Y box protein-1

Overview
NameY box protein-1
Smed IDSMED30014813
Length (bp)625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Y box protein-1 (SMED30014813) t-SNE clustered cells

Violin plots show distribution of expression levels for Y box protein-1 (SMED30014813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Y box protein-1 (SMED30014813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Y box protein-1 (SMED30014813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014813SMESG000058013.1 SmedASXL_009658SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014813SMESG000058013.1 SmedASXL_009658SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014813SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014813SMESG000058039.1 Contig7331newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014813SMESG000058039.1 Contig7331uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30014813SMESG000058043.1 SMED30004532smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30014813SMESG000058043.1 SMED30004532smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30014813SMESG000058043.1 SMESG000058013.1 dd_Smed_v6_35_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014813SMESG000058043.1 SMESG000058013.1 dd_Smed_v6_35_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014813SMESG000058039.1 SMED30014813smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014813SMESG000058039.1 SMED_04459_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014813SMESG000058039.1 SMED_04459_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014813SMESG000058039.1 SmWIOct06_008397GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 81.2629 bits (199), Expect = 1.120e-17
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   42 QVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            QV+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   93 QVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGP-GGVPVKGSRY 173          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 81.2629 bits (199), Expect = 1.120e-17
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   42 QVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            QV+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   93 QVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGP-GGVPVKGSRY 173          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX1 (Y-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:8014])

HSP 1 Score: 79.337 bits (194), Expect = 3.935e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   57 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 138          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 77.7962 bits (190), Expect = 1.336e-16
Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V+G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP+G  V G
Sbjct:   89 TKVLGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEG 167          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 78.1814 bits (191), Expect = 1.822e-16
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP+G  V G
Sbjct:   89 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEG 167          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-1 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62213])

HSP 1 Score: 84.3445 bits (207), Expect = 4.521e-20
Identity = 45/81 (55.56%), Postives = 57/81 (70.37%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V G VKWFN KNGYGFI+  +   ++D+FVH  +I   N      SL D EEV+FDIVEG+KGLEA +VTGP+GG V G
Sbjct:   19 TKVKGTVKWFNVKNGYGFINRTD--TNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQG 97          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-2 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91306])

HSP 1 Score: 73.559 bits (179), Expect = 1.251e-15
Identity = 39/81 (48.15%), Postives = 52/81 (64.20%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNA-----TSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGG 272
            + G VKW++    YGFIS ++   +KD+FVH  +IA +        +L D EEVLFD+VEG  G EA NVTGPNG +V+G 
Sbjct:   66 LQGKVKWYSVLRRYGFISRND--GEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGS 144          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 69.3218 bits (168), Expect = 5.539e-14
Identity = 38/81 (46.91%), Postives = 51/81 (62.96%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCD-KDVFVHFKSIAATNA-----TSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            V GHVKWF+ +  YGF++ D    + +D FVH  +I  ++       +L D E V+FDIVEG KG EA NVTGP+G +V G
Sbjct:   89 VKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRG 169          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 69.3218 bits (168), Expect = 5.539e-14
Identity = 38/81 (46.91%), Postives = 51/81 (62.96%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCD-KDVFVHFKSIAATNA-----TSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            V GHVKWF+ +  YGF++ D    + +D FVH  +I  ++       +L D E V+FDIVEG KG EA NVTGP+G +V G
Sbjct:   89 VKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRG 169          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 68.1662 bits (165), Expect = 1.102e-13
Identity = 41/86 (47.67%), Postives = 51/86 (59.30%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCD--KDVFVHFKSIAATNA-----TSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ 287
            G VKW++    YGFIS    R D  KDVFVH  +I+ ++       +LAD EEVLFD+V+G  G EA NVTGP G +V G     Q
Sbjct:   66 GKVKWYSVLRRYGFIS----RSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKYRHQ 147          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0076027)

HSP 1 Score: 76.2554 bits (186), Expect = 3.172e-16
Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 3
Query:   18 TNSIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            T  ++A ++V G VKWFN K+GYGFI+ ++ R  +DVFVH  +IA  N      S+ DGE V FD+V G KG EA NVTGP+ G+ V G+Q+
Sbjct:   54 TKEVIA-TKVTGTVKWFNVKSGYGFINRNDTR--EDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPS-GEPVRGSQF 141          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0305992)

