Endophilin-A3

Overview
NameEndophilin-A3
Smed IDSMED30014810
Length (bp)1367
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endophilin-A3 (SMED30014810) t-SNE clustered cells

Violin plots show distribution of expression levels for Endophilin-A3 (SMED30014810) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endophilin-A3 (SMED30014810) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endophilin-A3 (SMED30014810) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014810

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014810SMESG000065428.1 Contig4212GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014810SMESG000061276.1 Contig4212GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014810SMESG000061276.1 Contig51546newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014810SMESG000061276.1 Contig51546uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014810SMESG000061276.1 dd_Smed_v4_7468_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3 [Source:HGNC Symbol;Acc:HGNC:10832])

HSP 1 Score: 267.7 bits (683), Expect = 1.177e-85
Identity = 150/360 (41.67%), Postives = 217/360 (60.28%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  E+L+ E+ ID    +  +IL KTTEYLQPNPA+R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+E+ ++ K + E K  L+  + Q FI PL  L+  D++EI  H +K++GRRL +D     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++ FI+A  DYH Q+ +I + L SKL Q R  A SS     PR     +     S + N +++         +   G +     P CR LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQ-VKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYD---YKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL-QMRISAASS----VPRREYKPRPVKRSSSELNGVST------TSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPL 345          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 267.314 bits (682), Expect = 2.839e-85
Identity = 147/370 (39.73%), Postives = 220/370 (59.46%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANS------SEKPKAPRNVNSYKTASWGSEDTN----SLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ E EK +D       ++L +T EYLQPNPA R KL    T  KI G+  + P YPQ EG + E   ++  E GG   FG +L++  ++ K L E K  L+  + QNFI PL  L + D++EI  H +K++GRRL FD     K++  K+ D +L  A +KFEE+K +A  +M N L+++ E ++ +S+ + A+ DYH QA  I + L  KL ++  EA+S        KP+ P ++   + ++ G   T     + +S   S  +P             P+C+ALYDF  E+  EL F +GD+I L  Q+DENW+EG   G++GFFP+++VEVLVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQ-VKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPL 366          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL2 (SH3 domain containing GRB2 like 2, endophilin A1 [Source:HGNC Symbol;Acc:HGNC:10831])

HSP 1 Score: 264.618 bits (675), Expect = 2.332e-84
Identity = 145/361 (40.17%), Postives = 214/361 (59.28%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E E+ +D       +I+ KT EYLQPNPA R KL    T  KI G++ + P YPQ E  ++E   K+  E G +  FG +L E+ +  +EL E K  L+  + QNFI PL  L   D+REI  H +K++GRRL FD     K++  K+ D +L  A +KF+E+K IA  +M N L+ + E ++ +S+ ++A+ +YH QA  I + +  +L ++  +A+S  + +  P+   S +  +  S   N   S   +PK   +       Q   P CRALYDF  E+  EL F +GDII L  Q+DENW+EG   G +GFFPIN+VE+LV L
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQE-KGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGV-------QMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL 350          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3 [Source:HGNC Symbol;Acc:HGNC:10832])

HSP 1 Score: 249.595 bits (636), Expect = 1.543e-78
Identity = 148/366 (40.44%), Postives = 212/366 (57.92%), Query Frame = 1
Query:   61 FAGIKKQFNKAN--------QLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            FAGI    N+AN        QL SEKI G +GT+L  E+L+ E+ ID    +  +IL KTTEYLQPNPA+R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+E+ ++ K + E K  L+  + Q FI PL  L+  D++EI  H +K++GRRL +D     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++ FI+A  DYH Q+ +I + L SKL Q R  A SS     PR     +     S + N +++         +   G +     P CR LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+VEV+VPL
Sbjct:    5 FAGII--CNQANRCLTWTSQQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQ-VKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYD---YKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL-QMRISAASS----VPRREYKPRPVKRSSSELNGVSTTS------VVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPL 353          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 218.779 bits (556), Expect = 4.443e-67
Identity = 128/369 (34.69%), Postives = 196/369 (53.12%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANS------SEKPKAPRNVNSYKTASWGSEDTNS----LNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ E EK +D       ++L +T EYLQPNP                                                G +L++  ++ K L E K  L+  + QNFI PL  L + D++EI  H +K++GRRL FD     K++  K+ D +L  A +KFEE+K +A  +M N L+++ E ++ +S+ + A+ DYH QA  I + L  KL ++  EA+S        KP+ P ++   + ++ G   T +     +S   S  +P             P+C+ALYDF  E+  EL F +GD+I L  Q+DENW+EG   G++GFFP+++VEVLVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNP------------------------------------------------GDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPL 318          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 259.996 bits (663), Expect = 1.025e-82
Identity = 141/383 (36.81%), Postives = 221/383 (57.70%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQK--------RDE-------ANSSEKPK----APRNVNSYKTASWGSEDTNS---LNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G++KQFNKANQ +SE +G  + T+L   + E EK +D   +L  D++  T EYLQPNPA R K+       K+ G     P YPQ EG +++   KY  + G N   GKSL + ++T++++ + KY +ED + QNF+ PLT L+ ++++++N HR K++GRRL +D  KR + +     D ++  A++K EE+K +A  +M N L ++ E I+ + + I+A+ D+H Q A   E+L  +L  +        R+E       AN S  P+    AP +++   TA+      N      + P+    P        SQ   P CRAL+DF A+S  EL F +G +I+L+ Q+DENW+EG   GKTG FP+ +V+VLVPL+
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRGTTKTSP-YPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAARPREEHVPLSVLANESRTPRSRSPAPSDMSHNSTAAAAMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVLVPLK 377          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 259.225 bits (661), Expect = 2.436e-82
Identity = 141/385 (36.62%), Postives = 221/385 (57.40%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQK--------RDE-------ANSSEKPK------APRNVNSYKTASWGSEDTNS---LNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G++KQFNKANQ +SE +G  + T+L   + E EK +D   +L  D++  T EYLQPNPA R K+       K+ G     P YPQ EG +++   KY  + G N   GKSL + ++T++++ + KY +ED + QNF+ PLT L+ ++++++N HR K++GRRL +D  KR + +     D ++  A++K EE+K +A  +M N L ++ E I+ + + I+A+ D+H Q A   E+L  +L  +        R+E       AN S  P+      AP +++   TA+      N      + P+    P        SQ   P CRAL+DF A+S  EL F +G +I+L+ Q+DENW+EG   GKTG FP+ +V+VLVPL+
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRGTTKTSP-YPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAARPREEHVPLSVLANESRTPRSSFRSPAPSDMSHNSTAAAAMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVLVPLK 379          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 256.529 bits (654), Expect = 2.412e-81
Identity = 142/387 (36.69%), Postives = 222/387 (57.36%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQK--------RDE-------ANSSEKPK------APRNV--NSYKTASWGSEDTNS---LNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G++KQFNKANQ +SE +G  + T+L   + E EK +D   +L  D++  T EYLQPNPA R K+       K+ G     P YPQ EG +++   KY  + G N   GKSL + ++T++++ + KY +ED + QNF+ PLT L+ ++++++N HR K++GRRL +D  KR + +     D ++  A++K EE+K +A  +M N L ++ E I+ + + I+A+ D+H Q A   E+L  +L  +        R+E       AN S  P+      AP ++  NS   A++     N      + P+    P        SQ   P CRAL+DF A+S  EL F +G +I+L+ Q+DENW+EG   GKTG FP+ +V+VLVPL+
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRGTTKTSP-YPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAARPREEHVPLSVLANESRTPRSSFRSPAPSDMSHNSTAAAAFKMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVLVPLK 381          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 85.8853 bits (211), Expect = 2.799e-20
Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  943 SQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            SQ   P CRAL+DF A+S  EL F +G +I+L+ Q+DENW+EG   GKTG FP+ +V+VLVPL+
Sbjct:   39 SQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQVLVPLK 102          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: sorb-1 (SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O62482])

HSP 1 Score: 58.5362 bits (140), Expect = 4.922e-9
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 1
Query:  931 KGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEV 1119
            + Y  Q  + T  A+Y F   S  EL  + GDII++I++VD  W EGE  G++G FP ++V++
Sbjct:  146 RDYTPQPVM-TATAVYKFEPRSARELPLNRGDIIRIIREVDGYWMEGERNGRSGIFPTSYVQI 207          

HSP 2 Score: 51.2174 bits (121), Expect = 1.106e-6
Identity = 24/54 (44.44%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  964 CRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQ-GKTGFFPINFVEVL 1122
             RA+Y F A S  EL    G+II   +Q+D NW EG  Q G  G FP ++VE +
Sbjct:  218 MRAIYPFTARSDTELSLKRGEIITRRRQIDSNWLEGSNQIGIVGIFPASYVEPI 271          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0083699)

