Calcium-activated potassium channel slo-1, putative

Overview
NameCalcium-activated potassium channel slo-1, putative
Smed IDSMED30014811
Length (bp)3736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-activated potassium channel slo-1, putative (SMED30014811) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30014811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-activated potassium channel slo-1, putative (SMED30014811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30014811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014811

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30014811SMESG000044594.1 dd_Smed_v4_8138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014811SMESG000044594.1 dd_Smed_v4_8138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30014811SMESG000044594.1 dd_Smed_v4_8138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30014811SMESG000044594.1 dd_Smed_v4_8138_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014811SMESG000044594.1 dd_Smed_v6_8138_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 370/1081 (34.23%), Postives = 614/1081 (56.80%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS---VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K +      +K +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1123          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 383/1105 (34.66%), Postives = 609/1105 (55.11%), Query Frame = 2
Query:  377 EMNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLK-----ISQSTNFETACRSQKNLESLIEDP----------SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTN-PIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK-------------------------------GSPDDY-----ELTVISRLKSEEEVSLTKCDVENDFKEMEFIDE-----KCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSE--TQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVS-QINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            E + +C  +RK++ F+      +   ++L+VIW+++ +   ++R K     I      +      K+  S   DP           +    + +  +LIS Q L GR +  +  + ++ S ++Y Y+      ++E C P  + P    DL  N  FL+YF +RF  +++K+ F L  ++ ID FTIP    A+ L + W+G RF+R L L+ V +++Q  N++K+ +SIR+ QL+T F ++ + GAG  HLLENSG+   G  + N   I Y DS+YF++VTMSTVGYGDI+  T+CG++F++ FIL  LA FAS++PE+A+ +    +Y G Y    G++HI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++  PD+E++ L K +FT+V++F GTVMD +DL RV++ +ADACL+LA++  ++P+ EDA NIMR IS KNY     VI+QL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P    WLNDY+RG  ME+Y+  LS SF   S+ E     F  L LLL+AIE+KD  +K+  + +NP     I P + GFFI  S  +   A  +C +CH  ++D++ +K C CK                                 P  +     +L +I++ +           +  D + ++F  +     +   Y   G F+ C P + +++ +   HQ  +  L GH+++C+F+D  +  IG+RNF+MPLRS     +ELK +VI+ D +++ KEW  +   PKI ++      R     ++I+ C  CVI++ +    +   D  + DKE I+A+L  +A      M+ +  +           G      +T      G+      KG++  T VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+N +A+ ++  L+ GG+  +L+         +    T   L  R+   R  +  +S Q N      +   Y  +F   + ++  + +GLYR    L  +   +++ RYVITNPP    I+ TD VY L+Q
Sbjct:   34 EEDRKCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSET-DPFLKQQEEKHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKG--FINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWC-PSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE---DTTLADKEAILASLNIKA------MQFDDTL-----------GFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRD---RCRIAQISLQDNPYDGVVHNTTYGAMFTIALRRYGQLCIGLYR----LHDQDNPDSMKRYVITNPPAELRIKNTDYVYVLEQ 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 381/1105 (34.48%), Postives = 609/1105 (55.11%), Query Frame = 2
Query:  377 EMNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLK-----ISQSTNFETACRSQKNLESLIEDP----------SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTN-PIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK-------------------------------GSPDDY-----ELTVISRLKSEEEVSLTKCDVENDFKEMEFIDE-----KCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSE--TQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVS-QINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            E + +C  +RK++ F+      +   ++L+VIW+++ +   ++R K     I      +      K+  S   DP           +    + +  +LIS Q L GR +  +  + ++ S ++Y Y+      ++E C P  + P    DL  N  FL+YF +RF  +++K+ F L  ++ ID FTIP    A+ L + W+G RF+R L L+ V +++Q  N++K+ +SIR+ QL+T F ++ + GAG  HLLENSG+   G  + N   I Y DS+YF++VTMSTVGYGDI+  T+CG++F++ FIL  LA FAS++PE+A+ +    +Y G Y    G++HI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++  PD+E++ L K +FT+V++F GTVMD +DL RV++ +ADACL+LA++  ++P+ EDA NIMR IS KNY     VI+QL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS K  +  P    WLN Y+ G  ME+Y+  LS SF   ++ E V+  F  L LLL+AIE+KD  +K+  + +NP     I P + GFFI  S  +   A  +C +CH  ++D++ +K C CK                                 P  +     +L +I++ +           +  D + ++F  +     +   Y   G F+ C P + +++ +   HQ  +  L GH+++C+F+D  +  IG+RNF+MPLRS     +ELK +VI+ D +++ KEW  +   PKI ++      R     ++I+ C  CVI++ +    +   D  + DKE I+A+L  +A      M+ +  +           G      +T      G+      KG++  T VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+N +A+ ++  L+ GG+  +L+         +    T   L  R+   R  +  +S Q N      +   Y  +F   + ++  + +GLYR    L  +   +++ RYVITNPP    I+ TD VY L+Q
Sbjct:   34 EEDRKCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSET-DPFLKQQEEKHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKG--FINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTP---DWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWC-PSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE---DTTLADKEAILASLNIKA------MQFDDTL-----------GFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRD---RCRIAQISLQDNPYDGVVHNTTYGAMFTIALRRYGQLCIGLYR----LHDQDNPDSMKRYVITNPPAELRIKNTDYVYVLEQ 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 488.034 bits (1255), Expect = 2.861e-152
Identity = 259/635 (40.79%), Postives = 395/635 (62.20%), Query Frame = 2
Query:  377 EMNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLK-----ISQSTNFETACRSQKNLESLIEDP----------SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTN-PIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK 2233
            E + +C  +RK++ F+      +   ++L+VIW+++ +   ++R K     I      +      K+  S   DP           +    + +  +LIS Q L GR +  +  + ++ S ++Y Y+      ++E C P  + P    DL  N  FL+YF +RF  +++K+ F L  ++ ID FTIP    A+ L + W+G RF+R L L+ V +++Q  N++K+ +SIR+ QL+T F ++ + GAG  HLLENSG+   G  + N   I Y DS+YF++VTMSTVGYGDI+  T+CG++F++ FIL  LA FAS++PE+A+ +    +Y G Y    G++HI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++  PD+E++ L K +FT+V++F GTVMD +DL RV++ +ADACL+LA++  ++P+ EDA NIMR IS KNY     VI+QL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P    WLNDY+RG  ME+Y+  LS SF   S+ E     F  L LLL+AIE+KD  +K+  + +NP     I P + GFFI  S  +   A  +C +CH  ++D++ +K C CK
Sbjct:   34 EEDRKCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSET-DPFLKQQEEKHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKG--FINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCK 662          

HSP 2 Score: 177.178 bits (448), Expect = 1.120e-44
Identity = 126/404 (31.19%), Postives = 205/404 (50.74%), Query Frame = 2
Query: 2309 DVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSE--TQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVS-QINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            D   DF E +F D K   Y   G F+ C P + +++ +   HQ  +  L GH+++C+F+D  +  IG+RNF+MPLRS     +ELK +VI+ D +++ KEW  +   PKI ++      R     ++I+ C  CVI++ +    +   D  + DKE I+A+L  +A      M+ +  +           G      +T      G+      KG++  T VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+N +A+ ++  L+ GG+  +L+         +    T   L  R+   R  +  +S Q N      +   Y  +F   + ++  + +GLYR    L  +   +++ RYVITNPP    I+ TD VY L+Q
Sbjct:  746 DFSKDF-EQQFQDMK---YDSTGMFHWC-PSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE---DTTLADKEAILASLNIKA------MQFDDTL-----------GFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRD---RCRIAQISLQDNPYDGVVHNTTYGAMFTIALRRYGQLCIGLYR----LHDQDNPDSMKRYVITNPPAELRIKNTDYVYVLEQ 1117          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 488.419 bits (1256), Expect = 2.894e-152
Identity = 259/635 (40.79%), Postives = 395/635 (62.20%), Query Frame = 2
Query:  377 EMNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLK-----ISQSTNFETACRSQKNLESLIEDP----------SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTN-PIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK 2233
            E + +C  +RK++ F+      +   ++L+VIW+++ +   ++R K     I      +      K+  S   DP           +    + +  +LIS Q L GR +  +  + ++ S ++Y Y+      ++E C P  + P    DL  N  FL+YF +RF  +++K+ F L  ++ ID FTIP    A+ L + W+G RF+R L L+ V +++Q  N++K+ +SIR+ QL+T F ++ + GAG  HLLENSG+   G  + N   I Y DS+YF++VTMSTVGYGDI+  T+CG++F++ FIL  LA FAS++PE+A+ +    +Y G Y    G++HI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++  PD+E++ L K +FT+V++F GTVMD +DL RV++ +ADACL+LA++  ++P+ EDA NIMR IS KNY     VI+QL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P    WLNDY+RG  ME+Y+  LS SF   S+ E     F  L LLL+AIE+KD  +K+  + +NP     I P + GFFI  S  +   A  +C +CH  ++D++ +K C CK
Sbjct:   34 EEDRKCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSET-DPFLKQQEEKHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKG--FINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCK 662          

HSP 2 Score: 177.178 bits (448), Expect = 1.159e-44
Identity = 126/404 (31.19%), Postives = 205/404 (50.74%), Query Frame = 2
Query: 2309 DVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSE--TQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVS-QINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            D   DF E +F D K   Y   G F+ C P + +++ +   HQ  +  L GH+++C+F+D  +  IG+RNF+MPLRS     +ELK +VI+ D +++ KEW  +   PKI ++      R     ++I+ C  CVI++ +    +   D  + DKE I+A+L  +A      M+ +  +           G      +T      G+      KG++  T VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+N +A+ ++  L+ GG+  +L+         +    T   L  R+   R  +  +S Q N      +   Y  +F   + ++  + +GLYR    L  +   +++ RYVITNPP    I+ TD VY L+Q
Sbjct:  755 DFSKDF-EQQFQDMK---YDSTGMFHWC-PSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE---DTTLADKEAILASLNIKA------MQFDDTL-----------GFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRD---RCRIAQISLQDNPYDGVVHNTTYGAMFTIALRRYGQLCIGLYR----LHDQDNPDSMKRYVITNPPAELRIKNTDYVYVLEQ 1126          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 488.034 bits (1255), Expect = 3.435e-152
Identity = 259/635 (40.79%), Postives = 395/635 (62.20%), Query Frame = 2
Query:  377 EMNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLK-----ISQSTNFETACRSQKNLESLIEDP----------SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTN-PIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK 2233
            E + +C  +RK++ F+      +   ++L+VIW+++ +   ++R K     I      +      K+  S   DP           +    + +  +LIS Q L GR +  +  + ++ S ++Y Y+      ++E C P  + P    DL  N  FL+YF +RF  +++K+ F L  ++ ID FTIP    A+ L + W+G RF+R L L+ V +++Q  N++K+ +SIR+ QL+T F ++ + GAG  HLLENSG+   G  + N   I Y DS+YF++VTMSTVGYGDI+  T+CG++F++ FIL  LA FAS++PE+A+ +    +Y G Y    G++HI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++  PD+E++ L K +FT+V++F GTVMD +DL RV++ +ADACL+LA++  ++P+ EDA NIMR IS KNY     VI+QL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P    WLNDY+RG  ME+Y+  LS SF   S+ E     F  L LLL+AIE+KD  +K+  + +NP     I P + GFFI  S  +   A  +C +CH  ++D++ +K C CK
Sbjct:   34 EEDRKCLEERKYWCFLLSSITTFCASMILVVIWRVVTHLCCQRREKEFVEPIPAPEAVQINMNGSKHAPSET-DPFLKQQEEKHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKG--FINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCK 662          