HSP 1 Score: 76.2554 bits (186), Expect = 3.268e-16
Identity = 46/92 (50.00%), Postives = 62/92 (67.39%), Query Frame = 3
Query:   18 TNSIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            T  ++A ++V G VKWFN K+GYGFI+ ++ R  +DVFVH  +IA  N      S+ DGE V FD+V G KG EA NVTGP+ G+ V G+Q+
Sbjct:   54 TKEVIA-TKVTGTVKWFNVKSGYGFINRNDTR--EDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPS-GEPVRGSQF 141          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: lin-28 (gene:FBgn0035626 transcript:FBtr0077090)

HSP 1 Score: 52.373 bits (124), Expect = 2.853e-8
Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 3
Query:   48 VGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            +G  KWFN   G+GF++ ++    ++VFVH   I  +   SL + EEV F+    ++GLEA  V+  +GG   G
Sbjct:   40 LGKCKWFNVAKGWGFLTPNDG--GQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQG 111          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 80.1073 bits (196), Expect = 1.539e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   37 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 118          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 80.1073 bits (196), Expect = 1.539e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   37 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 118          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 79.7221 bits (195), Expect = 2.039e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   37 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 118          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: LIN28A (si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-110914-157])

HSP 1 Score: 58.151 bits (139), Expect = 3.402e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 3
Query:   48 VGHVKWFNSKNGYGFISVDNE-----RCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            VG  KWFN + G+GF+S++           DVFVH   +      SL +GE V F   + +KGLE+  VTGP G   VG
Sbjct:   27 VGVCKWFNVRMGFGFLSMNTRDGVPLETPVDVFVHQSKLHMEGFRSLKEGESVEFTFKKSSKGLESVRVTGPGGAHCVG 105          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: LIN28A (si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-110914-157])

HSP 1 Score: 57.7658 bits (138), Expect = 3.695e-10
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 3
Query:   48 VGHVKWFNSKNGYGFISVDNE-----RCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            VG  KWFN + G+GF+S++           DVFVH   +      SL +GE V F   + +KGLE+  VTGP G   VG
Sbjct:   25 VGVCKWFNVRMGFGFLSMNTRDGVPLETPVDVFVHQSKLHMEGFRSLKEGESVEFTFKKSSKGLESVRVTGPGGAHCVG 103          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 79.7221 bits (195), Expect = 2.547e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   35 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 116          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 78.1814 bits (191), Expect = 8.419e-17
Identity = 44/85 (51.76%), Postives = 58/85 (68.24%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   43 TKVLGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 124          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:NCBI gene;Acc:548572])

HSP 1 Score: 75.485 bits (184), Expect = 4.084e-16
Identity = 41/81 (50.62%), Postives = 51/81 (62.96%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+V G KG EA NVTGP G  V G
Sbjct:   34 TKVQGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQG 112          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 60.077 bits (144), Expect = 1.672e-10
Identity = 31/78 (39.74%), Postives = 41/78 (52.56%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            GH KWFN + G+GFIS+ +          DVFVH   +      SL +GE V F   + +KG E+  VTGP G   +G
Sbjct:   35 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLG 112          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 60.077 bits (144), Expect = 1.816e-10
Identity = 31/78 (39.74%), Postives = 41/78 (52.56%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            GH KWFN + G+GFIS+ +          DVFVH   +      SL +GE V F   + +KG E+  VTGP G   +G
Sbjct:   59 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLG 136          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 80.4925 bits (197), Expect = 6.548e-18
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   42 QVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            QV+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   17 QVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVKGSRY 97          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 81.2629 bits (199), Expect = 8.281e-18
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   42 QVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            QV+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   94 QVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVKGSRY 174          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx1 (Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146])