HSP 1 Score: 249.595 bits (636), Expect = 1.007e-78
Identity = 141/371 (38.01%), Postives = 218/371 (58.76%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG--GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK----PKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            MAFAG+KKQ NKANQ ++EK+GG +GT+L  +++E E+  D    L +++ LKT E+LQPNP  R K+ A K   K++G+  +   YPQ EG ++E    Y  + G   +VF ++L+E  +  K++ + KY L+D I QNF+ PL  ++  D++E+  HR+K+QGRRL FD  +R + K     D ++  A+ KF E+  +A   M N L+++ EH++ + +F +A  D+H Q AD+   L   L +KR EA S  +    PK   ++N        +ED    +   ++   P   +    S +        P C+ALYDF  E+P EL F + DII L+ +VD+NWFEG   G+TG+FP ++V+V VPL
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQ-AKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPL 365          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0334522)

HSP 1 Score: 249.595 bits (636), Expect = 1.007e-78
Identity = 141/371 (38.01%), Postives = 218/371 (58.76%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG--GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK----PKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            MAFAG+KKQ NKANQ ++EK+GG +GT+L  +++E E+  D    L +++ LKT E+LQPNP  R K+ A K   K++G+  +   YPQ EG ++E    Y  + G   +VF ++L+E  +  K++ + KY L+D I QNF+ PL  ++  D++E+  HR+K+QGRRL FD  +R + K     D ++  A+ KF E+  +A   M N L+++ EH++ + +F +A  D+H Q AD+   L   L +KR EA S  +    PK   ++N        +ED    +   ++   P   +    S +        P C+ALYDF  E+P EL F + DII L+ +VD+NWFEG   G+TG+FP ++V+V VPL
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQ-AKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPL 365          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0083698)

HSP 1 Score: 249.595 bits (636), Expect = 1.007e-78
Identity = 141/371 (38.01%), Postives = 218/371 (58.76%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG--GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK----PKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            MAFAG+KKQ NKANQ ++EK+GG +GT+L  +++E E+  D    L +++ LKT E+LQPNP  R K+ A K   K++G+  +   YPQ EG ++E    Y  + G   +VF ++L+E  +  K++ + KY L+D I QNF+ PL  ++  D++E+  HR+K+QGRRL FD  +R + K     D ++  A+ KF E+  +A   M N L+++ EH++ + +F +A  D+H Q AD+   L   L +KR EA S  +    PK   ++N        +ED    +   ++   P   +    S +        P C+ALYDF  E+P EL F + DII L+ +VD+NWFEG   G+TG+FP ++V+V VPL
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQ-AKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPL 365          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: POSH (gene:FBgn0040294 transcript:FBtr0086828)

HSP 1 Score: 64.3142 bits (155), Expect = 1.348e-10
Identity = 27/59 (45.76%), Postives = 40/59 (67.80%), Query Frame = 1
Query:  955 IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            +P   AL+DFA+    +L+F  GD+I +  ++D NWF G+  G+ G FPIN+V+V VPL
Sbjct:  137 LPHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPL 195          

HSP 2 Score: 53.1434 bits (126), Expect = 4.421e-7
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 1
Query:  955 IPTCRALYDFAAESPNE----LQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEV 1119
            +P C A+YDF    PN+    L+F    +I+++++VD NW EG      G FPI FVE+
Sbjct:  197 MPQCIAMYDFKM-GPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVEL 254          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: Asap (gene:FBgn0050372 transcript:FBtr0300954)

HSP 1 Score: 62.3882 bits (150), Expect = 5.718e-10
Identity = 35/94 (37.23%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  868 SEDTNSLNSQPNSPKQPYIFKKG----YDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQV--DENWFEGEFQG---KTGFFPINFVEVL 1122
            S D + LNS P++P +      G    Y+ Q     CRALYD  A++ +EL+F +G+I+ ++ +   DENW EG  +G   + G FP++FV +L
Sbjct: 1035 SSDNDRLNSSPDNPSKTGGAGLGGKFHYNGQRR---CRALYDCVADNDDELEFKEGEILIVLNERTDDENWMEGIIEGQPTRKGMFPVSFVHML 1125          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 263.077 bits (671), Expect = 4.653e-84
Identity = 137/362 (37.85%), Postives = 216/362 (59.67%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPL-YPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ + E+  D       D+L KTTEYLQPNPA R +L  A T  K+ G+   K L YPQ EG + E   KY  + G +  FG +L+E+ +  K L E K  L+  + QNFI P   +   D+++I  H +K++GRRL +D     K++  K+ D +L  A +KFEE+++ A  +M N LD++ E ++ + + ++++  +H Q+  + E L   + ++ ++A S  +P+  R   S  +  +   + ++    P++   P       D     P CRALYDF  E+  EL F++GD+I L  Q+D+NW+EG F+G+TG FP N+VEV+VPLR
Sbjct:    1 MSVAGLKKQFYKASQLMSEKVGGAEGTKLDEDFKDLERKADITSKAISDVLCKTTEYLQPNPASRARLTMANTMSKMRGQ--VKSLGYPQAEGLLGECMLKYGRDMGEDTNFGGALVEMGEAMKRLAEVKDSLDIDVKQNFIDPFQTIVDKDLKDIQHHLKKLEGRRLDYD---YKKKRQGKIADEELRMAMEKFEESRDAAETSMQNLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAMRERVNKAQS--QPRQKRMPVSRPSIDYSDPEDSNGGWNPSAAAPPSYSSTAADQ----PCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYVEVMVPLR 351          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1b (SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-031001-6])

HSP 1 Score: 261.536 bits (667), Expect = 1.906e-83
Identity = 144/360 (40.00%), Postives = 210/360 (58.33%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+Q++SEK+GG +GT+L  E+ + E+ +D       +++ KT+EYLQPNPA R KL    T  KI G+  + P YPQ EG + E   KY  E G    FG +LME+ ++ K L E K  L+  + QNFI PL  L   D+REI  H +K++GRRL +D     K++  K+ D +L  A +KF E+K +A  +M N L+++ E ++ +SS ++++  YH QA  I + L  KL  +  +A +      PR    Y        D    N Q N    P       ++ +    C+ALYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFP+N+VEV+VPL
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTNKAVVEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQ-VKSPGYPQAEGLLGECMGKYGRELGEETNFGGALMEVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHRQAVQILDELSDKLRDRMKDAQTR-----PRK--EYIPKPKPVIDFGETNEQSNGGYTPSSAPPMRNAAAEQACCKALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYVEVIVPL 349          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 259.996 bits (663), Expect = 1.402e-82
Identity = 141/372 (37.90%), Postives = 220/372 (59.14%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPL-YPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGS-EDTN-----SLNSQPNSPKQPYIFKKGYDSQ----STIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ + E+  D       D+L KTTEYLQPNPA R +L  A T  K+ G+   K L YPQ EG + E   KY  + G +  FG +L+E+ +  K L E K  L+  + QNFI P   +   D+++I  H +K++GRRL +D     K++  K+ D +L  A +KFEE+++ A  +M N LD++ E ++ + + ++++  +H Q+  + E L   + ++ ++A S  +P+  R   S  +  +   ED+N     S  + P+       F +    Q    +  P CRALYDF  E+  EL F++GD+I L  Q+D+NW+EG F+G+TG FP N+VEV+VPLR
Sbjct:    1 MSVAGLKKQFYKASQLMSEKVGGAEGTKLDEDFKDLERKADITSKAISDVLCKTTEYLQPNPASRARLTMANTMSKMRGQ--VKSLGYPQAEGLLGECMLKYGRDMGEDTNFGGALVEMGEAMKRLAEVKDSLDIDVKQNFIDPFQTIVDKDLKDIQHHLKKLEGRRLDYD---YKKKRQGKIADEELRMAMEKFEESRDAAETSMQNLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAMRERVNKAQS--QPRQKRMPVSRPSIDYSDPEDSNGGWNPSAAAPPSYSSTAPSFNRASSRQKRNSADQPCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYVEVMVPLR 365          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1b (SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-031001-6])

HSP 1 Score: 259.225 bits (661), Expect = 2.777e-82
Identity = 145/370 (39.19%), Postives = 220/370 (59.46%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK----PKAPRNVNSYKTASWGSEDTNSLNSQP--NSPKQPYIFKKGYDSQSTIP----TCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+Q++SEK+GG +GT+L  E+ + E+ +D       +++ KT+EYLQPNPA R KL    T  KI G+  + P YPQ EG + E   KY  E G    FG +LME+ ++ K L E K  L+  + QNFI PL  L   D+REI  H +K++GRRL +D     K++  K+ D +L  A +KF E+K +A  +M N L+++ E ++ +SS ++++  YH QA  I + L  KL  +  +A +  +    PK P+ V  +   +  S    + +S P   + +  + F +    +  +P     C+ALYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFP+N+VEV+VPL
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTNKAVVEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQV-KSPGYPQAEGLLGECMGKYGRELGEETNFGGALMEVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHRQAVQILDELSDKLRDRMKDAQTRPRKEYIPK-PKPVIDFGETNEQSNGGYTPSSAPPMRNAESYHQFGRITTRKPRLPAEQACCKALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYVEVIVPL 365          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl2a (SH3 domain containing GRB2 like 2a, endophilin A1 [Source:ZFIN;Acc:ZDB-GENE-040121-3])