HSP 2 Score: 176.792 bits (447), Expect = 1.384e-44
Identity = 126/404 (31.19%), Postives = 205/404 (50.74%), Query Frame = 2
Query: 2309 DVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSE--TQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVS-QINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            D   DF E +F D K   Y   G F+ C P + +++ +   HQ  +  L GH+++C+F+D  +  IG+RNF+MPLRS     +ELK +VI+ D +++ KEW  +   PKI ++      R     ++I+ C  CVI++ +    +   D  + DKE I+A+L  +A      M+ +  +           G      +T      G+      KG++  T VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+N +A+ ++  L+ GG+  +L+         +    T   L  R+   R  +  +S Q N      +   Y  +F   + ++  + +GLYR    L  +   +++ RYVITNPP    I+ TD VY L+Q
Sbjct:  753 DFSKDF-EQQFQDMK---YDSTGMFHWC-PSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTE---DTTLADKEAILASLNIKA------MQFDDTL-----------GFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRD---RCRIAQISLQDNPYDGVVHNTTYGAMFTIALRRYGQLCIGLYR----LHDQDNPDSMKRYVITNPPAELRIKNTDYVYVLEQ 1124          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100624)

HSP 1 Score: 520.39 bits (1339), Expect = 7.355e-164
Identity = 264/641 (41.19%), Postives = 402/641 (62.71%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS-VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTK 2305
            +C   RK++ F+      +  GLL++++W+       RK   +  +   +   ++ +N +    + +F    + +  +LIS Q   GRI+  +  + ++ S ++Y  +      ++E+C   +N I    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  NV+K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN+  + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS IPE+ E + +G++Y G   +  G+RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++KEPD+E++ LLK ++T V +FQGT+M+ VDL+RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  +SW NDY+RG  ME+Y+  LS +F    + +  E CF  L LLL+AIE+K +       + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK       LTV  R K ++   +T+
Sbjct:   42 DCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEF--EGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVD--ASSEEVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLD---FNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKEPDLELEGLLKRHYTTVAFFQGTMMNAVDLERVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAK-IQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCK------NLTVQPRSKFDDLGDITR 665          

HSP 2 Score: 181.8 bits (460), Expect = 5.074e-46
Identity = 133/428 (31.07%), Postives = 215/428 (50.23%), Query Frame = 2
Query: 2291 VSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPS 3523
            VSL     ++  K+ +F ++    Y   G F+  SP K +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  C IL+ K    D   D  + DKE I+A+L  +A            +    +I + +  G    E  N S + G+      +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ PP+
Sbjct:  752 VSLPAGIADDQSKDFDF-EKTEMKYDSTGMFH-WSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND---DPTLADKEAILASLNIKA------------MTFDDTIGVLSQRGP---EFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGK------YGDLFVAALKSYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPPA 1147          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0301582)

HSP 1 Score: 519.62 bits (1337), Expect = 3.505e-163
Identity = 259/617 (41.98%), Postives = 390/617 (63.21%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS-VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK 2233
            +C   RK++ F+      +  GLL++++W+       RK   +  +   +   ++ +N +    + +F    + +  +LIS Q   GRI+  +  + ++ S ++Y  +      ++E+C   +N I    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  NV+K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN+  + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS+IPE+ E     S+Y G Y K   +RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++KEPD+E++ LLK ++T V +FQGT+M+ VDL+RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  +SW NDY+RG  ME+Y+  LS +F    + +  E CF  L LLL+AIE+K +       + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK
Sbjct:   25 DCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEF--EGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSE--EVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLD---FNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAVFASWIPEITELAAQRSKYGGTYSKDPRKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKEPDLELEGLLKRHYTTVAFFQGTMMNAVDLERVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAK-IQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCK 630          

HSP 2 Score: 181.03 bits (458), Expect = 1.101e-45
Identity = 133/428 (31.07%), Postives = 215/428 (50.23%), Query Frame = 2
Query: 2291 VSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPS 3523
            VSL     ++  K+ +F ++    Y   G F+  SP K +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  C IL+ K    D   D  + DKE I+A+L  +A            +    +I + +  G    E  N S + G+      +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ PP+
Sbjct:  787 VSLPAGIADDQSKDFDF-EKTEMKYDSTGMFH-WSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND---DPTLADKEAILASLNIKA------------MTFDDTIGVLSQRGP---EFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGK------YGDLFVAALKSYGMLCIGLYRFRDT--SSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPPA 1182          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100622)

HSP 1 Score: 518.079 bits (1333), Expect = 6.169e-163
Identity = 263/641 (41.03%), Postives = 398/641 (62.09%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS-VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTK 2305
            +C   RK++ F+      +  GLL++++W+       RK   +  +   +   ++ +N +    + +F    + +  +LIS Q   GRI+  +  + ++ S ++Y  +      ++E+C   +N I    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  NV+K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN+  + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS+IPE+ E     S+Y G Y K   +RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++K PD+E++ L K +FT V++FQGT+M+ +DL RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  +SW NDY+RG  ME+Y+  LS +F    + +  E CF  L LLL+AIE+K +       + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK       LTV  R K ++   +T+
Sbjct:   42 DCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEF--EGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVD--ASSEEVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLD---FNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAVFASWIPEITELAAQRSKYGGTYSKDPRKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAK-IQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCK------NLTVQPRSKFDDLGDITR 665          

HSP 2 Score: 181.8 bits (460), Expect = 6.029e-46
Identity = 133/428 (31.07%), Postives = 215/428 (50.23%), Query Frame = 2
Query: 2291 VSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPS 3523
            VSL     ++  K+ +F ++    Y   G F+  SP K +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  C IL+ K    D   D  + DKE I+A+L  +A            +    +I + +  G    E  N S + G+      +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ PP+
Sbjct:  752 VSLPAGIADDQSKDFDF-EKTEMKYDSTGMFH-WSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND---DPTLADKEAILASLNIKA------------MTFDDTIGVLSQRGP---EFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGK------YGDLFVAALKSYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPPA 1147          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0084684)

HSP 1 Score: 517.309 bits (1331), Expect = 9.360e-163
Identity = 262/641 (40.87%), Postives = 400/641 (62.40%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS-VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTK 2305
            +C   RK++ F+      +  GLL++++W+       RK   +  +   +   ++ +N +    + +F    + +  +LIS Q   GRI+  +  + ++ S ++Y  +      ++E+C   +N I    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  NV+K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN+  + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS IPE+ E + +G++Y G   +  G+RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++K PD+E++ L K +FT V++FQGT+M+ +DL RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  +SW NDY+RG  ME+Y+  LS +F    + +  E CF  L LLL+AIE+K +       + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK       LTV  R K ++   +T+
Sbjct:   42 DCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEF--EGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVD--ASSEEVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLD---FNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAK-IQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCK------NLTVQPRSKFDDLGDITR 665          

HSP 2 Score: 181.8 bits (460), Expect = 5.627e-46
Identity = 133/428 (31.07%), Postives = 215/428 (50.23%), Query Frame = 2
Query: 2291 VSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPS 3523
            VSL     ++  K+ +F ++    Y   G F+  SP K +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  C IL+ K    D   D  + DKE I+A+L  +A            +    +I + +  G    E  N S + G+      +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ PP+
Sbjct:  752 VSLPAGIADDQSKDFDF-EKTEMKYDSTGMFH-WSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND---DPTLADKEAILASLNIKA------------MTFDDTIGVLSQRGP---EFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGK------YGDLFVAALKSYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPPA 1147          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100634)

HSP 1 Score: 517.694 bits (1332), Expect = 1.301e-162
Identity = 262/641 (40.87%), Postives = 400/641 (62.40%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDS-VSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTK 2305
            +C   RK++ F+      +  GLL++++W+       RK   +  +   +   ++ +N +    + +F    + +  +LIS Q   GRI+  +  + ++ S ++Y  +      ++E+C   +N I    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  NV+K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN+  + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS IPE+ E + +G++Y G   +  G+RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++K PD+E++ L K +FT V++FQGT+M+ +DL RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  +SW NDY+RG  ME+Y+  LS +F    + +  E CF  L LLL+AIE+K +       + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK       LTV  R K ++   +T+
Sbjct:   42 DCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEF--EGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVD--ASSEEVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLD---FNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAK-IQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCK------NLTVQPRSKFDDLGDITR 665          

HSP 2 Score: 181.415 bits (459), Expect = 7.067e-46
Identity = 133/428 (31.07%), Postives = 215/428 (50.23%), Query Frame = 2
Query: 2291 VSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPS 3523
            VSL     ++  K+ +F ++    Y   G F+  SP K +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  C IL+ K    D   D  + DKE I+A+L  +A            +    +I + +  G    E  N S + G+      +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ PP+
Sbjct:  774 VSLPAGIADDQSKDFDF-EKTEMKYDSTGMFH-WSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND---DPTLADKEAILASLNIKA------------MTFDDTIGVLSQRGP---EFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGK------YGDLFVAALKSYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPPA 1169          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 365/1064 (34.30%), Postives = 594/1064 (55.83%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFE---TACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDF-----------KEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-----QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---QDDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N  +++  K++     +   T     +  E+   +  +  + + +   +IS Q L GR++  +  V AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD++A+T  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K          +                +++E +D     Y   G F+ C  +++ K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L            N   ++   SI +  A  +          S  N        Q S  + + +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   37 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYK-SEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQ 1073          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 367/1068 (34.36%), Postives = 597/1068 (55.90%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFE---TACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVK----DSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDF-----------KEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-----QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---QDDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N  +++  K++     +   T     +  E+   +  +  + + +   +IS Q L GR++  +  V AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD++A+T  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K    +S S+K+ +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K          +                +++E +D     Y   G F+ C  +++ K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L            N   ++   SI +  A  +          S  N        Q S  + + +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   54 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESRSRKR-ILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQ 1094          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 369/1080 (34.17%), Postives = 598/1080 (55.37%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFE---TACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDF-----------KEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESK-------RRIMKNNSKIEMAKSISIKAAGGETQI--ERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---QDDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N  +++  K++     +   T     +  E+   +  +  + + +   +IS Q L GR++  +  V AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD++A+T  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K          +                +++E +D     Y   G F+ C  +++ K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L              QA S+        R   +NS +      +    G    I  E     K     +F   K S T + +I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   54 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYK-SEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELAKPGKLLPLVSFSQEKNSGTNIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLMQ 1118          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: CABZ01092907.1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1b [Source:NCBI gene;Acc:798583])

HSP 1 Score: 409.068 bits (1050), Expect = 2.071e-130
Identity = 200/467 (42.83%), Postives = 308/467 (65.95%), Query Frame = 2
Query:  605 RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPL-TNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVE 2002
            + +   +IS Q L GR++  +    ++ + V+Y    I     +E C     N     D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E
Sbjct:    5 KDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSDPIESCEHFDKNFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCE 462          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnt1 (potassium channel, subfamily T, member 1 [Source:ZFIN;Acc:ZDB-GENE-091231-1])