HSP 1 Score: 79.7221 bits (195), Expect = 2.473e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   55 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 136          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 78.5666 bits (192), Expect = 4.974e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP+G  V G
Sbjct:   81 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEG 159          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 78.5666 bits (192), Expect = 6.764e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP+G  V G
Sbjct:   81 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEG 159          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P41824|YBOXH_APLCA (Y-box factor homolog OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 6.699e-18
Identity = 45/81 (55.56%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            SQV G VKWFN K+GYGFI+ D+    +DVFVH  +I   N      S+ DGE+V FD+VEG KG EA NVTGP G +V G
Sbjct:   31 SQVSGTVKWFNVKSGYGFINRDD--TKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQG 109          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|Q9Y2T7|YBOX2_HUMAN (Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.378e-17
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query:   42 QVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            QV+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   93 QVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGP-GGVPVKGSRY 173          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P45441|YBX2B_XENLA (Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.112e-16
Identity = 45/91 (49.45%), Postives = 59/91 (64.84%), Query Frame = 3
Query:   21 NSIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            N  +  +QV G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G+++
Sbjct:   34 NKKLLATQVQGTVKWFNVRNGYGFINRNDSK--EDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVKGSRF 121          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|B5DE31|YBOX1_DANRE (Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.162e-16
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   37 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 118          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P62961|YBOX1_RAT (Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3)

HSP 1 Score: 79.7221 bits (195), Expect = 1.730e-16
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   55 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 136          
BLAST of Y box protein-1 vs. TrEMBL
Match: I1ZIB0 (Y box protein-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.081e-40
Identity = 68/86 (79.07%), Postives = 74/86 (86.05%), Query Frame = 3
Query:   27 IMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYE 284
            IM  SQV GHVKWF+SKNGYGFISVD++   KD+FVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGPNGGDV+GG  YE
Sbjct:   17 IMTASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYE 102          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A3M7PA90 (Y-box factor-like protein OS=Brachionus plicatilis OX=10195 GN=BpHYR1_037785 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.110e-18
Identity = 47/94 (50.00%), Postives = 62/94 (65.96%), Query Frame = 3
Query:   12 KFTNSIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            K     +   +V G VKWFN KNGYGFIS+D+   ++D+F+H   IA  N      S+ +GE+V FDIV+G KGLEA N+TGPN GD V G++Y
Sbjct:   26 KIVQKPLIDQKVTGTVKWFNVKNGYGFISLDDR--EEDIFIHHSGIARNNPKKQQKSVGEGEKVEFDIVQGEKGLEAANLTGPN-GDPVQGSKY 116          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A565DLG5 (Cold shock protein (Fragment) OS=Echiniscoides sigismundi OX=500494 GN=CSP PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.236e-18
Identity = 44/82 (53.66%), Postives = 56/82 (68.29%), Query Frame = 3
Query:   36 QSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAA----TNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++QV G VKWFN++ G+GFI  D      D+FVH  +I A    T   +LADGE+V FD+V+G KGLEA NVTGPNG +V G
Sbjct:   12 ETQVNGSVKWFNAQKGFGFIVRDGSDNGDDIFVHHSAIKAVDPNTTYRTLADGEQVTFDVVQGNKGLEAANVTGPNGNNVQG 93          
BLAST of Y box protein-1 vs. TrEMBL
Match: G0MVG4 (CBN-CEY-1 protein OS=Caenorhabditis brenneri OX=135651 GN=Cbn-cey-1 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.997e-18
Identity = 48/88 (54.55%), Postives = 59/88 (67.05%), Query Frame = 3
Query:   18 TNSIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            T   +  ++V G VKWFN KNGYGFI+  +   ++D+FVH  +I   N      SL D EEVLFDIVEG+KGLEA NVTGP+GG V G
Sbjct:   12 TEKPVKATKVKGTVKWFNVKNGYGFINRTD--TNEDIFVHQTAIINNNPNKYLRSLGDNEEVLFDIVEGSKGLEASNVTGPDGGPVQG 97          
BLAST of Y box protein-1 vs. TrEMBL
Match: E3LFG7 (CRE-CEY-1 protein OS=Caenorhabditis remanei OX=31234 GN=Cre-cey-1 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.389e-18
Identity = 47/81 (58.02%), Postives = 57/81 (70.37%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            ++V G VKWFN KNGYGFI+  +   ++D+FVH  +I   N      SL D EEVLFDIVEG+KGLEA NVTGP+GG V G
Sbjct:   19 TKVKGTVKWFNVKNGYGFINRTD--TNEDIFVHQTAIINNNPNKYLRSLGDNEEVLFDIVEGSKGLEASNVTGPDGGPVQG 97          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:103040011])