HSP 1 Score: 253.832 bits (647), Expect = 1.578e-80
Identity = 143/360 (39.72%), Postives = 215/360 (59.72%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E EK +D       DIL KTTEYLQPNPA R K+    +  KI G D + P Y Q E  + E   K   E G  + FG +L+++ +  +EL E K  L+  + QNFI PL  +   D++EI  H +K++GRRL FD     K++  KVT+ ++  A +KF+++K IA  +M N L+++ E ++ +S+ ++A+ +YH QAA+I + L SK+  +  EA+   KPK    V   +T+   SE+ N         + P    +        P CRALYDF  E+  EL F +GDII L  ++D+NW+EG   G++GFFP+N+V++LV L
Sbjct:    1 MSVAGLKKQFHKATQRVSEKVGGAEGTKLDVDFTEMEKKVDTTSRAVLDILTKTTEYLQPNPATRAKMSMMSSMSKIRGGD-KGPGYTQTETTLGEAMQKAGRELGEESCFGVALIDVGEAMRELGEVKDALDMEVKQNFIDPLQNIHDKDLKEIQHHLKKLEGRRLDFD---YKKKRQGKVTEDEIKQALEKFDDSKEIAEQSMFNLLENDIEQVSQLSALVQAQVNYHRQAAEILQQLSSKIEDRIREASC--KPKR-EYVPKPRTSLDFSENHNGSIGHSGPSRSPAPMDQ--------PCCRALYDFDPENEGELGFKEGDIITLTSKIDDNWYEGMVNGQSGFFPVNYVDILVAL 345          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: sh3gl1 (SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:619364])

HSP 1 Score: 269.626 bits (688), Expect = 2.093e-86
Identity = 151/361 (41.83%), Postives = 218/361 (60.39%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  E+ E EK +D       D+L KT EYLQPNPA R KL    T  KI G+  + P YPQ EG + ET  K+  + G    FG +L++  ++ K L E K  L+  + QNF+ PL  L   D++EI  H +K++GRRL +D     K++  K+ D +L  A +KF E+K +A  +M N LD++ E ++ +++ ++A+ DYH QA  I + L  KL  +  E++S  K +  P+   SY+ A   SE +N   S P+S K P    +        P C+ALYDF  E+  EL F + DII L  Q+DENW+EG   G++GFFP+N+VE+LVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDEFKEMEKKVDVTTKAVTDVLAKTIEYLQPNPASRAKLSMLNTMSKIRGQ-VKNPGYPQPEGVLGETMIKFGKDLGDESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQAMEKFIESKEVAETSMINLLDTDVEQVSQLTALVEAQLDYHRQAVQILDELSEKLKDRVRESSSRTKREFKPKPRESYEYAE--SEQSNGGFSNPSS-KAPAPLDQ--------PCCKALYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYVEILVPL 346          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:Xenbase;Acc:XB-GENE-946803])

HSP 1 Score: 263.848 bits (673), Expect = 3.223e-84
Identity = 147/360 (40.83%), Postives = 218/360 (60.56%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  ++ E E+ ID    +  ++L KTTEYLQPNPA+R +L    T  KI G+  +   YPQ EG + +   ++  E G  + FG +L++  +  K++ E K  L+  + QNFI PL  L+  D++EI  H ++++GRRL +D  KR +    K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ +S F++A  DYH Q+A I E L+++L  + + A+S  +PK      S       +E  +      NS  +P     G       P CRALYDF  E+  EL F +GDII L  Q+DENWFEG   G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQ-VKTTGYPQTEGLLGDCMLRHGRELGDESEFGCALLDAGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKRLEGRRLDYDYKKRRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVFVEAALDYHRQSAQILEDLHNRLHNRMNTASS--RPKRELQHKSIIATLESNEKLHHNGIPSNSSIKP----SGSSGNLDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEVVVPL 350          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: sh3gl2 (SH3-domain GRB2-like 2 [Source:NCBI gene;Acc:100037852])

HSP 1 Score: 263.077 bits (671), Expect = 7.733e-84
Identity = 149/360 (41.39%), Postives = 215/360 (59.72%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E E+ +D       +I+ KTTEYLQPNPA R KL    T  KI G++ + P YPQ E  ++E   K+  E G    FG +L+++ D  +EL + K  L+  + QNFI PL  L   D+REI  H +K++GRRL FD     K++  K+TD ++  A +KF+E+K IA  +M N L+ + E ++ +S+  +A+ +YH QA+ I + +  KL Q+  EA+S      PR    Y+     S +    NSQ N         K   +    P CRALYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+V++LVPL
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDEDFKEMERKVDVTSRAVMEIMTKTTEYLQPNPASRAKLSMLNTMSKIRGQE-KGPGYPQAEALLAEAMFKFGREIGDESNFGLALIDVGDAMRELSDIKDCLDIDVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFD---YKKKRQGKITDDEIRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALAQAQLEYHRQASQILQQVAVKLEQRIREASSQ-----PRR--EYQPKPRMSLELE--NSQLNGGIALAGTPKPSGAPMDQPCCRALYDFDPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPL 347          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: sh3gl1 (SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:619364])

HSP 1 Score: 259.61 bits (662), Expect = 2.665e-82
Identity = 147/370 (39.73%), Postives = 219/370 (59.19%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTN-SLNSQPNSPKQPYIFKKGYDSQST--------IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  E+ E EK +D       D+L KT EYLQPNPA R KL    T  KI G+  + P YPQ EG + ET  K+  + G    FG +L++  ++ K L E K  L+  + QNF+ PL  L   D++EI  H +K++GRRL +D     K++  K+ D +L  A +KF E+K +A  +M N LD++ E ++ +++ ++A+ DYH QA  I + L  KL  +  E++S  K +  P+   SY+ A   SE +N   ++  +       F+    +++          P C+ALYDF  E+  EL F + DII L  Q+DENW+EG   G++GFFP+N+VE+LVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDEFKEMEKKVDVTTKAVTDVLAKTIEYLQPNPASRAKLSMLNTMSKIRGQ-VKNPGYPQPEGVLGETMIKFGKDLGDESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQAMEKFIESKEVAETSMINLLDTDVEQVSQLTALVEAQLDYHRQAVQILDELSEKLKDRVRESSSRTKREFKPKPRESYEYAE--SEQSNGGFSNPSSKAPASSSFRSEKPARTNNRSSAPLDQPCCKALYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYVEILVPL 364          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:Xenbase;Acc:XB-GENE-946803])

HSP 1 Score: 244.588 bits (623), Expect = 1.265e-76
Identity = 138/346 (39.88%), Postives = 205/346 (59.25%), Query Frame = 1
Query:   97 QLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            QL SEKI G +GT+L  ++ E E+ ID    +  ++L KTTEYLQPNPA+R +L    T  KI G+  +   YPQ EG + +   ++  E G  + FG +L++  +  K++ E K  L+  + QNFI PL  L+  D++EI  H ++++GRRL +D  KR +    K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ +S F++A  DYH Q+A I E L+++L  + + A+S  +PK      S       +E  +      NS  +P     G       P CRALYDF  E+  EL F +GDII L  Q+DENWFEG   G++GFFPIN+VEV+VPL
Sbjct:   20 QLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQ-VKTTGYPQTEGLLGDCMLRHGRELGDESEFGCALLDAGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKRLEGRRLDYDYKKRRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVFVEAALDYHRQSAQILEDLHNRLHNRMNTASS--RPKRELQHKSIIATLESNEKLHHNGIPSNSSIKP----SGSSGNLDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEVVVPL 355          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl2 (SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:700009])

HSP 1 Score: 271.166 bits (692), Expect = 4.011e-87
Identity = 147/361 (40.72%), Postives = 217/361 (60.11%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E E+ +D       +I+ KT EYLQPNPA R KL    T  KI G++ + P YPQ E  ++E   K+  E G +  FG +L E+ +  +EL E K  L+  + QNFI PL  L   D+REI  H +K++GRRL FD     K++  K+ D +L  A +KF+E+K IA  +M N L+ + E ++ +S+ ++A+ +YH QA  I + +  +L ++  +A+S  + +  P+   S + A+  S   N   S   +PK P +       Q   P CRALYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+VE+LV L
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQE-KGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGV-------QMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVAL 350          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl3 (SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:700011])

HSP 1 Score: 271.166 bits (692), Expect = 4.170e-87
Identity = 153/360 (42.50%), Postives = 216/360 (60.00%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  E+L  EK ID       +IL K TEYLQPNPA+R KL    T  K+ G+  +   YPQ EG + +   KY  E G  + FG SL+++ +  K + E K  L+  + Q FI PL  L+  D++EI  H RK++GRRL +D  KR   +  K+ + ++  A +KFEE+K +A  +M NFL+++ E ++ ++ F++A  DYH Q+ +I + L SKL     E   S   K P+     K  +  S D N +    +S K P     G D+ S  P CR LYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQV-KATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKL-----ELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS-KTP-----GTDTPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPL 345          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl1 (SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:700010])