HSP 1 Score: 139.813 bits (351), Expect = 6.587e-33
Identity = 99/329 (30.09%), Postives = 167/329 (50.76%), Query Frame = 2
Query: 1151 DSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGR--RHIIVCGHINYASVSTF----LTDFLHE---DRSSSDVDVIFINKKEPDIEMKSLLKI--YFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRS--FNEFSYKELVEFCF---KNLNLLLIAIEVKDSVSKKKMLLMNP 2089
            ++LYF IVT STVG+GD+  +    ++ VV+ I +AL        EL        +  G Y +   +  RH+++C       VST     L DFL+E      + D  V+ +   E D++++ +L+I  +  +V Y QG+ +   DL R +M +A+AC IL+ +N +D    D   I+RA + K++   CP+ +Q+L+ ENK ++        +  D ++C  E +  +LA +CL P  STL+T +      +E +Q+P  E W   Y R    E+Y  +L  S  F E++ K      F   K   + +I ++ +D+    K +L+NP
Sbjct:  215 NALYFCIVTFSTVGFGDVTPQIWPSQLLVVVMICVALVVLPLQFEELIYLWMERQKSGGNYSRHRAQTERHVVLC-------VSTLKIDLLMDFLNEFYAHPHTQDYYVVILCPCEVDVQVRRILQIPLWSQRVIYLQGSALKNQDLLRAKMDDAEACFILSSRNEADRMAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHV--------KFADHVVCEEEFKYAMLALNCLCPATSTLITLLVHTSRGQEGQQSP--EQWQRMYGRCSGNEVYHIRLGDSMFFREYNSKSFTYAAFHAHKKYGVCMIGVKREDN----KSILLNP 522          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 373/1090 (34.22%), Postives = 605/1090 (55.50%), Query Frame = 2
Query:  380 MNIECPTQ--RKWYWFIAVDSLAYFGGLLLLVIWKI--------------------IINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---------SPDDYELTVISRLKSEEEVSLTKCD----VENDFKEMEFIDEKCCS-YKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNN----QFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C  Q  R W+ F+A   + +FGGL ++++W+                     ++NA      +++     +T  + +     ++E   +  + + +   +IS Q L GR++  + TV AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K    + ++++ NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K C CK          SP   +     R       ++ + D      ND  +++ +D      Y   G F+ C  ++L K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   D++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      +ER++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+     Q  +   P + +       +   Y D++ + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   21 MEVPCDNQGTRMWWAFLASSMVTFFGGLFIILVWRTFKYLWTVCCHCGGKNKDAQKVVNA---ASSQVTDGDYKQTDDKEETAAPGVVE-VGWMTSVKDWAGVMISAQTLTGRVL--VVTVFALSIGALMIY-FIDSSNPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRN--FENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIII-NPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGND--QIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL------GDGGCYGDLYCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1071          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 371/1102 (33.67%), Postives = 607/1102 (55.08%), Query Frame = 2
Query:  380 MNIECPTQ--RKWYWFIAVDSLAYFGGLLLLVIWKI--------------------IINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK-----------------GSPDDYELTVISRLKSEEEVSLTKCD--------------VENDFKEMEFIDEKCCS-YKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---QDDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C  Q  R W+ F+A   + +FGGL ++++W+                     ++NA      +++     +T  + +     ++E   +  + + +   +IS Q L GR++  + TV AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K    + + +++NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K C CK                 G  +D + + +S  K +    + +                  ND  +++ +D      Y   G F+ C  ++L K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   D++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      +ER++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D++ + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   67 MEVPCDNQGTRMWWAFLASSMVTFFGGLFIILVWRTFKYLWTVCCHCGGKNKDAQKVVNA---ASSQVTDGDYKQTDDKEETAAPGVVE-VGWMTSVKDWAGVMISAQTLTGRVL--VVTVFALSIGALMIY-FIDSSNPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRN--FENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESR-IIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRRSQFHKSPLQNKKKGNGPFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGND--QIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLYCKALKTYNMLCFGIYRLRD-AHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1135          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 371/1090 (34.04%), Postives = 602/1090 (55.23%), Query Frame = 2
Query:  380 MNIECPTQ--RKWYWFIAVDSLAYFGGLLLLVIWKI--------------------IINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---------SPDDYELTVISRLKSEEEVSLTKCD----VENDFKEMEFIDEKCCS-YKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNN----QFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C  Q  R W+ F+A   + +FGGL ++++W+                     ++NA      +++     +T  + +     ++E   +  + + +   +IS Q L GR++  + TV AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FA ++PE+A  +    +Y G +    GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K    + ++++ NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K C CK          SP   +     R       ++ + D      ND  +++ +D      Y   G F+ C  ++L K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   D++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      +ER++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+     Q  +   P + +       +   Y D++ + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   67 MEVPCDNQGTRMWWAFLASSMVTFFGGLFIILVWRTFKYLWTVCCHCGGKNKDAQKVVNA---ASSQVTDGDYKQTDDKEETAAPGVVE-VGWMTSVKDWAGVMISAQTLTGRVL--VVTVFALSIGALMIY-FIDSSNPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRN--FENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTFNATRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIII-NPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGND--QIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL------GDGGCYGDLYCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1117          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 371/1107 (33.51%), Postives = 604/1107 (54.56%), Query Frame = 2
Query:  380 MNIECPTQ--RKWYWFIAVDSLAYFGGLLLLVIWKI--------------------IINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKK-----------------------MLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---------SPDDYELTVISRLKSEEEVSLTKCD----VENDFKEMEFIDEKCCS-YKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQ---DDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C  Q  R W+ F+A   + +FGGL ++++W+                     ++NA   +   ++     +T  + +     ++E   +  + + +   +IS Q L GR++  + TV AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K    + +                        +++NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K C CK          SP   +     R       ++ + D      ND  +++ +D      Y   G F+ C  ++L K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   D++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      +ER++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D++ + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:    4 MEVPCDNQGTRMWWAFLASSMVTFFGGLFIILVWRTFKYLWTVCCHCGGKNKDAQKVVNAASSQ---VTDGDYKQTDDKEETAAPGVVE-VGWMTSVKDWAGVMISAQTLTGRVL--VVTVFALSIGALMIY-FIDSSNPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRN--FENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRGSKLEAVDILARFCVITFRVFFTRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGND--QIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLYCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1078          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 362/1009 (35.88%), Postives = 572/1009 (56.69%), Query Frame = 2
Query:  587 SFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---------SPDDYELTVISRLKSEEEVSLTKCD----VENDFKEMEFIDEKCCS-YKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESK-------RRIMKNNSKIE-MAKSISIKAAGGETQI-ERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQ---DDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
             +  + + +   +IS Q L GR++  + TV AL    L +Y  I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K    + ++++ NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K C CK          SP   +     R       ++ + D      ND  +++ +D      Y   G F+ C  ++L K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   D++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L              QA S+        R   +NS +  +A+  SI        I E     K     +F   K S T +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D++ + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   19 GWMTSVKDWAGVMISAQTLTGRVL--VVTVFALSIGALMIY-FIDSSNPIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRN--FENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIII-NPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGND--QIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELAKPGKLLPLISFSQEKNSGTHIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLYCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1010          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 369/1078 (34.23%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGC+   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   10 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1054          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 369/1078 (34.23%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGC+   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   10 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1054          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 369/1078 (34.23%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGC+   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   75 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1119          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 369/1078 (34.23%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGC+   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   10 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1054          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 369/1081 (34.14%), Postives = 613/1081 (56.71%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG------------SPDDYELTVISRLKSEEEVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGC+             SP   +     R        L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   26 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLIYFEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1073          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q8AYS8|KCMA1_CHICK (Calcium-activated potassium channel subunit alpha-1 OS=Gallus gallus OX=9031 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 367/1073 (34.20%), Postives = 608/1073 (56.66%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----------INAFHRKRLKISQSTNFETACR-SQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSE---------EEVSLTKCD--VENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQ---DDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +           +     +++     T  + AC+ + +  E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL PG ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E  F  L LL+IAIE K S  ++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D  +    ++++ +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ IG+RN +MPLR+     +ELK +V +   +++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N               +   V+Q+        +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGVKNKEAQKINGGGDTQADGACKPTDEKEENVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQQLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYK-SEKRESSILINPGNHVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGNEQIDNMDANVKKYDSTGMFHWCPAKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELKHIVFVGSLEYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1078          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q9BG98|KCMA1_RABIT (Calcium-activated potassium channel subunit alpha-1 OS=Oryctolagus cuniculus OX=9986 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 369/1077 (34.26%), Postives = 612/1077 (56.82%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKIII-----------NAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSE---------EEVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +             A   +++    S    T     +  E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   76 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKAKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1120          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18866|KCMA1_PIG (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 371/1078 (34.42%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNLESLIE-------DPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSE---------EEVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   A ++   L+ + E       +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   49 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGASQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1093          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18867|KCMA1_MACMU (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Macaca mulatta OX=9544 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSE---------EEVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   48 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1092          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q28204|KCMA1_BOVIN (Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 370/1078 (34.32%), Postives = 615/1078 (57.05%), Query Frame = 2
Query:  380 MNIECPT--QRKWYWFIAVDSLAYFGGLLLLVIWKII-----INAFHRKRLKISQSTNFETACRSQKNL-------ESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSE---------EEVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRNNQFRINLTPVSQINKT-VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            M + C +  QR W+ F+A   + +FGGL ++++W+ +     +      + K +Q  N   + ++   L       E++  +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L++ F S  +  AGF HL+ENSG+      + N+Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LL+IAIE K S +++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D+   T+  + K               L + D      ND  +++ +D     Y   G F+ C+P+++ K +++ SE  +  L GH+++CIF D  ++ IG+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  ++NVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         +    T   L  R+   R  +  ++ ++    +  +   Y D+F + +  +  +  G+YR R+     T  +   RYVITNPP  F + PTD+++CL Q
Sbjct:   63 MEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKIN-NGSSQADGTLKPVDEKEETVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWEN--FQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYK-SANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLSPKKKQRNGGMRNSPSSSPKLMRHDPLLIPGND--QIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRD---RCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1107          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A1B6HFZ4 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.43282 PE=4 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 398/1127 (35.31%), Postives = 621/1127 (55.10%), Query Frame = 2
Query:  383 NIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---SPDDYELTVISR---------LKSEEEVSLTKCDVEN-------------------------------------DFKEMEFIDEKC-CSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQA----ESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPSSDEKK*NS 3547
            N EC  +RKW+ F+      +  GLL++++W++      RK  + S +   +   ++ +  +   E  +F    + +  +LIS Q   GRI+  +  + ++ S ++Y   I     ++EKC   +N +    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  N++K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN Q + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS IPE+ E +   S+Y G   +  G+RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++K PD+E++ L K +FT V++FQG++M+ +DL RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  ++W NDY++G   E+Y+  L+ SF   ++ +  E CF  L LLL+AIE+K        + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK      D  +  V +R         + S ++V+  K +V                                       D +  +F  EK    Y   G F+  SP + +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  CVIL+ K    D   D  + DKE I+A+L  +A    ++   + +++S +  A++            E  N     G       +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD V+ L Q       G E+ P S+  K+ NS
Sbjct:   18 NAECLKERKWWCFLLSSIFTFLAGLLIVLLWRVFAFLCCRKEPEFSPNDPKQKEQKAARQGKQEFEG-TFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYF--IDASSEEVEKCQSWSNNVTQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNILKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPME---FNNPQQLSYWTCVYFLIVTMSTVGYGDVYCQTVLGRTFLVFFLLVGLAIFASSIPEIIELVGTRSKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGSIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDTQAWQNDYLQGTGCEMYTETLAPSFTGMTFPQASELCFTKLKLLLLAIEIKGEDGNDSKISINPRGAK-ISANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNCETGRDREDALVANRNLRNTPTAMVNSTKQVNKVKPNVNRTPNDIISPNSGYNNRPTQRGTPGNNVNNNGGLTVGIADDQAKDFDFEKTEMKYDSTGMFH-WSPARNLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGAVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCVILSAKVPSND---DPTLADKEAILASLNIKAMTFDDTIGVLSQDDSGVVSARN------------EHENLQTIGGGPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTSDSLSNRDRCRVGQISLYDGPLAQFGEAGK------YGDLFVSALKTYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQ----FDPGLEYKPASNRGKEENS 1106          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A4W3HWC2 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 383/1078 (35.53%), Postives = 602/1078 (55.84%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKI------IINAFHRKRLKISQSTN--FETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-----QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            E   QR W+ F+A   + +FGGL ++++W+       +    + K   I + TN  F  A  + KNLE   E P   V +    + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L + W+GLRF+R L LI+  E++Q  N++K+  SI+++ LI+ F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLIL ++ C DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL PG ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++   +  + K               L + D      ND  ++E +D     Y   G F+ C P+ + K +++ SE  +  L GH+++CIF D++++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ +V      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +          S  N        Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+     T    + RYVITNPP  F + PTD+++CL Q
Sbjct:   37 ESKEQRMWWAFLASSMVTFFGGLFIILLWRTFNYLWTVCCHCNPKNKDIQKFTNVVFSQADANSKNLEEKEELPVAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSDPIESCQDFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLSRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLISIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILTNKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSGAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDKRESSILINPGNNVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEHPSALSPKKKQRNGGMRNSPNGSPKLMRHDPLLIPGND--QIEEMDANVKKYDSTGMFHWCLPKDIEKVILTRSEAAMTVLSGHVVVCIFGDSKSALVGLRNLVMPLRASNFHYHELKHIVFVGALEYLKREWETLHNFPKVTIVAGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRASPDNSPVHGIVRQTSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HMCTPSPCIKRYVITNPPYEFEMVPTDLIFCLMQ 1077          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A1B6HKE7 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.43307 PE=4 SV=1)