HSP 1 Score: 78.9518 bits (193), Expect = 3.389e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   38 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVPVQGSKY 119          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 74.3294 bits (181), Expect = 1.318e-15
Identity = 43/83 (51.81%), Postives = 54/83 (65.06%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            V G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD+VE  KG EA NVTGP GG  V G++Y
Sbjct:   24 VQGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGP-GGVPVKGSRY 103          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 73.9442 bits (180), Expect = 1.735e-15
Identity = 43/83 (51.81%), Postives = 54/83 (65.06%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            V G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD+VE  KG EA NVTGP GG  V G++Y
Sbjct:   31 VQGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGP-GGVPVKGSRY 110          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 60.4622 bits (145), Expect = 6.184e-11
Identity = 33/78 (42.31%), Postives = 42/78 (53.85%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            GH KWFN + G+GFIS+ +   +      DVFVH   +      SL +GE V F   + +KGLE   VTGP G   VG
Sbjct:   31 GHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVG 108          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 60.4622 bits (145), Expect = 6.497e-11
Identity = 33/78 (42.31%), Postives = 42/78 (53.85%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            GH KWFN + G+GFIS+ +   +      DVFVH   +      SL +GE V F   + +KGLE   VTGP G   VG
Sbjct:   39 GHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVG 116          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO41469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S475])

HSP 1 Score: 81.6481 bits (200), Expect = 1.847e-20
Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = 3
Query:   27 IMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
             +A ++V G VKWFN KNGYGFI+ D+ +  +D+FVH  +IA  N      S+ DGE V F++V G KGLEA NVTGP+ G+ V G++Y
Sbjct:    2 FIAATKVTGTVKWFNVKNGYGFINRDDNK--EDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPD-GEPVQGSKY 87          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO44703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV03])

HSP 1 Score: 59.3066 bits (142), Expect = 1.588e-10
Identity = 34/76 (44.74%), Postives = 44/76 (57.89%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQ 278
            G VKWFN   G+GFI+ D+    +DVFVH  +I A+   SL +GE V   I    KG  A  VT P GG+V G ++
Sbjct:  485 GSVKWFNLIKGFGFITRDDG--GEDVFVHQSAIKASGYRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGASR 558          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:100049221])

HSP 1 Score: 78.5666 bits (192), Expect = 3.878e-17
Identity = 44/85 (51.76%), Postives = 57/85 (67.06%), Query Frame = 3
Query:   39 SQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            ++V+G VKWFN +NGYGFI+ ++    +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVTGP GG  V G++Y
Sbjct:   39 TKVLGTVKWFNVRNGYGFINRND--TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP-GGVAVQGSKY 120          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007880.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 76.6406 bits (187), Expect = 3.839e-16
Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            V G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD++E AKG EA NVTGP GG  V G++Y
Sbjct:  112 VQGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGP-GGIPVKGSRY 191          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007875.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 76.2554 bits (186), Expect = 5.001e-16
Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = 3
Query:   45 VVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQY 281
            V G VKWFN +NGYGFI+ ++ +  +DVFVH  +I   N      S+ DGE V FD++E AKG EA NVTGP GG  V G++Y
Sbjct:  112 VQGTVKWFNVRNGYGFINRNDTK--EDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGP-GGIPVKGSRY 191          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 63.929 bits (154), Expect = 3.453e-12
Identity = 34/78 (43.59%), Postives = 43/78 (55.13%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            G  KWFN + G+GFIS+ N          DVFVH   +      SL +GE+V F   + +KGLE+  VTGP GG  VG
Sbjct:   35 GFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVG 112          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 63.929 bits (154), Expect = 3.925e-12
Identity = 34/78 (43.59%), Postives = 43/78 (55.13%), Query Frame = 3
Query:   51 GHVKWFNSKNGYGFISVDNERCDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVG 269
            G  KWFN + G+GFIS+ N          DVFVH   +      SL +GE+V F   + +KGLE+  VTGP GG  VG
Sbjct:   42 GFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVG 119          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058039.1 (SMESG000058039.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.043e-56
Identity = 85/86 (98.84%), Postives = 85/86 (98.84%), Query Frame = 3
Query:   30 MAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ 287
            MAQSQV GHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ
Sbjct:    1 MAQSQVTGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ 86          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058043.1 (SMESG000058043.1)

