:  292 MSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNXXXXXXXXXXXXXXXXQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIXXXXXXXXINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQARXXXXXXXXIDDQNKSEKLKWNIPS 1512
            MSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNRIREREKELEIKIRKLQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIELKKKEKEINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQARQMSSMSQSIDDQNKSEKLKWNIPS
Sbjct:    1 MSAEAEKMLDNLKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVMMGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLRAQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIKRELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLIELQSLIEQERSLREKFDNRHHQESDEYNRIREREKELEIKIRKLQSELEIERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKLKQDKDNLIEYVDNLQIELKKKEKEINSSYGLMKEMEFRVAQLENLKSLDDVIQSKRWGELEHTIDALKSQARQMSSMSQSIDDQNKSEKLKWNIPS 407          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H9T41.949e-5833.98paramyosin isoform X2 OS=Lingula unguis OX=7574 GN... [more]
A0A267EBS81.804e-5735.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J7352.242e-5735.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GG802.566e-5735.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9LY915.949e-5735.95Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462783.768e-1925.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052451.10.000e+0100.00SMESG000052451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014820 ID=SMED30014820|Name=Centrosomal protein of 135 kDa (Cep135 protein) (Centrosomal protein 4), putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1693bp
TTATAGTCACCCGCGGATTTTAAAATGGCTCAAACAGCAAAAAGATTAAG
TTTTAAAAAAACTCCTTCCTTTTCGAAATCTGAACCTAAACCGCCTACTA
TCAATTCGAATCTATCTTCATCAATAAATGATTTACGAAGTCGCAAAAGT
TTTAACACAGCATCAACGGATTCAACTACGGTTTTAGAAGCTGAATATAT
CAAAAGTTTACAGCAACAAATCTATTTACTAGAATTAGAAAACAATCATC
TGCGTCAGCAAACATTGAAAGCCACTGAAATCCAACCGATCATGTCGGCA
GAAGCGGAAAAGATGTTGGATAATTTAAAGATCCTACAGAAAAAGGTCAA
TAGTTTGGAATTAGAATTATTTCGCAAAGAAGGACACGTGGATTTGTTGA
ATTCGAAAATAATACAATTAACAAAGCGACTCGACCACGAAACCGATAAA
TATGGACGAGATAAACAGGTAATGATGGGAGAAACTATAAATACAAAAAA
AGACCTCGATAACTTTGAAAGAGAATTAAATCGAAAAAATATTCTCATTA
AAGAACTGAAAGACGATTTGCATAGAAATTCATCGAATCTCCATTCGGCA
GAAAATAAAATTGAAATGCTCAGAGCACAATTGCAAGAACAAATGATGAA
AGCCAGGGAAACTGAGATGGAATTGTCGGAGAAGAAATCCGAAATGCTTA
AAGTCAATTCAAAATTTCGTGAACTCGAGGAAAGCTTTACGACTAACAGT
AATAATTTTCAAGAAAATATCAAGCGGGAATTGAGGGACGAAGTAATGTT
TTTGAAAGAGAAGTTAAAGGATACAATGGAACTGGTAGAAAAAGAACAAA
ATTTGAAGCATAAATTGTCGGAAGATGCGAGTAAATTGATCAAAGAAAAT
TCTATTCTTAACAGACAATTAATTGAGCTGCAATCTTTAATTGAACAAGA
AAGGAGTTTGAGGGAAAAGTTTGACAATCGACATCACCAAGAATCTGACG
AATACAATAGAATACGTGAAAGAGAAAAAGAATTGGAAATAAAAATTCGA
AAACTGCAGAGTGAATTAGAAATTGAGAGAGCTAGAGTGTCAAGATTAAC
TGATGAAATAGCTAAACAAGACAAAGTTTATAGTAGTCGAGTAATAGAGG
ATAATGTGAATAAAAAAAGATTGTCCGATGACAACATAAGAACGATTGCT
GTATTGGAAGAAAATGAGAAACTCAAACAAGATAAAGACAATCTTATAGA
ATACGTGGATAATCTCCAGATCGAACTGAAGAAAAAAGAAAAAGAAATCA
ACAGTTCGTACGGGCTTATGAAAGAAATGGAGTTTAGAGTAGCTCAGTTG
GAAAATTTGAAATCTCTCGATGATGTCATCCAGTCGAAACGCTGGGGAGA
ACTGGAGCACACTATTGACGCCCTTAAGTCTCAAGCACGACAAATGTCAT
CTATGTCACAGTCTATAGACGATCAAAACAAATCTGAGAAATTAAAATGG
AACATTCCGAGTTGATGACCATTTTGAAGCTTTACAATGATGAACTATCG
CGCGGAACAATCAGTATTTTGTGCTGTATATCAATCAATACATATCTTTA
TATATTATCTGGAACTAAATTCATTTTTAAGGAGATTTTATTTTAGGCAA
ATATTTGTTTGTCAATTTGTCGCTATTATTATTATTATTATTA
back to top

protein sequence of SMED30014820-orf-1

>SMED30014820-orf-1 ID=SMED30014820-orf-1|Name=SMED30014820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=497bp
MAQTAKRLSFKKTPSFSKSEPKPPTINSNLSSSINDLRSRKSFNTASTDS
TTVLEAEYIKSLQQQIYLLELENNHLRQQTLKATEIQPIMSAEAEKMLDN
LKILQKKVNSLELELFRKEGHVDLLNSKIIQLTKRLDHETDKYGRDKQVM
MGETINTKKDLDNFERELNRKNILIKELKDDLHRNSSNLHSAENKIEMLR
AQLQEQMMKARETEMELSEKKSEMLKVNSKFRELEESFTTNSNNFQENIK
RELRDEVMFLKEKLKDTMELVEKEQNLKHKLSEDASKLIKENSILNRQLI
ELQSLIEQERSLREKFDNRHHQESDEYNRIREREKELEIKIRKLQSELEI
ERARVSRLTDEIAKQDKVYSSRVIEDNVNKKRLSDDNIRTIAVLEENEKL
KQDKDNLIEYVDNLQIELKKKEKEINSSYGLMKEMEFRVAQLENLKSLDD
VIQSKRWGELEHTIDALKSQARQMSSMSQSIDDQNKSEKLKWNIPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