HSP 1 Score: 667.537 bits (1721), Expect = 0.000e+0
Identity = 390/1104 (35.33%), Postives = 610/1104 (55.25%), Query Frame = 2
Query:  383 NIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKG---SPDDYELTVISR---------LKSEEEVSLTKCDVEN-------------------------------------DFKEMEFIDEKC-CSYKKNGNFYTCSPQKLMKNVISSEHQ--IENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQA----ESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGS--ETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---------QDDNDTEINLEQRN----NQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            N EC  +RKW+ F+      +  GLL++++W++      RK  + S +   +   ++ +  +   E  +F    + +  +LIS Q   GRI+  +  + ++ S ++Y   I     ++EKC   +N +    DLA N  F++YF +RF  +++KL F L  ++ +D FTIP    ++ LD+ WIGLRF+R L L+ V +++Q  N++K+ +SIR+ QL++ F S+ +  AG  HLLENSG+      +NN Q + Y   +YF+IVTMSTVGYGD++ +T+ G+ F+V F+L+ LA FAS IPE+ E +   S+Y G   +  G+RHI+VCGHI Y SVS FL DFLHEDR   DV+V+F+++K PD+E++ L K +FT V++FQG++M+ +DL RV++  ADACL+LA++ C DP+ EDA NIMR IS KNY     VIIQL+Q+ NK YL NIP+W+ + GD +IC +E++LG +AQSCL PGFST++ N+F++RS    K +P  ++W NDY++G   E+Y+  L+ SF   ++ +  E CF  L LLL+AIE+K        + +NP   K I   + GFFI  S  +   A  YC  CH  ++D T +K C CK      D  +  V +R         + S ++V+  K +V                                       D +  +F  EK    Y   G F+  SP + +++ I   +Q  +  L GH+++C+F+D  +  IG+RN +MPLR+     +ELK +VI+   D+I +EW  +   PKI V+      R     ++++ C  CVIL+ K    D   D  + DKE I+A+L  +A    ++   + +++S +  A++            E  N     G       +GS     VP+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMST Y+NQNA+ ++  LI GG+  +L+         +    T  +L  R+     Q  +   P++Q  +         Y D+F+  +  +  + +GLYR R+     +   +  RYVITNPP +F + PTD  + L Q
Sbjct:   18 NAECLKERKWWCFLLSSIFTFLAGLLIVLLWRVFAFLCCRKEPEFSPNDPKQKEQKAARQGKQEFEG-TFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYF--IDASSEEVEKCQSWSNNVTQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNILKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPME---FNNPQQLSYWTCVYFLIVTMSTVGYGDVYCQTVLGRTFLVFFLLVGLAIFASSIPEIIELVGTRSKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGSIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRS---FKTSPDTQAWQNDYLQGTGCEMYTETLAPSFTGMTFPQASELCFTKLKLLLLAIEIKGEDGNDSKISINPRGAK-ISANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNCETGRDREDALVANRNLRNTPTAMVNSTKQVNKVKPNVNRTPNDIISPNSGYNNRPTQRGTPGNNVNNNGGLTVGIADDQAKDFDFEKTEMKYDSTGMFH-WSPARNLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGAVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCVILSAKVPSND---DPTLADKEAILASLNIKAMTFDDTIGVLSQDDSGVVSARN------------EHENLQTIGGGPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTSDSLSNRDRCRVGQISLYDGPLAQFGEAGK------YGDLFVSALKTYGMLCIGLYRFRD--TSSSCDASSKRYVITNPPDDFSLLPTDQAFVLLQ 1087          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A4W3HVA0 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 383/1078 (35.53%), Postives = 602/1078 (55.84%), Query Frame = 2
Query:  389 ECPTQRKWYWFIAVDSLAYFGGLLLLVIWKI------IINAFHRKRLKISQSTN--FETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEE---------EVSLTKCDV----ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-----QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            E   QR W+ F+A   + +FGGL ++++W+       +    + K   I + TN  F  A  + KNLE   E P   V +    + +   +IS Q L GR++  +    ++ + V+Y    I     +E C           D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L + W+GLRF+R L LI+  E++Q  N++K+  SI+++ LI+ F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  ++GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLIL ++ C DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL PG ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  +I  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++   +  + K               L + D      ND  ++E +D     Y   G F+ C P+ + K +++ SE  +  L GH+++CIF D++++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ +V      R     ++I+ C  CVIL+ N+ NI    +D  + DKE I+A+L            N   ++   SI +  A  +          S  N        Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+     T    + RYVITNPP  F + PTD+++CL Q
Sbjct:   38 ESKEQRMWWAFLASSMVTFFGGLFIILLWRTFNYLWTVCCHCNPKNKDIQKFTNVVFSQADANSKNLEEKEELPVAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSDPIESCQDFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLSRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLISIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILTNKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKIEE----DTWQKYYLEGVANEMYTEYLSGAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDKRESSILINPGNNVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEHPSALSPKKKQRNGGMRNSPNGSPKLMRHDPLLIPGND--QIEEMDANVKKYDSTGMFHWCLPKDIEKVILTRSEAAMTVLSGHVVVCIFGDSKSALVGLRNLVMPLRASNFHYHELKHIVFVGALEYLKREWETLHNFPKVTIVAGTPLSRADLRAVNINLCDMCVILSANQNNI----DDTSLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRASPDNSPVHGIVRQTSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HMCTPSPCIKRYVITNPPYEFEMVPTDLIFCLMQ 1078          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A2I4B5Y2 (calcium-activated potassium channel subunit alpha-1-like isoform X12 OS=Austrofundulus limnaeus OX=52670 GN=LOC106517014 PE=4 SV=1)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 374/1075 (34.79%), Postives = 614/1075 (57.12%), Query Frame = 2
Query:  383 NIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKC-YPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLK-----------SEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            ++ C +QR W+ F+A   + +FGGL ++++W+ +          NA  + RL++ + T  +   R+ K  ++   +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C Y   +     D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   +D + T+  + K           S  ++      +    +++E +DE    Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ IG+RNF+MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+     T+ +   RYVITNPP  F + P+D+++CL Q
Sbjct:   28 DMPCDSQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNAKKKVRLEVHRITTGDGIKRADKE-DAAASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSKPIESCQYFYKDYTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALFYCKACHDDITDPKRIKKCGCKKFEEDQQSTLSPKKKQRNGGMRNSPNSSPKIMRHDPLLIPGSEQIESMDENVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELKHIVFVGSLEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLNTQSQCTKRYVITNPPYAFELVPSDLIFCLMQ 1066          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050702.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 372/1088 (34.19%), Postives = 602/1088 (55.33%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETA------CRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTK--CDVEN---------DFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESKR-------RIMKNNSKIE-MAKSISIKAAGGETQIERTNQSKSEGNET-FQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +      + K+  + +  N   A         +K   + + +  +  + + +   +IS Q L GR++  +    ++ + V+Y  +       +E C      I    D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   + ++ T+  + K       T   C  +N            +ME +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L              QA S+        R    NS +  + +  S+        I    +S    N    +  K   T +P+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDS---SDPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRFEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1097          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000044980.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000044980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 377/1103 (34.18%), Postives = 604/1103 (54.76%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETA------CRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLT-----------------KCDVEN---------DFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESKR-------RIMKNNSKIE-MAKSISIKAAGGETQIERTNQSKSEGNET-FQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +      + K+  + +  N   A         +K   + + +  +  + + +   +IS Q L GR++  +    ++ + V+Y    I     +E C      I    D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK S  +Y       +KS EEV  +                  C  +N            +ME +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L              QA S+        R    NS +  + +  S+        I    +S    N    +  K   T +P+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYF---IDSSDPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYN----GYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1108          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:48528:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 375/1103 (34.00%), Postives = 602/1103 (54.58%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETA------CRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLT-----------------KCDVEN---------DFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESKR-------RIMKNNSKIE-MAKSISIKAAGGETQIERTNQSKSEGNET-FQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +      + K+  + +  N   A         +K   + + +  +  + + +   +IS Q L GR++  +    ++ + V+Y  +       +E C      I    D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FA ++PE+A  +    +Y G Y    GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK S  +Y       +KS EEV  +                  C  +N            +ME +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L              QA S+        R    NS +  + +  S+        I    +S    N    +  K   T +P+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDS---SDPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYN----GYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1108          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000051878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000051878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 378/1134 (33.33%), Postives = 608/1134 (53.62%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETA------CRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPD-----------------DYELTVISR-LKSEEEVSL----------------TKCDVENDFKEMEFIDEKCCSYKK---NGNFYT---CSPQKLMKN--VISSEHQIEN------------------------------------LRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +      + K+  + +  N   A         +K   + + +  +  + + +   +IS Q L GR++  +    ++ + V+Y  +       +E C      I    D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK S                   DY    +SR ++S  E +                 +K +     K +E + +   S KK   NG   T   CSP+ L  +  +I S  Q+E                                     L GH+++CIF D +++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L      K  +  ++  +  A S      G    ++R++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDS---SDPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL----NIKSMLFDDSIGLLQANSQGFTPPG----MDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1135          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000004500.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000004500.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 381/1154 (33.02%), Postives = 609/1154 (52.77%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETA------CRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPD-----------------DYELTVISR-LKSEEEVSL----------------TKCDVENDFKEMEFIDEKCCSYKK---NGNFYT---CSPQKLMKN--VISSEHQIEN------------------------------------LRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL------------FFQAESK-------RRIMKNNSKIE-MAKSISIKAAGGETQIERTNQSKSEGNET-FQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +      + K+  + +  N   A         +K   + + +  +  + + +   +IS Q L GR++  +    ++ + V+Y  +       +E C      I    D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQP+ Y + +Y ++VTMSTVGYGD+ AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK S                   DY    +SR ++S  E +                 +K +     K +E + +   S KK   NG   T   CSP+ L  +  +I S  Q+E                                     L GH+++CIF D +++ +G+RN +MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L              QA S+        R    NS +  + +  S+        I    +S    N    +  K   T +P+I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + PTD+++CL Q
Sbjct:   33 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNVKKKDVQRVINPIGAGDGVGKVGDKKEAAAAVSEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDS---SDPIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLMQ 1163          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006399.1 (pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 358.221 bits (918), Expect = 3.358e-113
Identity = 170/385 (44.16%), Postives = 254/385 (65.97%), Query Frame = 2
Query: 1088 ENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSP 2242
            ENSG+      + N Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FA ++PE+A  +    +Y G Y+   GR+H++VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L + +FTQV+++QG+V++ +DL RV++  ADAC+I+A++ C DP+ EDA NIMR IS KNY  R  VI Q+LQ+ NK +L NIP+W+ R GD  IC SE++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LLLIAIE +   S    +L+NP +  RI  G++ FFI +  ++   A  YC  CH  + D   +K C C+  P
Sbjct:    1 ENSGDPWRD--FQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE----DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSCRQCP 379          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006404.1 (pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 356.295 bits (913), Expect = 2.691e-112
Identity = 169/383 (44.13%), Postives = 254/383 (66.32%), Query Frame = 2
Query: 1085 LENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCK 2233
            +ENSG+      + N Q + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FA ++PE+A  +    +Y G Y+   GR+H++VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L + +FTQV+++QG+V++ +DL RV++  ADAC+I+A++ C DP+ EDA NIMR IS KNY  R  VI Q+LQ+ NK +L NIP+W+ R GD  IC SE++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E CF  L LLLIAIE +   S    +L+NP +  RI  G++ FFI +  ++   A  YC  CH  + D   +K C C+
Sbjct:   22 VENSGDPWRD--FQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE----DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSCR 398          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007042.1 (pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 gene:ENSPMAG00000006371.1 transcript:ENSPMAT00000007042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.868 bits (577), Expect = 4.483e-68
Identity = 105/215 (48.84%), Postives = 151/215 (70.23%), Query Frame = 2
Query: 1352 RHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSN---ESWLNDYMRGVTMEIYSAKLSRSFNEFSY 1987
            RHI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++  ADACLILA++ C DP+ EDA NIMR IS KNY  R  VI Q+ Q+ NK +L NIP+WN + GD  IC +E++LG +AQSCL PG ST+L N+FS+RS  +    P     ++W   Y+ GV+ E+Y+  LS +F   S+
Sbjct:    1 RHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIEAADACLILANKYCGDPDAEDASNIMRVISIKNYHPRIRVITQMQQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKRVPLPHQIEEDTWQKYYLEGVSNEMYTEYLSNAFTGLSF 215          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: KCNT1 (potassium sodium-activated channel subfamily T member 1 [Source:HGNC Symbol;Acc:HGNC:18865])