HSP 1 Score: 164.851 bits (416), Expect = 2.108e-52
Identity = 80/86 (93.02%), Postives = 82/86 (95.35%), Query Frame = 3
Query:   30 MAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ 287
            MAQSQVVGHVKWFNSKNGYGFISVDN+  DKD+FVHFKSIAA NATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGA YEQ
Sbjct:    1 MAQSQVVGHVKWFNSKNGYGFISVDNDNSDKDIFVHFKSIAAGNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAPYEQ 86          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058013.1 (SMESG000058013.1)

HSP 1 Score: 143.28 bits (360), Expect = 7.487e-44
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 3
Query:   30 MAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 242
            MAQSQV+GHVKWFNSKNGYGFISVDNER DKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT
Sbjct:    1 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 71          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058066.1 (SMESG000058066.1)

HSP 1 Score: 142.51 bits (358), Expect = 6.510e-43
Identity = 67/85 (78.82%), Postives = 73/85 (85.88%), Query Frame = 3
Query:   30 MAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYE 284
            M  SQV GHVKWF+SKNGYGFISVD++   KD+FVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGPNGGDV+GG  YE
Sbjct:    1 MTASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYE 85          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000078868.1 (SMESG000078868.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.805e-36
Identity = 62/88 (70.45%), Postives = 72/88 (81.82%), Query Frame = 3
Query:   24 SIMAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQ 287
            S + +++V GHVKWFNSK+GYGFI  + +R D DVFVH  SI ATNA SLADGEEV FD+V+G+KGLEARNVTGPNGGDVVGG  Y Q
Sbjct:    2 SNIIETKVNGHVKWFNSKSGYGFIRRE-DRKDSDVFVHHSSIVATNANSLADGEEVQFDVVQGSKGLEARNVTGPNGGDVVGGKPYFQ 88          
The following BLAST results are available for this feature:
BLAST of Y box protein-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YBX21.120e-1753.57Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX21.120e-1753.57Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX13.935e-1751.76Y-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
YBX31.336e-1651.85Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX31.822e-1651.85Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cey-14.521e-2055.56C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62... [more]
cey-21.251e-1548.15C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-45.539e-1446.91C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-45.539e-1446.91C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-31.102e-1347.67C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
yps3.172e-1650.00gene:FBgn0022959 transcript:FBtr0076027[more]
yps3.268e-1650.00gene:FBgn0022959 transcript:FBtr0305992[more]
lin-282.853e-836.49gene:FBgn0035626 transcript:FBtr0077090[more]
back to top
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx11.539e-1751.76Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx11.539e-1751.76Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx12.039e-1751.76Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
LIN28A3.402e-1040.51si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-11091... [more]
LIN28A3.695e-1040.51si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-11091... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcs12.547e-1751.763-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs18.419e-1751.763-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
ybx34.084e-1650.62Y-box binding protein 3 [Source:NCBI gene;Acc:5485... [more]
lin28b1.672e-1039.74lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
lin28b1.816e-1039.74lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
back to top
BLAST of Y box protein-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ybx26.548e-1853.57Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx28.281e-1853.57Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx12.473e-1751.76Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146][more]
Ybx34.974e-1751.85Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx36.764e-1751.85Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
back to top
BLAST of Y box protein-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41824|YBOXH_APLCA6.699e-1855.56Y-box factor homolog OS=Aplysia californica OX=650... [more]
sp|Q9Y2T7|YBOX2_HUMAN5.378e-1753.57Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN... [more]
sp|P45441|YBX2B_XENLA1.112e-1649.45Y-box-binding protein 2-B OS=Xenopus laevis OX=835... [more]
sp|B5DE31|YBOX1_DANRE1.162e-1651.76Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=... [more]
sp|P62961|YBOX1_RAT1.730e-1651.76Y-box-binding protein 1 OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of Y box protein-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIB05.081e-4079.07Y box protein-1 (Fragment) OS=Schmidtea mediterran... [more]
A0A3M7PA902.110e-1850.00Y-box factor-like protein OS=Brachionus plicatilis... [more]
A0A565DLG55.236e-1853.66Cold shock protein (Fragment) OS=Echiniscoides sig... [more]
G0MVG46.997e-1854.55CBN-CEY-1 protein OS=Caenorhabditis brenneri OX=13... [more]
E3LFG79.389e-1858.02CRE-CEY-1 protein OS=Caenorhabditis remanei OX=312... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx13.389e-1751.76Y-box binding protein 1 [Source:NCBI gene;Acc:1030... [more]
YBX21.318e-1551.81Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
YBX21.735e-1551.81Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
LIN28B6.184e-1142.31protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
LIN28B6.497e-1142.31protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO414691.847e-2050.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447031.588e-1044.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx13.878e-1751.76Y-box binding protein 1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007880.23.839e-1651.81Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007875.25.001e-1651.81Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
lin28b3.453e-1243.59lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
lin28b3.925e-1243.59lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
back to top
BLAST of Y box protein-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058039.11.043e-5698.84SMESG000058039.1[more]
SMESG000058043.12.108e-5293.02SMESG000058043.1[more]
SMESG000058013.17.487e-4497.18SMESG000058013.1[more]
SMESG000058066.16.510e-4378.82SMESG000058066.1[more]
SMESG000078868.12.805e-3670.45SMESG000078868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014813 ID=SMED30014813|Name=Y box protein-1|organism=Schmidtea mediterranea sexual|type=transcript|length=625bp
GAATTATATAAAAATTTACAAATTCAATCATGGCTCAATCTCAAGTTGTT
GGACACGTTAAATGGTTTAACTCAAAGAATGGATACGGATTTATTAGTGT
TGACAATGAACGTTGCGATAAAGATGTCTTTGTACATTTTAAATCTATTG
CTGCAACAAATGCAACTTCATTAGCTGATGGTGAAGAAGTTCTCTTCGAT
ATAGTTGAAGGTGCTAAGGGTCTTGAAGCAAGAAACGTTACTGGACCAAA
TGGAGGCGATGTTGTTGGTGGCGCACAATATGAACAGAATAACGATAGAT
TTAACAACAGAGGTGGTGATAGAGATAATAACAGATCTTATGGTAATCGT
GATGGTGGTAATAGAAGAGATCAAGGTGGATATGGTAATTATGGTGGTCG
AAGAGAAGACAACTATTAATGGATTTCAAGAGAATTGAAATTGTTTAGAA
TAATACTGCATTAAATTTAATAAATTTGTGTAAATTTTTAAATTTGTTAT
TTTTACGTAGTGTTTATTTCTTAGTTAAAAAATGATATTTTAAATTTATT
TGTGTCTTTAACAGGATTAAGGAAACAGTTTATTTAAAGCCTAAATGTTG
TATTAGTTTATAAGCTTTGTATGTG
back to top