HSP 1 Score: 264.233 bits (674), Expect = 2.903e-84
Identity = 145/370 (39.19%), Postives = 217/370 (58.65%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK------PKAPRNVNSYKTASWG----SEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ + EK +D       ++L++T EYLQPNPA R KL    T  KI G+  + P YPQ EG + E   ++  E GG   FG +L++  ++ K L E K  L+  + QNFI PL  L   D++EI  H +K++GRRL FD     K++  K+ D +L  A +KFEE+K +A  +M N L+++ E ++ +S+ + A+ DYH QA  I E L  KL ++  EA+S  K      P+ P  +   +  + G         + +S   S  +P             P+C+ALYDF  E+  EL F +GD+I L  Q+DENW+EG   G++GFFP+++V+VLVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKDMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQ-VKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSRPKREFKPRPREPFELGELEQPNGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPL 366          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl3 (SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:700011])

HSP 1 Score: 230.335 bits (586), Expect = 9.633e-72
Identity = 132/324 (40.74%), Postives = 188/324 (58.02%), Query Frame = 1
Query:  163 EKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            EK ID       +IL K TEYLQPNPA+R KL    T  K+ G+  +   YPQ EG + +   KY  E G  + FG SL+++ +  K + E K  L+  + Q FI PL  L+  D++EI  H RK++GRRL +D  KR   +  K+ + ++  A +KFEE+K +A  +M NFL+++ E ++ ++ F++A  DYH Q+ +I + L SKL     E   S   K P+     K  +  S D N +    +S K P     G D+ S  P CR LYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFPIN+VEV+VPL
Sbjct:    2 EKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQ-VKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKL-----ELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS-KTP-----GTDTPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPL 310          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl2 (SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:700009])

HSP 1 Score: 233.032 bits (593), Expect = 2.407e-71
Identity = 132/338 (39.05%), Postives = 197/338 (58.28%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENW 1062
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E E+ +D       +I+ KT EYLQPNPA R KL    T  KI G++ + P YPQ E  ++E   K+  E G +  FG +L E+ +  +EL E K  L+  + QNFI PL  L   D+REI  H +K++GRRL FD     K++  K+ D +L  A +KF+E+K IA  +M N L+ + E ++ +S+ ++A+ +YH QA  I + +  +L ++  +A+S  + +  P+   S + A+  S   N   S   +PK P +       Q   P CRALYDF  E+  EL F +GDII L  Q+DEN 
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQE-KGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGV-------QMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENC 327          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q62420|SH3G2_MOUSE (Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 PE=1 SV=2)