HSP 1 Score: 96.2857 bits (238), Expect = 5.040e-21
Identity = 60/207 (28.99%), Postives = 106/207 (51.21%), Query Frame = 2
Query: 1130 SQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGR--RHIIVC-GHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKI--YFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQ 1735
            ++ I    SLYF IVT STVG+GD+  K    ++ VV+ I +AL        EL        +  G Y +   +  +H+++C   +    +  FL +F    R   D   + +   + D +++ +L +  +  +V Y QG+ +   DL RV++ +A+AC IL  +N  D    D   I+RA + K++   CP+ +Q+L+ ENK +++
Sbjct:  219 AENISLFRSLYFCIVTFSTVGFGDVLPKIWPSQLLVVIMICVALMVLPVQFEELVYLYMERQKSGGNYSRYRAQTEKHVVLCVSSLKLDLLMDFLNEFYAHPRLQ-DFYTVILCPTDMDSQVRRMLHVPLWAQRVIYLQGSALKDQDLVRVKIDDAEACFILTSRNEVDRTAADHQTILRAWAVKDFAPSCPLYVQILKPENKFHVK 424          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 60.8474 bits (146), Expect = 1.351e-9
Identity = 66/259 (25.48%), Postives = 110/259 (42.47%), Query Frame = 2
Query:  752 LTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLD--------QEWIGLRFIRVLSLIRVFEVIQCFNVVKS--------GTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIK------IAGRRHIIVCGHINYA----SVSTFLTDFLH-EDRSSSDVD 1447
             T+P F  +  C   F    L+RFF    K  F+     +ID   I      L  +        Q+ + L  +RV+ L+RVF + +     K           S+R + L+ +F   L +G   F    +S    + + + NS+     D+ ++ +VTM+TVGYGD+   T+ GKI   L  +  + T A  +P +       S +  FY +       A   H+  C H   +    S S   ++++  +D  S+DVD
Sbjct:  210 FTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEMAKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFF---LFIGVILF----SSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIV------SNFNYFYHRETDNEEHANYLHVSSCSHQEESRKSRSPSMSRSEYMEMDDGLSNDVD 455          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO32743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU69])

HSP 1 Score: 123.635 bits (309), Expect = 1.583e-28
Identity = 105/373 (28.15%), Postives = 175/373 (46.92%), Query Frame = 2
Query: 1001 KSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIK-IAGR-RHIIVCG-HINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLK--IYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRS--FNEFSYKELVEFCF---KNLNLLLIAIEVKDSVSKKKMLLMNP 2089
            +S  S +V+ LIT    IL       H LE +           S       +L+F+IVT STVGYGD        + FV++ I +AL      +  LA  LF+  +  G Y   +AG  RH+++C   +   ++  FL +F + D    DV V+ +   + D  ++ LL+  ++  +V Y +G+ +   DL R +  NA  C ILAD+  +D    D   I+R  + +++    P+ +Q+L+ ENK ++           + ++C  EI+  +LA +C+ PG STL+T +     E+  +    +E W   Y +    EIY  +L  S  F  ++YK      F   K   + LI ++      K   L++NP
Sbjct:  215 QSALSQKVLILITTVVCILFTSVCGIHHLERA-----------SLQWSMMKTLWFVIVTFSTVGYGDTVPTHWTTQTFVMIMIGIALVLLPIELERLAFLLFSRQKEGGAYNHLLAGTDRHVVLCATTLRTGTLIDFLNEF-YADSRLHDVHVVLLCPSDLDSTLRILLQVPVWAQRVTYLKGSALIDEDLVRAR-RNAAGCFILADRYAADREAADQHTILRTWAIQDFAPATPLFVQILKPENKFHVS--------FAEHVVCEDEIKHALLAVNCVCPGISTLVTLLLHTLHEQYVR---GSEKWHEIYGKCAGNEIYDIRLGDSMIFRPYAYKSFTHAAFHAHKKYGVTLIGVKRH---GKGGRLMLNP 560          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO28098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F3])

HSP 1 Score: 67.781 bits (164), Expect = 8.710e-13
Identity = 32/111 (28.83%), Postives = 61/111 (54.95%), Query Frame = 2
Query: 2456 HIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANL 2788
            HI++C+F+      +G+R  +MPLR+  +  ++LK++V + DKD+++ EW EIC F ++ ++      R     ++ +     V L+      D   D  + DK+ I+A+L
Sbjct:   72 HILVCVFNKKEDPLVGLRKMVMPLRASNLHRSDLKKIVFLGDKDYMKLEWEEICNFHEVYILPGSPFCRADLRAVNANLADMVVFLSGTA--VDQAGDPRLADKQSILASL 180          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAK5 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS8])

HSP 1 Score: 61.2326 bits (147), Expect = 1.158e-9
Identity = 50/160 (31.25%), Postives = 80/160 (50.00%), Query Frame = 2
Query:  797 FLIYFLLRFFTSTEKLAFWLGFHTVIDC-----FTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSG---------TSIRVIQLITYFASILIVGAGFFHLLENSGEI-TSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKI 1231
            F + +L+RF +S +K  F   F  VID      F I  IL ++  +   + L F+R+L L+RVF + +  +   SG          S+R + L+ +F   L +G   F  +    E  T  +    S P    D+ ++ +VTM+TVGYGD+  KT+ GK+
Sbjct:  199 FTLEYLVRFLSSPKKCPFVRSFLNVIDILAIVPFYIDLILNSVQSNDGTLSLAFLRILRLVRVFRIFK-LSRHSSGLQILGLTLRKSLRELGLLIFF---LFIGVVIFSSMAYYAEAGTKDTHLGRSIP----DTFWWALVTMTTVGYGDLVPKTLWGKL 350          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: SHAKR1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Y6])

HSP 1 Score: 57.7658 bits (138), Expect = 1.297e-8
Identity = 85/309 (27.51%), Postives = 140/309 (45.31%), Query Frame = 2
Query:  398 TQRKWYWF----IAVDSLAYF---GGLLLLVI---WKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQ--ILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIG-YGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIP 1285
            + +K Y+F    +A DS+ YF    G LL  +    K  +N  +   L+   S  F  A  S  +L S + D +        V +L  + F   ++VA  +    LLS V++  E   LP   E     ++ ++  ++ C   F +  LLRF T   K  F + F  +ID   I    I+  L   ++   L F+R+L L+RVF +   F + +    ++V+ L T  AS+  +    F LL      +SG +Y  S       ++ +F +VTM+TVGYGD    +  GK+   +  +  + T A  +P
Sbjct:   39 SMKKEYFFDRNRVAFDSILYFYQSNGKLLRPVDLDMKTFVNEVYFFELEDLVSHQFIEAYGSDTSLVSKMPDNAIQRKIWE-VLELPHSSF-TAQVVAVWSVGVILLSIVVFCIE--TLPGLRETRTEKSSALYSIEILCVAWFTLELLLRFLTCPNKPHFIISFLNIIDVLAILPYYIMLGLGDTKDTSTLAFLRILRLVRVFRI---FKLSRHYRGLKVLGL-TLKASLRELLLLTFFLLMGVIVFSSGVYYAESTHFSSIPEAFWFSVVTMTTVGYGDKAPLSTWGKLVGSMCAIAGVLTLALPVP 339          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO47871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL57])