protein sequence of SMED30014813-orf-1

>SMED30014813-orf-1 ID=SMED30014813-orf-1|Name=SMED30014813-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MAQSQVVGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLAD
GEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQNNDRFNNRGGDRDN
NRSYGNRDGGNRRDQGGYGNYGGRREDNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002059CSP_DNA-bd
IPR011129CSD
IPR012340NA-bd_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002059Cold-shock protein, DNA-bindingPRINTSPR00050COLDSHOCKcoord: 8..23
score: 66.08
coord: 46..64
score: 50.21
IPR002059Cold-shock protein, DNA-bindingPFAMPF00313CSDcoord: 7..72
e-value: 1.8E-23
score: 82.2
IPR002059Cold-shock protein, DNA-bindingCDDcd04458CSP_CDScoord: 6..72
e-value: 2.3336E-20
score: 76.4634
IPR011129Cold shock domainSMARTSM00357csp_8coord: 7..73
e-value: 4.7E-20
score: 82.6
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 1..84
e-value: 1.6E-26
score: 94.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..109
NoneNo IPR availablePANTHERPTHR11544COLD SHOCK DOMAIN CONTAINING PROTEINScoord: 3..115
NoneNo IPR availablePANTHERPTHR11544:SF60LD37574Pcoord: 3..115
NoneNo IPR availablePROSITEPS51857CSD_2coord: 5..72
score: 27.639
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 5..72