HSP 1 Score: 271.166 bits (692), Expect = 2.806e-86
Identity = 147/361 (40.72%), Postives = 217/361 (60.11%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E E+ +D       +I+ KT EYLQPNPA R KL    T  KI G++ + P YPQ E  ++E   K+  E G +  FG +L E+ +  +EL E K  L+  + QNFI PL  L   D+REI  H +K++GRRL FD     K++  K+ D +L  A +KF+E+K IA  +M N L+ + E ++ +S+ ++A+ +YH QA  I + +  +L ++  +A+S  + +  P+   S + A+  S   N   S   +PK P +       Q   P CRALYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+VE+LV L
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQE-KGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSHTGTPKPPGV-------QMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVAL 350          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q62421|SH3G3_MOUSE (Endophilin-A3 OS=Mus musculus OX=10090 GN=Sh3gl3 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 6.910e-86
Identity = 152/360 (42.22%), Postives = 216/360 (60.00%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  E+L  EK ID       +IL K TEYLQPNPA+R KL    T  K+ G+  +   YPQ EG + +   KY  E G  + FG SL+++ +  K + E K  L+  + Q FI PL  L+  D++EI  H RK++GRRL +D  KR   +  K+ + ++  A +KFEE+K +A  +M NFL+++ E ++ ++ F++A  DYH Q+ +I + L SKL     E   S   K P+     K  +  S D N +    +S K P     G D+ +  P CR LYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQV-KATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKL-----ELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS-KTP-----GTDTPADQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPL 345          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|O35180|SH3G3_RAT (Endophilin-A3 OS=Rattus norvegicus OX=10116 GN=Sh3gl3 PE=1 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 3.712e-85
Identity = 151/363 (41.60%), Postives = 220/363 (60.61%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK---APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  E+L+ EK ID       +IL K TEYLQPNPA+R KL    T  K+ G+  +   YPQ EG + +   KY  E G  + FG SL+E+ +  K + E K  L+  + Q FI PL  L+  D++EI  H RK++GRRL +D     K++  K+ + ++  A +KFEE+K +A  +M NFL+++ E ++ ++ F++A  DYH Q+ +I + L +KL  +   A +S+ P+    P+ VN+  T + G E ++S                G D  S  P CR LYDF  E+  EL F +GDII L  Q+DENW+EG  +G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLDMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTMSKLRGQ-VKATGYPQTEGLLGDCMLKYGRELGEDSAFGNSLVEVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYD---YKKKRVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQNKLELRI--ALASQVPRRDYMPKPVNTSSTNANGVEPSSSSKL------------TGTDIPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPL 345          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q8AXV0|SH3G1_CHICK (Endophilin-A2 OS=Gallus gallus OX=9031 GN=SH3GL1 PE=1 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 3.877e-85
Identity = 150/371 (40.43%), Postives = 222/371 (59.84%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSED-TNSLNSQPNSPK--QPYIFKKGYDSQSTI--------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+QL+SEK+GG +GT+L  ++ E EK +D       ++L +T EYLQPNPA R KL    T  KI G+  + P YPQ EG + E+  +Y  E G +  FG +L++  ++ K L E K  L+  + QNFI PL  L   D++EI  H +K++GRRL FD     K++  K+ D +L  A +KFEE+K +A  +M N L+++ E ++ +S+ + A+ DYH QA  I + L  KL ++  EA+S  +P+        +T  +G  D +N   S   +PK      F+     ++++        P C+ALYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFP+N+VEVLVPL
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDLTSKAVTEVLTRTIEYLQPNPASRAKLTMLNTMSKIRGQ-VKNPGYPQSEGLLGESMIRYGKELGEDSNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFD---YKKKRQGKIPDEELRQAMEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASS--RPRREYKPKPRETYDFGESDQSNGGFSCTPTPKVSASSSFRSDKPFRTSVRSIPHLDQPCCKALYDFEPENDGELGFKEGDIITLTNQIDENWYEGMINGQSGFFPLNYVEVLVPL 365          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q99963|SH3G3_HUMAN (Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE=1 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 5.651e-85
Identity = 150/360 (41.67%), Postives = 217/360 (60.28%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL SEKI G +GT+L  E+L+ E+ ID    +  +IL KTTEYLQPNPA+R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+E+ ++ K + E K  L+  + Q FI PL  L+  D++EI  H +K++GRRL +D     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++ FI+A  DYH Q+ +I + L SKL Q R  A SS     PR     +     S + N +++         +   G +     P CR LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+VEV+VPL
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQ-VKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYD---YKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL-QMRISAASS----VPRREYKPRPVKRSSSELNGVST------TSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPL 345          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A1S3K9F9 (endophilin-A3 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106179882 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 4.823e-103
Identity = 166/369 (44.99%), Postives = 244/369 (66.12%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK--APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYD----SQSTIP---TCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG++KQFNKANQ +SEKIGG KGTEL  E+LE E+ ID    L +D++ +T EYLQPNPA R KL+   T  K+ G+  ++  YPQ EG + ET  K+  + G +  FG+ L+E  ++FK+L + KY LED++ QNF+ PL  L+  D++E+N HR+K+ GRRL +D  KR K+KG+ +++ +L  A++KFEE+K +A  AM N L+++ E I+ ++SFI+A+ DYH +AADI + L+  L  KR+EA S  + +  + +  +S++ +S   +  N+L+S         +   GY      QS+ P    C ALYDF  E+P EL F +GD+I LI Q+DENW+EG   G+TGFFP+N+VEV VPL
Sbjct:    1 MSLAGLRKQFNKANQFMSEKIGGAKGTELDEEFLEMERKIDVTGKLVEDVMARTQEYLQPNPASRAKLMTVNTISKLRGQ-VKQTAYPQPEGILGETMIKHGKDLGDDSSFGQCLVEAGESFKQLADVKYALEDSVKQNFLEPLQHLQNKDLKEVNHHRKKLGGRRLDYDCKKRKKDKGSAISEDELQQAEEKFEESKQLAETAMHNLLENDVEQISQLASFIEAQEDYHRRAADILQQLHDTLQSKRNEAASRPRSEFVSKKVTSSFRNSSPAFD--NNLDS---------LDTTGYSLSPAQQSSEPQQACCTALYDFDPENPGELGFREGDMITLISQIDENWYEGSIHGQTGFFPVNYVEVKVPL 357          
BLAST of Endophilin-A3 vs. TrEMBL
Match: W6USB0 (Endophilin-A3 OS=Echinococcus granulosus OX=6210 GN=EGR_00480 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 1.229e-101
Identity = 166/364 (45.60%), Postives = 235/364 (64.56%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNE-SGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKE---KGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK-PKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+F G++KQ NKANQ +SEKIGG +GT+L  EY+  EK ID    L ++I+ KT EYLQPNPA R KL    TF+KI GK G+ P YPQ EGQ+ +   KY NE    ++FG+ L++    FK +E+ KY +ED + + +I PL  ++  +++EIN HR+K++GRRL FD  KR KE   +  KV +A++  A++KF+E+K +A  AM NFL S+ EHI+ ++ F+ A+  Y+  A++I E+L+  L++K+DEA S  K    P+ +   +T S      N   S P +P      K       + P CRALY F AE+  EL FS+GDII+LI+QVDENWFEG  + K GFFP+N+VEV+ PL
Sbjct:    1 MSFTGLRKQINKANQFMSEKIGGAEGTKLDEEYIHCEKQIDAMSKLIEEIITKTHEYLQPNPATRAKLATLNTFNKIQGK-GKAPPYPQPEGQLGDCMLKYGNELDHDSLFGECLIQTGYAFKNMEDIKYNMEDQVKREYIEPLRGIQSVELKEINFHRKKLEGRRLDFDCKKRKKESNPQAAKVLEAEIKVAEEKFQESKVLAETAMANFLASDFEHISALAEFVDAQASYYRHASEIMENLHKVLLEKKDEAQSRGKQTHNPKPLQITRTLSGEVSTKNGSMSSPRTPN-----KSPAGDGGSGPCCRALYQFEAENDTELAFSEGDIIQLIRQVDENWFEGRLRDKEGFFPVNYVEVIEPL 358          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A1S3K928 (endophilin-A3 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106179882 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 8.651e-101
Identity = 166/373 (44.50%), Postives = 244/373 (65.42%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGN-VFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEK----GNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK--APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYD----SQSTIP---TCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG++KQFNKANQ +SEKIGG KGTEL  E+LE E+ ID    L +D++ +T EYLQPNPA R KL+   T  K+ G+  ++  YPQ EG + ET  K+  + G +  FG+ L+E  ++FK+L + KY LED++ QNF+ PL  L+  D++E+N HR+K+ GRRL +D  KR K+K    G+ +++ +L  A++KFEE+K +A  AM N L+++ E I+ ++SFI+A+ DYH +AADI + L+  L  KR+EA S  + +  + +  +S++ +S   +  N+L+S         +   GY      QS+ P    C ALYDF  E+P EL F +GD+I LI Q+DENW+EG   G+TGFFP+N+VEV VPL
Sbjct:    1 MSLAGLRKQFNKANQFMSEKIGGAKGTELDEEFLEMERKIDVTGKLVEDVMARTQEYLQPNPASRAKLMTVNTISKLRGQ-VKQTAYPQPEGILGETMIKHGKDLGDDSSFGQCLVEAGESFKQLADVKYALEDSVKQNFLEPLQHLQNKDLKEVNHHRKKLGGRRLDYDCKKRKKDKAPASGSAISEDELQQAEEKFEESKQLAETAMHNLLENDVEQISQLASFIEAQEDYHRRAADILQQLHDTLQSKRNEAASRPRSEFVSKKVTSSFRNSSPAFD--NNLDS---------LDTTGYSLSPAQQSSEPQQACCTALYDFDPENPGELGFREGDMITLISQIDENWYEGSIHGQTGFFPVNYVEVKVPL 361          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A4S2LB47 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008447 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.991e-100
Identity = 165/371 (44.47%), Postives = 237/371 (63.88%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGN-VFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKG---NKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKP--------KAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG KKQ NKANQ +SEKIGGV+GT+L  EYLE EK +D    L D+++ +T E+LQPNPAHR K+L   T +K+ GK  +  +YPQ EGQ+ +   KY  + G +  +G+ L++  ++FK L + KY +ED +  NF+ PL  ++  +++EIN HR+K++GRRL FD  KR ++K     K+ + +L  A++KF E+K +A  AM NFL+SE E I  ++  + A+ DYH QA +I E L   L+ K+DEA+S  +P          P  VNS +T S  +  T + N        P++      S    P+CR LYDF AE+ +EL FS+GD+I+L+QQVDENWFEGE  G+ G+FPIN+VEV+ PL
Sbjct:    1 MSLAGFKKQLNKANQFVSEKIGGVEGTKLDDEYLETEKKVDVICKLIDEVVTQTQEFLQPNPAHRAKMLTMNTLNKLQGK-AKSSVYPQPEGQLGDCMQKYGRDLGPDSCYGQCLLQSGESFKYLADIKYTMEDHVKDNFLQPLHSIQTHELKEINHHRKKLEGRRLDFDCKKRKQDKAAATAKLPEDELKIAEEKFVESKILAEQAMINFLNSEVEQIQALTELVTAQVDYHRQATEIMEQLQKFLIDKKDEASSKPRPVYEPKRFSTLPNQVNS-RTPSQSALSTPAKNG-------PHV-NASAPSPILGPSCRGLYDFEAENASELPFSEGDVIRLLQQVDENWFEGELNGRRGYFPINYVEVINPL 361          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A0X3PT28 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR132953 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 3.616e-100
Identity = 160/364 (43.96%), Postives = 235/364 (64.56%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGN-VFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEK---GNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSS-EKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG++KQ NKANQ ++EKIGG +GT+L  EY+  EK ID    L D+I+ +T EYLQPNPA R K+L   TF+KI GK  +   YPQ EGQ+ +   KY  E G + +FG+ L++   +FK LEE K+ +ED +   +I PL  ++  +++EIN HR+K++GRRL +D  KR KE    G K  + ++  A++KF+E+K +A  AM NFL S+ EHI  ++ F+ A+  ++ QA +I E+L+  LM+K+DEA ++ +K    + V  Y T+S      N LN+  N  + P    K   +  + P CRALY F AE+  EL F++GD+I+LI+QVDENW+EG   G+ GFFP+N+VE +V L
Sbjct:    1 MSLAGLRKQINKANQFVTEKIGGAEGTKLDDEYINCEKQIDIMSKLIDEIINRTHEYLQPNPATRAKMLTMNTFNKIQGK-AKTSAYPQPEGQLGDCMLKYGEELGNDSLFGECLVQAGQSFKCLEEVKFHMEDQVKAGYIEPLRGIQSVELKEINFHRKKLEGRRLDYDCKKRRKENNPAGGKAIEDEVKIAEEKFQESKVLAETAMINFLSSDIEHIGALAEFVDAQVTFYRQATEIMENLHKYLMEKKDEAAAAGKKEHIQKPVQRYSTSS------NDLNAAKNGTQSPGTTGKTGTNAESGPCCRALYQFDAENDTELAFAEGDVIQLIRQVDENWYEGRLNGREGFFPVNYVETIVDL 357          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: ENSAMXT00000053701.1 (endophilin-A1 [Source:NCBI gene;Acc:103033999])

HSP 1 Score: 273.092 bits (697), Expect = 5.820e-88
Identity = 151/361 (41.83%), Postives = 218/361 (60.39%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSP-KQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E EK +D       DI+ +TTEYLQPNPA R KL    T  KI G++ + P YPQ E  + E   K+  E G  + FG +L++ S+  +EL E K  L+  + QNFI PL  L   DI+EI  H +K++GRRL FD     K++  KVTD ++  A +KF+E+K IA  +M N L+S+ E ++ +++ +KA+ +YH QA D+ + L SK+ ++  EA  S KP+              SE+ N       SP + P    +        P+CRALYDF  E+  EL F +GDII L  Q+D+NW+EG   G++GFFPIN+V++LVPL
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMEKKVDTTSRAVLDIMARTTEYLQPNPASRAKLTMINTMSKIRGQE-KGPGYPQAESVLGEAMQKFGRELGEESSFGLALIDASEAMRELGEVKDALDMEVKQNFIDPLQNLHDKDIKEIQHHLKKMEGRRLDFD---YKKKRQGKVTDDEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVKAQLEYHRQATDVLQQLSSKMEERIKEA--SNKPRKEYIPKPRMELQLPSENHNGGIHTAKSPARSPAPLDQ--------PSCRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMIHGQSGFFPINYVDILVPL 347          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 258.455 bits (659), Expect = 3.422e-82
Identity = 146/366 (39.89%), Postives = 223/366 (60.93%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQST-----IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL+SEKI G +GT+L  +++E E+ ID       ++L KTTEYLQPNPA R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+++ +  K++ + K  L+  + QNFI PL  L+  D++EI  H +K++GRRL FD     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++S I+A  +YH Q+ +I E L SKL  +   ANS  + +  P+++ S    +  ++  N L+   +     +      + + T      P CR+LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+V+VLVPL
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQ-VKTTGYPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFD---YKKKRQGKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDLNSKLQNRIATANSQPRKEFKPKSIMS-SLETIDNDQQNGLSYSSSLKSSDHQVTHSVNGKKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDVLVPL 361          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl1b (SH3 domain containing GRB2 like 1, endophilin A2 [Source:NCBI gene;Acc:103032391])