HSP 1 Score: 56.225 bits (134), Expect = 5.114e-8
Identity = 66/297 (22.22%), Postives = 125/297 (42.09%), Query Frame = 2
Query:  488 NAFHRKRLKISQSTNFETACRSQKNLESLIE--DPSFSVAFRSYVNQLISTQF---------LIGRIVASIATVAALLSTV-LYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQI---LTALVLDQEWIGLRFI---RVLSLIRVFEVIQCFNVVKSGTSIRVIQL--------ITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGK-------IFVVLFILLALATFAS 1276
            N FH++   +      + A +   N++   +  D    V  RS + +L    +          + +IV  +++   +LSTV L L  I  L +KL+      N +    +  C   F + +L+R  ++   + F       ID   I      L +L  D + +  RF+   R+L ++R+  +++ F + +    ++ +          +    ++LI+G   F  L    E    +    S P    ++ ++ I+TM+TVGYGD++  T  GK       I  ++FI L + T  S
Sbjct:  120 NHFHQENEAVENLMKIKEAFKKDLNMKKEQDEVDLLLEVESRSKLARLKRKMWDLFENPHSSFMAKIVYLLSSFFVMLSTVALCLNTIDSLRIKLDNGETADNAVLAGIEAGCIAWFTVEYLIRLLSAPRIVPFLKSIMNTIDLLAILPYYFELLSLAFDNQ-LDYRFVEMRRILQILRILRIVRIFKMARHSVGLQTLAYTFKQSTAELGLLGTLLIMGMTLFSSLVYFAEEAEPNSMFKSIP----EAFWWSIITMTTVGYGDVYPVTPLGKLVGSLCCISGIIFIALPIPTIVS 411          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: ENSORLT00000011055.2 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:101155390])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 367/1054 (34.82%), Postives = 611/1054 (57.97%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKIIINAF------HRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCD------VEND------FKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETF-QVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLD---QDDNDTEINLEQRNNQFRINLTPVSQI----NKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +   +        K+ ++ + T  E   R  K  +S   +  +  + + +   +IS Q L GR++  +    ++ + V+Y  +    P++  K +  +N     D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C+DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++LG +AQSCL  G ST+L N+FS+RS  + ++    ++W   Y+ GV+ E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++   L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   +D   + +S  K +    +          + +D       +++E +DE    Y   G F+ C  + + K +++ SE  +  L GH+++CIF D +++ IG+RNF+MPLR+     +ELK +V +   +++++EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI    +DA + DKE I+A+L      K  +  ++ ++  A S      G    ++R++   S  +    Q S  +   +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+    ++N  +            +   V+Q+        +  +   Y D+F + +  +  +  G+YR R+      + +   RYVITNPP  F + P+D+++CL Q
Sbjct:   36 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCKAKKKEVHRITTGEHIKRVDKG-DSAASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDS-SDPIEFCKHF-YSNYTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE----DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYK-SDQRESSTLINPGNHVKMQEGTLGFFIASDAKEVKRALFYCKACHDDISDPKRIKKCGCKKFEEDRH-SALSPKKKQRNGGMRNSPNSSPKIMRHDPLFIPGSEQIESMDENVKKYDSTGMFHWCPSRDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELKHIVFVGSLEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----DDASLQDKECILASL----NIKSMLFDDSIRVLQANSQGFTPPG----MDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALKGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLNAQSQCTKRYVITNPPYAFELVPSDLIFCLMQ 1065          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 375/1074 (34.92%), Postives = 602/1074 (56.05%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLK------------SEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNE-TFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N   ++  K++   N + A R  K  +   E P+  V +    + +   +IS Q L GR++  +  V AL    L +Y  I     +E C    +      D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  E ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K            S + +S     +    +++E +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI     DA + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  + + +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + P+D+++CL Q
Sbjct:   58 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRPPKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYK-SEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----EDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQ 1096          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 381/1094 (34.83%), Postives = 607/1094 (55.48%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVK----DSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLK------------SEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANL---FFQAESKRRIMKNNSK------IEMAKSISIKAAGGETQIERTNQSK--------SEGNETFQVS----KGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N   ++  K++   N + A R  K  +   E P+  V +    + +   +IS Q L GR++  +  V AL    L +Y  I     +E C    +      D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  E ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K    +S S+K+ +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K            S + +S     +    +++E +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI     DA + DKE I+A+L     Q +    +++ NS+      ++ +   S    G   Q   T  S           G     VS    K S T + +I++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + P+D+++CL Q
Sbjct:   58 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRPPKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKR-ILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----EDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELAKPGKLMPLVSHSQEKKSGTSIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQ 1128          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 377/1107 (34.06%), Postives = 604/1107 (54.56%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVK----DSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSL---TKCDVEND--------------------------------------FKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNE-TFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N   ++  K++   N + A R  K  +   E P+  V +    + +   +IS Q L GR++  +  V AL    L +Y  I     +E C    +      D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FAS++PE+ E +    +Y G Y  + GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C DP+ EDA NIMR IS KNY  +  +I Q+LQ+ NK +L NIP+WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  E ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K    +S S+K+ +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   +    T      S++E  +     C++  D                                       +++E +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI     DA + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  + + +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + P+D+++CL Q
Sbjct:   58 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRPPKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKR-ILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRPAEG--ATTPGNTGSQKEAGVRFKADCNIVEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----EDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRD-AHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQ 1127          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 359/1074 (33.43%), Postives = 580/1074 (54.00%), Query Frame = 2
Query:  401 QRKWYWFIAVDSLAYFGGLLLLVIWKII---------INAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAF----RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLK------------SEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVIS-SEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILN-NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGE----TQIERTNQSKSEGNE-TFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINL-TPVSQINKT--------------VNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            QR W+ F+A   + +FGGL ++++W+ +          N   ++  K++   N + A R  K  +   E P+  V +    + +   +IS Q L GR++  +  V AL    L +Y  I     +E C    +      D+A N  FL+YF LRF  + +KL FWL  ++V+D FT+P +  ++ L++ W+GLRF+R L LI+  E++Q  N++K+  SI+++ L + F S  +  AGF HL+ENSG+      + NSQ + Y + +Y ++VTMSTVGYGD++AKT  G++F+V FIL  LA FA ++PE+A  +    +Y G Y    GR+HI+VCGHI   SVS FL DFLH+DR   +V+++F++   P++E+++L K +FTQV+++QG+V++  DL RV++ +ADACLILA++ C DP+ EDA NIMR   +                           WN + GD  IC +E++ G +AQSCL  G ST+L N+FS+RS  E ++    ++W   Y+ GV  E+Y+  LS +F   S+  + E C+  L LLLIAIE K S  ++  +L+NP N  ++  G++GFFI    ++   A  YC  CH  + D   +K CGCK   D++  T+  + K            S + +S     +    +++E +D     Y   G F+ C  + + K +++ SE  +  L GH+++CIF D  ++ +G+RN +MPLR+     +ELK +V +   D++ +EW  +  FPK+ ++      R     ++I+ C  CVIL+ N+ NI     DA + DKE I+A+L            N   ++   SI +  A  +      ++R++   S  +    Q S  + + +PII++L  +SNVQ+LD  +D+  +   YL +PFA G AF  S+LDSLMS  Y+N N + ++  L+ GG+  +L+         L    N  R    TP +  N+                +  +   Y D+F + +  +  +  G+YR R+        +   RYVITNPP  F + P+D+++CL Q
Sbjct:   58 QRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCNIKKKEVQKVNNFANNQAADRPPKGPDEKEEAPASEVGWMTSVKDWAGVMISAQTLTGRVL--VVLVFALSIGALGIY-FIDSSDPIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWEN--FQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGSYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRYTLYH-------------------------IWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE----DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYK-SEQRESSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNI----EDASLQDKECILASL------------NIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELE--------GLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA-HLGAPSQCTKRYVITNPPYEFELVPSDLIFCLMQ 1071          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000044594.1 (SMESG000044594.1)

HSP 1 Score: 2151.71 bits (5574), Expect = 0.000e+0
Identity = 1047/1053 (99.43%), Postives = 1049/1053 (99.62%), Query Frame = 2
Query:  380 MNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPSSDEKK 3538
            MNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFR YVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDL RVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSP DYELTVISRLKSEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDD+DTEINLEQRNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVET+DRYVITNPPPNFPIEPTDMVYCLQQKCLPKPK KEFSPPSSDEKK
Sbjct:    1 MNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRPYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLHRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPGDYELTVISRLKSEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDSDTEINLEQRNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLRKETRVETIDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKRKEFSPPSSDEKK 1053          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000014623.1 (SMESG000014623.1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 371/1048 (35.40%), Postives = 612/1048 (58.40%), Query Frame = 2
Query:  398 TQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKIS----QSTNFETACRSQKNLESLIEDPSFSVAF-RSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKC--YPLTNPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQ-NPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKS-EEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIK-VVFHQISIRRIAHLISIDTCSRCVILN---NKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVP---IISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINLTPV--SQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYR----KRNLLRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQ 3475
            +++KWY F+  + +  F GL LL++WK+I   + +   K+S       +++    S  N    I + + ++   R + ++ IS Q   G+I+  IA V   ++   Y+YE    P+++E+C  Y     +   DL C   F  Y+++RF  +  K+ FW G ++++D  TIP     + LD  W+GLRF+R + L++V +++Q   V+KS T  R+ QL T F  + IVG+G  H+LEN+G+    +  N+   + +GDS+YF IVTMSTVGYGDI   +  GKI+V +FIL++ A FASFIPE+AE LF+GS+Y G Y+     +HI+VCG+  ++S+ +F+ DF +EDR  S ++V+FIN++EPD E+++LLK+ F + K+ +GTVMDQVDL R  +  ADAC ILA+ NC +P DEDA NIMR IS KN+     V+IQLLQ+ENK+YL NIPTWNK  GD ++CYSE+EL ILA+SCL+PG+ST ++N+FS+RSE +CK+   S  SW+NDY+ G+ +E+Y++ LS S    ++ +LV F ++ LNLLLIA+EVK  +   K + +NP +       +VG+FIC+S++++    +YC+ CH    + T L+V       D ++   I+++ S  E++  T   +     +   +D+     +K  +F  C  +   +++I +  +      HIILCIF+DN + SIG++NF++PLRS  +   +L+ ++I ++++F+ +EW  +  FP +  + F+ I+ + ++ ++ ++ C  CVI++   +K N A+L  D ++VDKEII+  L  ++  K+++ K        K I                             G   ++P   +I+KL +E+NVQ+LD  +++  N P +L + FA G AFTT MLD L+S AY+N +   ++  LI  G +   +  +++   N+   N + +I +  +   +       +N   Y+++F      +  + LGLY+     +N+L    +     + ++TNP   F +   D V  LQ
Sbjct:    5 SEKKWYVFLLTNVIIIFSGLFLLLLWKLIKFIYGKISKKLSPINASQGSYKAGEFSGGNNSGRINEENQNIQIIRVWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVK--MRNGKTVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGA-NEGTPLRV-------DKFKCVCINKVASLNEKIRQTSFRLSRQQFQYAILDKA----EKEIDFLKCDYKDFKESLIKNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLS-VLQVENCHVCVIMSARVSKRNAANL--DFHLVDKEIILGTLNVKSIFKKKLQK--------KFI-----------------------------GKSGEIPNRFLITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLI-AGEIHCFENINDEESTNMANNNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFKHYHLLLLGLYKVVETTQNILSSSKK-----KVILTNPDGEFSVSCYDSVLGLQ 992          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000050831.1 (SMESG000050831.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 383/1092 (35.07%), Postives = 609/1092 (55.77%), Query Frame = 2
Query:  407 KWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKR-LKISQSTNFETACRSQKN-LESLIEDPSFSVA-------FRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPD---------DYELTVI--SRLKSEEEVSLTKCDV-------------------ENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVI---SSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAES---KRRIMKNNSKI--EMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQD------------DNDTEINLEQ-RNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNL-------LRKETRVETVDRYVITNPPPNFPIEPTDMVYCLQQ 3478
            KWY F+A        G+L++  +++I N     R   ++   N      S+ + +++  +D    V         + +  ++IS Q L G+ + S+  + ++ S  +YLYE+       E C      +    DLA N +FL+YF LRF  S +KL FWL  ++ +D +TIP     L L + WIGLRF+R + L+ + +V+   NV+KS +SIR+  L T F S++I  +GF HL+E+SG        +N Q   + D  YFIIVT+STVGYGDI  +T  GK+ ++ FIL  LA FA+ IPE+ E + + ++Y   + K   ++HII+CGHI Y SVS FL DFLH+DR   DV ++ +N   P++E+K++LK YF  V+++QG+ M+  DL R+Q+ NADACL+LA++   DP+ EDA NIMR IS KN+C R  VI+QL+Q+ NK YL NIP+W+ + GD  +C +E++LG +AQSCL PGFSTLL N+F++RS K     P   +WLN Y+ G  ME+YS   S +F+  ++ E V   FK L LLLIAIE K +V+++  + +NP N  +I PG  GFFI  S  ++  A  +C +CH   R    +K C C               +E T    S+L+S++    +K  +                   +  F+ + F ++    +   G F+ C P++ +++V+   S + ++     HI++C+F+++ ++ IG+ NF+MPLR+     +EL  +V I + +++++EW  +  FP + ++      R     ++++    CVIL++K+N  +  +DA++VDKE I+ +L  QA S       M+N  ++  +++KS+S  + G E  +     SKS  +            + +I++LAI+SNVQ+LD  +++      ++ +PFA G AF  S+LDSLMSTAY+N+NA+ ++  LI GG+  DL+Q               DT  N ++ R    ++   P+++I  + N      Y  +F+E + +   + +GLYR  NL               +  RYVITNPP    I  +DMVYCLQQ
Sbjct:   19 KWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLNLTDEGLSRPDFIDTKFDDDQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYLGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSG---GPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLP---NWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLN-RHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSKLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQISRRFDTTGMFHWC-PERPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSN--NSMDDAFLVDKEAILCSLNVQAMSFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGAD------------IKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCN--YGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYCLQQ 1086          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000076792.1 (SMESG000076792.1)