HSP 1 Score: 258.455 bits (659), Expect = 3.985e-82
Identity = 148/376 (39.36%), Postives = 221/376 (58.78%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEK----PKAPRNV------NSYKTASWG-SEDTNSLNSQPN-----SPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+Q++SEK+GG +GT+L  E+ + E+ +D       +++ KT+EYLQPNPA R KL    T  KI G+  + P YPQ EG + E   KY  + G    FG +LM++ ++ K L E K  L+  + QNFI PL  L   D+REI  H +K++GRRL +D     K++  K+ D ++  A +KF E+K +A  +M N L+++ E ++ +SS ++++  YH QA  I E L  KL  +  EA S  +    PK P+ V      N +    +  S    + NS+PN     S ++P +      + +    C+ALYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFP+N+VEV+VPL
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTSKAVVELISKTSEYLQPNPASRAKLSMLNTMSKIRGQ-VKSPGYPQAEGLLGECMGKYGRDLGEETNFGLALMDVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYD---YKKKRQGKIPDEEVKQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHKQAVQILEELSDKLKDRIGEAQSRPRKEYIPK-PKPVFDFGETNDHSNGGFAPSSAPPTRNSEPNLKLGKSSRKPRL------TPAEQACCKALYDFEPENEGELGFREGDIITLTNQIDENWYEGMLHGQSGFFPLNYVEVIVPL 365          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 256.529 bits (654), Expect = 2.784e-81
Identity = 153/381 (40.16%), Postives = 218/381 (57.22%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI---------------------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL+SEKI G +GT+L  +++E E+ ID       ++L KTTEYLQPNPA R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+++ +  K++ + K  L+  + QNFI PL  L+  D++EI  H +K++GRRL FD     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++S I+A  +YH Q+ +I E L SKL  +   ANS      PR    +K  S  S      N Q N        K   D  S I                     P CR+LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+V+VLVPL
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQ-VKTTGYPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFD---YKKKRQGKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDLNSKLQNRIATANSQ-----PR--KEFKPKSIMSSLETIDNDQQNGLSYSSSLKSSADHVSYIPPMTHTWPESPRDKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDVLVPL 370          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 256.144 bits (653), Expect = 5.674e-81
Identity = 148/385 (38.44%), Postives = 231/385 (60.00%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNV-NSYKTASWGSED---------------TNSLNSQPNS----PKQPYIFKKGYDSQSTI----PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA+QL+SEKI G +GT+L  +++E E+ ID       ++L KTTEYLQPNPA R KL    T  KI G+  +   YPQ EG + +   KY  E G  + FG +L+++ +  K++ + K  L+  + QNFI PL  L+  D++EI  H +K++GRRL FD     K++  K+ D ++  A +KFEE+K +A  +M NFL+++ E ++ ++S I+A  +YH Q+ +I E L SKL  +   ANS  + +  P+++ +S +T     ++               T+S+N + +     P   + + +    ++ +    P CR+LYDF  E+  EL F +GDII L  Q+DENW+EG   G++GFFPIN+V+VLVPL
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQ-VKTTGYPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFD---YKKKRQGKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDLNSKLQNRIATANSQPRKEFKPKSIMSSLETIDNDQQNGLSYSSSLKSSDHQVTHSVNGKTDHVSYIPPMTHTWPESPRDKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDVLVPL 381          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 231.491 bits (589), Expect = 1.683e-72
Identity = 126/351 (35.90%), Postives = 214/351 (60.97%), Query Frame = 1
Query:   85 NKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK-APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            +K  Q +SEK+GG +GT+L  ++ E EK  D       DI+ KT EYLQPNPA R KL    T  KI G+  +   YPQ EG + E  AKY  + G  + FG +L ++ ++ K++ E K  L+  + QNF+ P+  L+  +++EI  H +K++GRRL FD     K++  K+ D ++  A++KFEE++ +A+ +M N ++SE E ++ +++ + A+ +YH ++A + + L + L ++++EA+   K +   + ++++   SWG+    ++      P           S+S+ P+ +ALYDF  E+  EL F +GDII L +Q+D+NW+EG  +G +GFFP+N+V+V+VPL
Sbjct:   13 HKCTQFVSEKVGGAEGTKLDDDFTEMEKKYDTTNKAVMDIITKTQEYLQPNPASRAKLGMLNTMSKIRGQ-VKSTGYPQPEGLLGEAMAKYGKDMGTESCFGLALADVGESMKQMAEIKDSLDIDVKQNFLDPMQALQDKELKEIGHHLKKLEGRRLDFD---YKKKRLGKIPDEEIRQAEEKFEESREVAASSMHNLVESEIEQVSQLAALVDAQLEYHQRSAAVLQDLQAALQERKNEASKMPKKEFKAKPMSTFHENSWGNGGGENI-----YPAMSGSASASASSRSSAPSAKALYDFDPENEGELGFQEGDIITLTKQIDDNWYEGTVRGHSGFFPVNYVDVIVPL 354          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 100.908 bits (250), Expect = 1.217e-25
Identity = 57/151 (37.75%), Postives = 91/151 (60.26%), Query Frame = 1
Query:  241 AHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEA 690
            A R KL    T  KI G+  +   YPQ EG + E   KY  + G    FG++L+++ +++KE+ E K GL+  + QNFI PL  L++ ++REI  H +K++GRRL FD     K++  K+ + D+  + +KFEE+K +A  +M N L+S+ 
Sbjct:    1 ASRAKLGMLNTMSKIRGQV-KSTGYPQPEGTLGECMVKYGQDLGEESNFGQALVDVGESYKEMAEVKDGLDIGVKQNFIDPLQGLQEKELREIGQHLKKLEGRRLDFD---YKKKRQGKILEEDIRQSAEKFEESKEVAESSMFNLLESDV 147          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 70.8626 bits (172), Expect = 1.224e-13
Identity = 86/388 (22.16%), Postives = 152/388 (39.18%), Query Frame = 1
Query:   82 FNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-----GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNK-----VTDADLDDAQKK----FEEAKNIASDAMDNF----------LDSEAEHINIISSFIKAERDYHHQA--------ADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPT-------CRALYDFAAESPNELQFSDGDIIKL--IQQVDENWFEGEFQGKTGFFPINFVEVL 1122
            F++A Q   EK+G  + TEL + +       +  +H  D I+ +    LQPNP  R   +    F K+ GK    PL        SE   +Y  E+G     G  +G +L++   T KEL   +     T    F++PL      D R I   ++ ++ +RL  D  K   +K         T+ D ++ + +       A  + +D +              D +AE   ++   I +    HH+A        A  +   Y  +++ + E  S   P +  + N+   A+     +       ++P  P     G  S    P         R LYD+ A   +EL     +++ +  +  +D +W  GE   + G  P+ ++E+L
Sbjct:   16 FSRAVQFTEEKLGQAERTELDAHFENLLGRAEMTRHWTDKIMRQAETLLQPNPNAR---IEDYFFEKLEGK---APL----RATNSEYLGQYMIEAGQEFGPGTAYGCALIKCGTTQKELGISEKDFIQTTANGFLTPLRNFLDGDFRTIAKEKKILENKRLDLDACKSRLKKARSAEAKAATEPDFNEIRPRNYVLSASAAGLWADEVARAEQELRVTQTEFDRQAEITRLLLEGIGSTHANHHRALKEFVEAQAAYYAKCYQSMVELQKELGSF--PTSFVSNNNLAGAAGSGAASAGTGGGGSAPPVPTPSILGLPSAEGAPPLVTGTRRARVLYDYDAADMSELSLLADEVVTVYSLPGMDSDWLMGERGNQKGKVPVTYLELL 391          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: sorbs1 (sorbin and SH3 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-090313-168])

HSP 1 Score: 63.929 bits (154), Expect = 3.061e-11
Identity = 27/65 (41.54%), Postives = 41/65 (63.08%), Query Frame = 1
Query:  925 FKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEV 1119
            +K+    + T  T RA Y+F A+S  EL    GD++ + +QVD+NW+EGE  G+ G FP  +VE+
Sbjct:  386 WKRTSVGEPTRQTARAKYNFRAQSQKELPLHKGDVVYINRQVDQNWYEGEHHGRVGIFPATYVEL 450          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: nebl (nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151])