HSP 1 Score: 527.324 bits (1357), Expect = 1.991e-167
Identity = 344/1026 (33.53%), Postives = 543/1026 (52.92%), Query Frame = 2
Query:  560 NLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLP-LKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKK--MLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSP--DDYELTVIS-----------------------------RLKSEEEVSLTKCDVEND-FKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIEN--LRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDN------------DTEINLEQ-RNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRK--RNLLRKETRVET-VDRYVITNPPPNFPIEPTDMVYCLQ 3475
            NL+ +IE        + +  ++IS Q   GR++ SI +  +L S ++Y  EI  L  +  E C   +       DLA N VFLI+F LR+  +T+K  FW+  ++++D  T+P      VL++ W+GLRF R L LI   +V+   N++KS + IR+  L+T F S+++  AGF HL+E +G+I   +   N Q   Y D  YF+I TMSTVGYGDI  KT  GK+ ++ FIL  LA FA+ IPE+ E +   ++Y G + K  G++HII+CGHI +              R++ D          P  E  S+ K            V  +    RVQ+  ADACLIL D+   DP+ EDA NIMR IS KNYC    VI+QL+Q+ NK YL NIP+W+ R GD ++C +E++LG +AQSCL PGFSTLL N+F +RS K+    P    W+N Y+ G ++E+Y+  LS SF+  ++ E V  CF  LNLLLIA+EVK +  +     + +NP     I PG+ GFFI +S  DA  A  YC  CH + +   ++K C C+ S    D    ++S                             R +   + +  +    ND    ++F ++    +   G F+ CS ++    +++++  + +     HI++CIF+D  +  IG+R+F+MPLRS     NEL++++ +  +D++ +EW  +  FPKI V+      R    +I+I+ C   VIL+  TN ++   DAY+ DKE I+ +L  +A      MK       +K +S          +  + S S  N            +P+I++L+++S+VQYLD  +++  +   +L +PFA G AF  S+LDSLMSTAY+N+NA+ ++  ++ GG+  +L++  +            +T  N ++ R    R+  +P S++     + N   Y  +F++   ++  +  GLYR    N+      + T  +R+V+TNP P  P+   D V+CL+
Sbjct:  115 NLDWIIEA-------KDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQT---NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITF-------------QRTNCD-------SGHPSTEY-SIAK-----------CVEKKFKPARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLP---EWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCK---SVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILS--TNHSNGLVDAYLADKEAILCSLNIKA------MKFTDDNLQSKDLS-------EIFKNLSTSASHQNSI----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSEL-----FGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFCLR 1062          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000078105.1 (SMESG000078105.1)