HSP 1 Score: 58.9214 bits (141), Expect = 3.912e-10
Identity = 24/54 (44.44%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  967 RALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQ--GKTGFFPINFVEVL 1122
            RA+YD+AA   +E+ F DGD+I+ ++Q+DE W  G  Q  G+TG  P N+++ L
Sbjct:  199 RAVYDYAAADDDEVSFLDGDVIENVKQIDEGWMYGTVQRTGQTGMLPANYLQPL 252          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 65.855 bits (159), Expect = 4.341e-12
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = 1
Query:  943 SQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLV 1125
            +Q+ +   RALYD     P+EL F  GD+I +++QV  +W++G  +G  G FP+N+V  +V
Sbjct:  215 AQTVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPIV 275          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 61.6178 bits (148), Expect = 8.721e-11
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query:  943 SQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDE--NWFEGEFQGKTGFFPINFVEV 1119
            + S  PT  ALY+FA E P +L F  GD+I ++++ D   +W+ G   GK G FP N+V V
Sbjct:  407 TNSATPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRV 467          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 53.9138 bits (128), Expect = 2.357e-8
Identity = 22/57 (38.60%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  958 PTCRALYDFAAESPNELQFSDGDIIKLIQQVDE--NWFEGEFQGKTGFFPINFVEVL 1122
            P   ALY FA E   +L F  GD+I ++++ D   +W+ G   G+ G FP N+VE++
Sbjct:  403 PKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: RVS167 (Calmodulin-binding actin-associated protein; roles in endocytic membrane tabulation and constriction, and exocytosis; N-BAR domain protein that interacts with Rvs161p to regulate actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; recruited to bud tips by Gyl1p and Gyp5p during polarized growth; homolog of mammalian amphiphysin [Source:SGD;Acc:S000002796])

HSP 1 Score: 49.2914 bits (116), Expect = 7.609e-7
Identity = 19/55 (34.55%), Postives = 35/55 (63.64%), Query Frame = 1
Query:  961 TCRALYDFAAESPNELQFSDGDIIKLIQQVDE--NWFEGEFQGKTGFFPINFVEV 1119
            T  ALYD+ A++  +L F  G +I+++Q+  +   W+ G + G+ G FP N+V++
Sbjct:  425 TVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQL 479          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 46.9802 bits (110), Expect = 1.813e-6
Identity = 18/51 (35.29%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  964 CRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVE 1116
              ALYDF A+   +L    GD I++++++  +W+ G+   K G FP N+V+
Sbjct:   58 VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO31161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP4])

HSP 1 Score: 261.536 bits (667), Expect = 5.677e-84
Identity = 150/357 (42.02%), Postives = 209/357 (58.54%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVL 1122
            M+FAG KKQ NKANQ +SEKIG  KG++L  E++E E+  D+   L +D+L KT EYLQPNPA R KL      HK+ G +     YPQ EG + ET  K   + G  ++FG++++E  +TF +L E K  L+  + QNF+ PLT+L   DI+EI  HR+K+QGRRL +D  KR   K NK+   D+  A++KFEE+K +  ++M N LD EAE I+ +S+  +A  DYH  AA++ +SL S L  +  EA+S  + + P     +      S    S+ S P           G   +      +ALYDF  E+  EL FS+GDII +   VDENW EG   G+TG FP N+VE +
Sbjct:    1 MSFAGFKKQINKANQYMSEKIGSAKGSQLEEEFVELERKTDSTAKLIEDVLHKTKEYLQPNPAARAKLSMQGAVHKVRG-EARSTRYPQPEGNLGETMVKGGQDLGDTSLFGQAMVEAGETFLQLAEVKDALDANVKQNFLDPLTQLENRDIKEIMQHRKKMQGRRLDYDCKKR---KSNKLPLEDIRIAEEKFEESKELCYNSMMNLLDGEAEQISQLSALSEAILDYHKHAAEVMQSLVSTLNDRVTEASSRPRSERPSFTPKFNDDDDSSSGGGSMPSLPTPTPSAPPPSSGGKEK-----VKALYDFEPENDGELGFSEGDIITIESTVDENWLEGSVHGRTGLFPRNYVESM 348          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO47212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMW0])

HSP 1 Score: 195.282 bits (495), Expect = 2.449e-58
Identity = 120/368 (32.61%), Postives = 189/368 (51.36%), Query Frame = 1
Query:   61 FAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG----GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQK-------RDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            FAG+KKQ NKANQ +SEK+G  +GT++  E++E E+  D    L  ++  KT EYLQPN  +  K+    T      +  EK  YP  EG + +       E G    G+ +  +L++ +    EL E ++ L++ +  NF+ PL  L  +D++E+  +R+K+QGRRL +D  KR   KGNKV+  ++  AQ KFEE+KN+    M   L +E + I  +   +    +YH ++ +  E   S+L ++       + EA +S   +AP             E  N       +P+      K  DS    P+C+A +D+ A+   EL F++G II L  + D+ W+EG   GK G FP   V++L  L
Sbjct:    5 FAGLKKQINKANQYVSEKMGSAEGTKMEDEFIEMERKTDALIELVANLTPKTKEYLQPNATYNAKVKMHMT------QPDEK--YPYTEGLMGDVMMLAGQEIGQVGKGSDYAAALLDFAGALHELAETRHELDEKVHSNFLGPLHDLEANDLKELTFNRKKLQGRRLDYDCKKR---KGNKVSIEEIKTAQFKFEESKNLCKQGMAKLLGNEMDMIEQLCQLVVDMLEYHKKSTESLEIAMSQLNKRIVNARRNQAEAEASAPKQAPE------------EPENVPEQHEKAPESTNPLAKSSDSDKLKPSCKAKFDYKAKKEGELSFTEGQIITLSGKRDDEWYEGTLDGKFGIFPSALVQILTDL 349          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO38201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK8])

HSP 1 Score: 92.8189 bits (229), Expect = 6.927e-21
Identity = 85/357 (23.81%), Postives = 153/357 (42.86%), Query Frame = 1
Query:   82 FNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFH-KIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGN-----KVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKL-MQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKL--IQQVDENWFEGEFQGKTGFFPINFVEVL 1122
            F++A Q   E++G  + TE  + +    +  D  K   + +L +T   LQPNP  R    A + F+ K+  K  E+  + +  G+I E      NE G G  +G +L++   T K+L   +       + +++ PL    + D++ I+  RR +  +RL  D  K    K       +  +++L  AQ +F+    +    +D    S A H   + SFI+A+  Y+ Q     + L  +L      ++     P AP   +       G  D N+         +P + KK           + LYD+ A   +EL     ++I +  +  +D +W  GE   + G  P+ ++E+L
Sbjct:   19 FSRAKQYTEEQLGKAEATEFDARFESLLERADRTKQWTERLLKQTEALLQPNPGIR----AEEYFYSKLGEKKPERLTHLETLGKIME---DAGNELGPGTSYGSTLVKCGATEKKLASAERDFMTKSVSHYLHPLKSFLEGDMKTISTERRTLLAKRLDLDSCKAKVRKAQTPERIQQAESELRVAQAEFDRQYEVTKLLLDGIATSHANHHRALQSFIEAQAQYYAQCFQYMQDLQRQLGTPPPTDSVPLVPPTAPSAADVR-----GVLDVNAY-------PRPSVTKKA----------KVLYDYDATDSSELSLLSDEVITVYNVPGMDNDWMVGERGSQRGKVPVTYLELL 346          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO44404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVL2])

HSP 1 Score: 69.3218 bits (168), Expect = 1.153e-13
Identity = 30/64 (46.88%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  940 DSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            D ++T P  R LYDF      +L    GD + L++QVDENWFEG+  G  GF P N+VEV+  L
Sbjct:   87 DQRTTKPCARVLYDFEPREQGDLALCKGDFVYLLRQVDENWFEGQVNGCQGFLPSNYVEVISAL 150          

HSP 2 Score: 65.855 bits (159), Expect = 2.022e-12
Identity = 30/55 (54.55%), Postives = 37/55 (67.27%), Query Frame = 1
Query:  958 PTCRALYDF-AAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEV 1119
            P  +ALYDF   E  + L F  GD+I +I++VDENW EG+   K G FPINFVEV
Sbjct:  160 PVAKALYDFDGGEEQDILPFKQGDVISVIRKVDENWCEGKLNNKCGIFPINFVEV 214          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO29864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2F6])

HSP 1 Score: 54.299 bits (129), Expect = 2.310e-9
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  922 IFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEF--QGKTGFFPINFV 1113
            IF K  DS+ +  T  ALYDF A+   EL F  G+ I+++ + D+NW++G     G+ G FP N+V
Sbjct:   47 IFLKDVDSECSQDTVVALYDFVAQEAGELNFKKGNHIEVLDKEDDNWWKGRVAETGEEGLFPRNYV 112          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: ENSORLT00000037055.1 (endophilin-A1 [Source:NCBI gene;Acc:101160542])