HSP 1 Score: 437.958 bits (1125), Expect = 3.023e-135
Identity = 311/1012 (30.73%), Postives = 500/1012 (49.41%), Query Frame = 2
Query:  380 MNIECPTQ---RKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQSTNFETACRSQKNLESLIEDPSFSVAFRS--YVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLPLK------LEKCYPLT-NPIFCSDLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKKM-LLMNPLNCKRIIPGSV-GFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDFKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNL 3373
            M I C  +    KW  F+  D L Y GGLL+L +   +    H K   +  +  F+    ++ N   +   P+ +V  R   Y+ Q        G    +I     LL+ VL L+              LE C P   N +    L  +  FLI FL+ F    + L FW   + +I+ FT+P     + L + ++G  F+R + + ++ +VIQ  ++++  + IR+  L + F  I + GAG F+L EN+G+I     Y NSQ I YG   YFI+VTMSTVGYGDI+ KT  G+IF+ LF+L+ALA FAS+IPE+ + L + S Y   +  +  ++H IVCG +    + +FL+ F HE+R+S ++ +IFI+   P + +K L+K Y  QV+Y +GT M   DL R+++  AD CL++  +NC + + ED  NIMR IS K  C    VIIQL QF+NK +L NIP W    GD++IC++EI+LGILA+SCL  GFST + + F++ S K   +N  N  W+  Y RG +  IY  + S+ F   ++ E V  C+    +++I +EV DS  +  + L  NP   K +I      + I ++     N +IYC RCH+       LK C C+    +  ++V   LK     SL   +     KEME I  K      +  F   S +    + +  +   + L  HI+L +FS   + S G+ NF+ PLR       ++K ++++ +  ++EKEW  I  FP+I VV        +  L  ++    CV++N          D Y+VDKE+I+  L      K   +  +     + S++ K                                 II+ ++I++N+ +L     +      Y  K FA G A+  S+L+SL+S+ YY+ N I ++ + I G   D  ++        +  +    ++ L   S   + +N  N   + ++F   ++++  + +G+YR  NL
Sbjct:    1 MKINCYEECNDNKWPIFLGFDCLIYIGGLLILFLKSKLSKLVHSK---VEMAKEFQVYLGTENNDYHM--QPNETVLTRPVRYIGQ--------GTFYGTIT----LLNVVLNLFSFFIYVFNTNEYYILENCCPWNENLLEIIQLVLSIFFLISFLIDFSMQKDHLEFWKDLYAIINIFTVPNTFIGIYLQRNYVGTFFLRFIWVYKIPDVIQQLDLLEVKSVIRLWHLGSIFMCIWVCGAGLFYLFENTGDIWHN--YKNSQKISYGACFYFILVTMSTVGYGDIYPKTDSGRIFLCLFLLIALAIFASYIPEMWDILKSRSIYDKTFRPVYNKKHNIVCGSLEDQEIESFLSTFYHENRNSKNIRIIFISLNRPKLYLKGLMKRY-PQVEYVEGTEMKSEDLKRIRVEIADCCLVITKRNCENEDAEDKANIMRVISIKECCPNQRVIIQLHQFQNKIHLLNIPNWCPLIGDEVICFNEIKLGILARSCLCAGFSTAICHAFTILSPKHIIKN-ENNPWIEQYKRGFSASIYRERFSQFFYGRTFLETVHICYDRFKIIVIGLEVIDSYGESTIKLYPNP---KHVITKQCWAYCISENQILPYNMSIYCKRCHSDKNSNLYLKKCYCEIITINSNMSVKIPLKQ----SLLAHN-----KEMEKILNK----NLDNKFEITSRRSFYHSFVKYD---KTLFDHIVLLVFSHENSKSAGLINFVKPLRIKKDDYVKIKPIILVGNGVYLEKEWKTISIFPEIYVVVGSCFDLEVLDLAQVNRARTCVLINAPKPFNHKVEDPYLVDKEVILGTLNLLNYLKYNKVSLSESDFSSSSVNTK---------------------------------IITDVSIDTNMHFLYPNSLDSSQNGAYFTKVFASGHAYCNSILNSLLSSTYYDWNTINLLRLFIEGSYDDSFEK--------VPGKYWHTQLKLISFSS-ERFLNLRNCKTFDEVFQTALNQNNILIIGIYRLFNL 930          
The following BLAST results are available for this feature:
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+034.32potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+034.32potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+034.32potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+034.32potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+034.23potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo-10.000e+034.66Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+034.48Calcium-activated potassium channel slo-1 [Source... [more]
slo-12.861e-15240.79Calcium-activated potassium channel slo-1 [Source... [more]
slo-12.894e-15240.79Calcium-activated potassium channel slo-1 [Source... [more]
slo-13.435e-15240.79Calcium-activated potassium channel slo-1 [Source... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo7.355e-16441.19gene:FBgn0003429 transcript:FBtr0100624[more]
slo3.505e-16341.98gene:FBgn0003429 transcript:FBtr0301582[more]
slo6.169e-16341.03gene:FBgn0003429 transcript:FBtr0100622[more]
slo9.360e-16340.87gene:FBgn0003429 transcript:FBtr0084684[more]
slo1.301e-16240.87gene:FBgn0003429 transcript:FBtr0100634[more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a0.000e+034.30potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+034.36potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+034.17potassium large conductance calcium-activated chan... [more]
CABZ01092907.12.071e-13042.83potassium large conductance calcium-activated chan... [more]
kcnt16.587e-3330.09potassium channel, subfamily T, member 1 [Source:Z... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+034.22potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+033.67potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+034.04potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+033.51potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+035.88potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnma10.000e+034.23potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+034.23potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+034.23potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+034.23potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+034.14potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AYS8|KCMA1_CHICK0.000e+034.20Calcium-activated potassium channel subunit alpha-... [more]
sp|Q9BG98|KCMA1_RABIT0.000e+034.26Calcium-activated potassium channel subunit alpha-... [more]
sp|O18866|KCMA1_PIG0.000e+034.42Calcium-activated potassium channel subunit alpha-... [more]
sp|O18867|KCMA1_MACMU0.000e+034.32Calcium-activated potassium channel subunit alpha-... [more]
sp|Q28204|KCMA1_BOVIN0.000e+034.32Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6HFZ40.000e+035.31Uncharacterized protein OS=Homalodisca liturata OX... [more]
A0A4W3HWC20.000e+035.53Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A1B6HKE70.000e+035.33Uncharacterized protein OS=Homalodisca liturata OX... [more]
A0A4W3HVA00.000e+035.53Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A2I4B5Y20.000e+034.79calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050702.10.000e+034.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044980.10.000e+034.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050440.10.000e+034.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051878.10.000e+033.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000004500.20.000e+033.02pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006399.13.358e-11344.16pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1... [more]
ENSPMAT00000006404.12.691e-11244.13pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1... [more]
ENSPMAT00000007042.14.483e-6848.84pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 g... [more]
KCNT15.040e-2128.99potassium sodium-activated channel subfamily T mem... [more]
KCNA31.351e-925.48potassium voltage-gated channel subfamily A member... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327431.583e-2828.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280988.710e-1328.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAK51.158e-931.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR11.297e-827.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478715.114e-822.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011055.20.000e+034.82potassium calcium-activated channel subfamily M al... [more]
kcnma1a0.000e+034.92calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+034.83calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+034.06calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+033.43calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044594.10.000e+099.43SMESG000044594.1[more]
SMESG000014623.10.000e+035.40SMESG000014623.1[more]
SMESG000050831.10.000e+035.07SMESG000050831.1[more]
SMESG000076792.11.991e-16733.53SMESG000076792.1[more]
SMESG000078105.13.023e-13530.73SMESG000078105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014811 ID=SMED30014811|Name=Calcium-activated potassium channel slo-1, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3736bp
AATTCCTAAATATTCAGTACTACTGACAGTAGTAGGAACGTTTTCTTAAA
CTGTAAATTCACCTGCATTTGTGTGTCAACATCTCATGAATAAGACATGC
CTATAATGAACAAACAGTGACAAAAAACCGTTTAGTAACAATAACTTTCA
GCGGAACTTCATGCAACAATCTGAATTTAAAACGATTTCTGTAAATATTC
ACCAAGTGAGATAAATTAATTTTTCACAAAAATTGTCTGAAAGAATTCAG
CGAATAGAAATTAATTATTAATTTGAAATGATTTGATTGGTTGAATTGAT
TTTCCATAAATTACAAAGCCTTGATATAGTATTGAATTGAAATTAGTCCA
TATTACAATTGTTATTAAGAAACCTAGAAATGAATATAGAATGTCCAACT
CAACGGAAATGGTATTGGTTTATCGCAGTCGATTCTTTGGCTTATTTCGG
TGGATTATTGCTGTTAGTCATTTGGAAAATCATCATCAATGCTTTCCATC
GAAAACGATTGAAAATCTCTCAGTCGACAAATTTTGAAACGGCCTGTCGA
TCGCAGAAAAATTTGGAAAGTCTCATTGAAGATCCGTCGTTTTCTGTAGC
GTTCCGATCGTATGTGAATCAGTTGATTTCGACTCAGTTTCTGATTGGTC
GAATTGTGGCATCAATTGCGACAGTTGCCGCATTGTTGTCGACAGTTCTG
TATTTGTATGAAATCATCTGTTTGCCGTTGAAATTGGAAAAATGTTATCC
ATTAACAAATCCGATTTTCTGTTCGGATTTGGCGTGTAATTTTGTTTTTT
TGATTTATTTTTTGTTGAGATTTTTTACGTCGACGGAAAAATTGGCTTTC
TGGTTGGGATTCCACACGGTAATAGATTGTTTTACGATTCCCCAGATATT
GACAGCTTTGGTGCTCGATCAAGAATGGATTGGTTTGAGGTTTATTAGAG
TTTTGTCGTTGATAAGGGTTTTCGAAGTCATTCAATGTTTCAATGTCGTC
AAGTCGGGCACTTCGATTCGAGTGATTCAGTTGATAACGTATTTTGCGAG
CATACTGATTGTTGGGGCGGGCTTTTTTCATTTGCTTGAAAATTCCGGAG
AAATAACTTCCGGTTCCTTTTATAATAACTCCCAACCGATCGGTTATGGA
GATTCTTTGTACTTTATAATTGTAACGATGTCCACTGTCGGTTATGGGGA
CATTTTTGCTAAAACTATGTGCGGGAAAATCTTTGTCGTTTTGTTTATTT
TGCTGGCGTTGGCTACGTTTGCTAGCTTTATTCCAGAATTGGCAGAATTT
CTCTTTGCTGGATCCCAATATCTTGGTTTTTATATTAAAATAGCCGGCCG
CCGACATATCATTGTGTGTGGCCATATTAATTATGCTAGTGTTTCAACCT
TTCTCACGGACTTTCTCCATGAAGATCGCTCTTCCTCGGACGTAGATGTG
ATTTTCATTAACAAAAAAGAGCCAGATATAGAAATGAAAAGTTTATTAAA
AATATATTTCACTCAAGTAAAATATTTTCAAGGAACAGTAATGGATCAAG
TAGATCTGGATCGTGTCCAAATGTCTAATGCTGACGCCTGCTTGATATTG
GCCGATCAAAACTGTTCGGATCCGAACGATGAGGATGCCGGTAACATCAT
GCGAGCGATATCATTCAAAAACTATTGCTACCGATGCCCCGTGATCATTC
AGCTGCTTCAATTCGAAAACAAAACATATCTTCAGAATATTCCTACCTGG
AATAAGCGGAATGGGGACCAAATTATTTGTTACAGTGAAATCGAATTGGG
AATTTTGGCCCAGAGCTGTTTGGTGCCGGGATTCTCCACCTTGCTAACGA
ACATATTCTCTGTGAGATCAGAGAAAGAATGCAAACAAAATCCCTCGAAT
GAGAGTTGGTTGAATGATTACATGAGAGGGGTGACTATGGAAATATATTC
CGCAAAATTATCCCGATCTTTTAATGAATTCAGTTATAAAGAACTCGTTG
AGTTTTGTTTCAAGAATCTAAACTTACTTCTAATTGCGATTGAAGTGAAA
GATTCCGTGAGCAAAAAGAAAATGTTACTTATGAATCCATTGAACTGTAA
AAGGATAATTCCTGGAAGTGTTGGATTTTTCATCTGTGACTCCTACAGAG
ATGCTTTGAATGCCAATATTTATTGTTCTCGGTGTCATGCAACTTTGAGA
GATTTGACAAACCTTAAGGTTTGTGGCTGTAAAGGTTCTCCGGATGACTA
CGAATTGACAGTGATCAGTAGACTTAAATCTGAAGAGGAAGTCAGCTTGA
CCAAATGTGACGTAGAGAATGACTTCAAAGAAATGGAGTTCATTGACGAA
AAGTGTTGCAGTTATAAAAAGAACGGCAACTTTTACACTTGTTCTCCACA
GAAACTCATGAAAAATGTCATCAGCAGCGAGCATCAGATTGAAAACCTAC
GTGGTCACATTATACTATGTATTTTTTCAGATAATAGAACATCATCGATA
GGAATCAGAAACTTTCTAATGCCTTTAAGATCGGTGACGATTTCCGAAAA
CGAATTGAAAGAATTGGTAATTATCGCTGATAAGGACTTCATTGAAAAGG
AGTGGTCGGAAATTTGTGGGTTTCCTAAAATCAAAGTCGTATTTCATCAG
ATCTCGATAAGACGAATCGCCCATTTGATCTCTATTGATACGTGTTCCCG
ATGCGTTATTCTCAATAATAAGACCAACATTGCCGATCTTCAGAACGATG
CATATATGGTAGACAAGGAAATTATTATTGCTAATCTGTTTTTTCAAGCA
GAATCCAAACGAAGAATTATGAAAAATAATTCAAAAATAGAAATGGCAAA
GTCGATCTCGATCAAGGCGGCCGGTGGTGAGACTCAAATAGAAAGGACTA
ATCAGAGTAAATCAGAGGGTAATGAAACGTTCCAGGTAAGCAAAGGCTCT
GAAACTCAAGTACCGATTATATCGAAATTAGCCATTGAAAGCAATGTTCA
GTACCTCGATGTCAGGGAGGACAATGTGCTGAATATTCCAAACTACTTAC
GGAAGCCGTTTGCTTTCGGTTGTGCTTTTACAACTAGCATGCTGGACTCA
TTAATGAGCACCGCTTATTACAATCAAAATGCAATTTATATTATGGAAAT
GCTCATCAATGGAGGATCTGTTGATGATCTGGATCAAGATGATAATGATA
CAGAGATCAATCTGGAACAACGAAACAACCAATTCCGAATAAATCTCACT
CCGGTTTCCCAAATTAATAAAACTGTCAATTGGAGTAATACGGTATTTTA
TAGGGATATTTTCATTGAGCTCATGTCAAAACATGAGTCGGTGAGCTTAG
GATTGTATCGGAAAAGGAATTTGTTGAGAAAAGAAACAAGAGTTGAAACG
GTTGATAGATATGTTATCACAAATCCTCCCCCGAATTTCCCCATTGAACC
GACAGATATGGTGTATTGCTTACAACAGAAATGTCTCCCTAAACCGAAAG
GAAAAGAATTTTCTCCTCCTTCGAGTGATGAAAAGAAATAAAACTCATTT
TGATATTTTTATCATGATGATCAATCATTTTTTATGAGGTTTCTAACAAT
TTTGTACTAACGTTGACATTATTCTAACCTCTCTCTGGCTGTACCTTTGT
TTGTACCGATTTGTTTTAATGTTTTCTTGTGATTTCTAATTTTGTACTTG
AAGACAAATACATGTTATGAGTCTGTGGGATTCCGT
back to top

protein sequence of SMED30014811-orf-1

>SMED30014811-orf-1 ID=SMED30014811-orf-1|Name=SMED30014811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1054bp
MNIECPTQRKWYWFIAVDSLAYFGGLLLLVIWKIIINAFHRKRLKISQST
NFETACRSQKNLESLIEDPSFSVAFRSYVNQLISTQFLIGRIVASIATVA
ALLSTVLYLYEIICLPLKLEKCYPLTNPIFCSDLACNFVFLIYFLLRFFT
STEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEV
IQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNN
SQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASF
IPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDR
SSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLDRVQMSN
ADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTY
LQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKE
CKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLL
LIAIEVKDSVSKKKMLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCS
RCHATLRDLTNLKVCGCKGSPDDYELTVISRLKSEEEVSLTKCDVENDFK
EMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIENLRGHIILCIFS
DNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPK
IKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIII
ANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNET
FQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAF
TTSMLDSLMSTAYYNQNAIYIMEMLINGGSVDDLDQDDNDTEINLEQRNN
QFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRKRNLLR
KETRVETVDRYVITNPPPNFPIEPTDMVYCLQQKCLPKPKGKEFSPPSSD
EKK*
back to top

protein sequence of SMED30014811-orf-2

>SMED30014811-orf-2 ID=SMED30014811-orf-2|Name=SMED30014811-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MATHNDMSAAGYFNIKTKILGSSKEKFCQFWNKASKRSQRQQNKQNDKDF
PAHSFSKNVPITDSGHRYNYKVQRISITDRLGVIIKGTGSYFSGIFKQMK
KARPNNQYARKIRYQLNHSNRSARLDDIETLNDFENPYQRQNSNKPQTNP
FLIEHQSCQYLGNRKTIYYRVESQPESQFFRRRKKSQQKINQKNKITRQI
RTENRIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006813potassium ion transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR036291NAD(P)-bd_dom_sf
IPR003929K_chnl_BK_asu
IPR016040NAD(P)-bd_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
GO:0005267potassium channel activity
GO:0060072large conductance calcium-activated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008076voltage-gated potassium channel complex
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01449BKCHANNELAcoord: 399..419
score: 61.9
coord: 432..445
score: 35.71
coord: 356..376
score: 25.0
coord: 478..493
score: 64.32
coord: 930..945
score: 50.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 211..313
e-value: 5.5E-17
score: 63.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 318..455
e-value: 7.8E-15
score: 56.9
NoneNo IPR availablePANTHERPTHR10027CALCIUM-ACTIVATED POTASSIUM CHANNEL ALPHA CHAINcoord: 74..1034
NoneNo IPR availablePANTHERPTHR10027:SF33POTASSIUM LARGE CONDUCTANCE CALCIUM-ACTIVATED CHANNEL, SUBFAMILY M, ALPHA MEMBER 1Acoord: 74..1034
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 101..308
NoneNo IPR availableTMHMMTMhelixcoord: 255..277
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 284..301
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
IPR003929Calcium-activated potassium channel BK, alpha subunitPFAMPF03493BK_channel_acoord: 456..554
e-value: 2.2E-29
score: 101.5
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 48..210
e-value: 2.3E-8
score: 35.6
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 100..302
e-value: 1.0E-13
score: 51.1
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 324..489