HSP 1 Score: 263.462 bits (672), Expect = 2.777e-84
Identity = 145/363 (39.94%), Postives = 219/363 (60.33%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESG-GNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK---APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF+KA Q +SEK+GG +GT+L  ++ E EK +D       DI+ KTTEYLQPNPA R KL    T  KI G+D + P YPQ E  + +   K+  E G  + FG +L++  ++ KEL E K  L+  + QNFI PL  L   D++EI  H +K++GRRL FD     K++  KV D ++  A +KF+E+K IA  +M N L+S+ E ++ +++ ++A+ +YH +AA+I + L SK+  +  E +S  KP+   +P+   + +           ++S  +  + P    +        P CRALYDF  E+  EL F +GDII L  Q+D+NW+EG   G++GFFPIN+V++LVPL
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMEKKVDITSRAVLDIMTKTTEYLQPNPASRAKLSMINTMSKIRGQD-KGPGYPQAETILGDAMLKFGRELGEESSFGMALIDAGESIKELGEVKDALDMEVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFD---YKKKRQGKVQDEEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRAAEILQQLSSKMEDRIKEVSS--KPRKEYSPKPRMTLELLPPSESHNGGIHSAKSPGRSPAPMDQ--------PCCRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMINGQSGFFPINYVDILVPL 349          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1b (endophilin-A2 [Source:NCBI gene;Acc:101164792])

HSP 1 Score: 261.536 bits (667), Expect = 1.568e-83
Identity = 141/360 (39.17%), Postives = 218/360 (60.56%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG+KKQF KA+Q++SEK+GG +GT+L  ++ + E+ +D       +++ KT+EYLQPNPA R KL    T  KI G+  + P YPQ EG + E  AKY  E G +  FG +L+++ ++ K L E K  L+  + QNFI PL  L   D+REI  H +K++GRRL +D     K++  K+ D ++  A +KF E+K++A  +M N L+++ E ++ +S+ + ++  YH QA  + E L  KL ++ +EA S  +P+            +G ++++S    P +   P         Q   P+C+ALYDF  E+  EL F +GD+I L  Q+DENW+EG   G++GFFP+N+VEVLVPL
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDDDFRDLERKVDVTSKAVAEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQ-VKNPGYPQAEGLLGECMAKYGRELGEDTNFGGALVDVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYD---YKKKRQGKIPDEEIRQALEKFHESKDVAETSMYNLLETDIEQVSQLSALVDSQLQYHRQAVQVLEELSDKLRERMNEAQS--RPRREYTPKPKPIFDFG-DNSHSNGGYPTTMAPPPSRNPAPPEQ---PSCKALYDFEPENEGELGFHEGDVITLTNQIDENWYEGMLNGQSGFFPLNYVEVLVPL 350          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1a (endophilin-A2 [Source:NCBI gene;Acc:101161753])

HSP 1 Score: 258.07 bits (658), Expect = 5.782e-82
Identity = 139/373 (37.27%), Postives = 219/373 (58.71%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTN-------------SLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG++KQ NKA Q+I+EK+GG +GT+L  ++ E E+  D       +++ KTTEYLQPNPA R KL    T  KI G+  + P YPQ EG + E   KY  + G +  FG +L+++ +T K + E K  L+  + QNFI PL  +   DI++I  H +K++GRRL +D     K++  K+ D +L  A +KF E++++A  +M N L+++ E ++ +S+F+ +   YH +A  I + L  +L ++  +A S  K + P+            +D+N             S  +Q  S ++P + KK  D     P C+A+YDF  E+  EL F +GDII L+ ++DENW+EG  QG++G+FP N+VEV+VPL
Sbjct:    1 MSVAGLRKQINKATQMINEKVGGAEGTKLDEDFKELERKADITSKAMLEVISKTTEYLQPNPATRAKLTMLNTVSKIRGQ-VKSPGYPQPEGLLGEAMLKYGRDMGDDTNFGGALLDVGETMKRMAEVKDSLDIDVKQNFIDPLQAVADKDIKDIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQALEKFHESRDLAETSMYNLLETDVEQVSQLSAFVDSLLQYHQEATQILQELNGRLKERVSDAQSRPKREIPKKRQESFEYGHEQDDSNGGYSPAAINPPSYSAAAQYPSFQRPSVKKKPTD-----PCCKAMYDFEPENDGELGFREGDIITLVSKIDENWYEGRLQGRSGYFPTNYVEVMVPL 364          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1a (endophilin-A2 [Source:NCBI gene;Acc:101161753])

HSP 1 Score: 256.529 bits (654), Expect = 1.523e-81
Identity = 134/360 (37.22%), Postives = 215/360 (59.72%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            M+ AG++KQ NKA Q+I+EK+GG +GT+L  ++ E E+  D       +++ KTTEYLQPNPA R KL    T  KI G+  + P YPQ EG + E   KY  + G +  FG +L+++ +T K + E K  L+  + QNFI PL  +   DI++I  H +K++GRRL +D     K++  K+ D +L  A +KF E++++A  +M N L+++ E ++ +S+F+ +   YH +A  I + L  +L ++  +A S  K + P+     ++  +G E  +S      +   P  +       +  P C+A+YDF  E+  EL F +GDII L+ ++DENW+EG  QG++G+FP N+VEV+VPL
Sbjct:    1 MSVAGLRKQINKATQMINEKVGGAEGTKLDEDFKELERKADITSKAMLEVISKTTEYLQPNPATRAKLTMLNTVSKIRGQ-VKSPGYPQPEGLLGEAMLKYGRDMGDDTNFGGALLDVGETMKRMAEVKDSLDIDVKQNFIDPLQAVADKDIKDIQHHLKKLEGRRLDYD---YKKKRQGKIPDEELRQALEKFHESRDLAETSMYNLLETDVEQVSQLSAFVDSLLQYHQEATQILQELNGRLKERVSDAQSRPKREIPKKRQ--ESFEYGHEQDDSNGGYSPAAINPPSYS------AADPCCKAMYDFEPENDGELGFREGDIITLVSKIDENWYEGRLQGRSGYFPTNYVEVMVPL 348          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: ENSORLT00000025093.2 (endophilin-A1 [Source:NCBI gene;Acc:101160542])

HSP 1 Score: 246.899 bits (629), Expect = 6.917e-78
Identity = 139/359 (38.72%), Postives = 212/359 (59.05%), Query Frame = 1
Query:   67 GIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGG-NVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPK---APRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPL 1131
            G+  QF+  +  +SEK+GG +GT+L  ++ E EK +D       DI+ KTTEYLQPNPA R KL    T  KI G+D + P YPQ E  + +   K+  E G  + FG +L++  ++ KEL E K  L+  + QNFI PL  L   D++EI  H +K++GRRL FD     K++  KV D ++  A +KF+E+K IA  +M N L+S+ E ++ +++ ++A+ +YH +AA+I + L SK M+ R  +  S KP+   +P+   + +           ++S  +  + P    +        P CRALYDF  E+  EL F +GDII L  Q+D+NW+EG   G++GFFPIN+V++LVPL
Sbjct:    5 GLSGQFHTGSS-VSEKVGGAEGTKLDDDFKEMEKKVDITSRAVLDIMTKTTEYLQPNPASRAKLSMINTMSKIRGQD-KGPGYPQAETILGDAMLKFGRELGEESSFGMALIDAGESIKELGEVKDALDMEVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFD---YKKKRQGKVQDEEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRAAEILQQLSSK-MEDRYRSALSSKPRKEYSPKPRMTLELLPPSESHNGGIHSAKSPGRSPAPMDQ--------PCCRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMINGQSGFFPINYVDILVPL 349          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000061276.1 (SMESG000061276.1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 360/361 (99.72%), Postives = 360/361 (99.72%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLRD 1137
            MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQ TIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLRD
Sbjct:    1 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQLTIPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLRD 361          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000043383.1 (SMESG000043383.1)

HSP 1 Score: 397.127 bits (1019), Expect = 1.985e-136
Identity = 195/366 (53.28%), Postives = 269/366 (73.50%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQ--PYIFKKGYD-SQST--IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLRD 1137
            M+  G+KKQ NKANQLI+EK+G  KGTEL  +Y+E EK ID  K+LFD++L K TEYLQPNP++R KL     FHKI+GK  +K LYPQ E QISE F KY  E     FG  LME S++FK++ + KY LED I QNF+ P++K++++D++EI  HR+KVQGRRL +D  KRNKEKG+K+++ ++  A++KFE++K++A +AM+NFLDSE EHIN ++ FIKAE +YH + A+I ESLY+ +++K +E   S K  A + ++S K  S+   D +S NS+ ++ +Q      K  +D SQST  +PTCRALYDF AES  ELQF++GD+IKL+QQVD++WFEGE   + GFFPIN+VEVL+PL +
Sbjct:    1 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEEC--SNKAPASQRISSLKKCSYS--DNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEVLIPLSE 362          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 323.939 bits (829), Expect = 8.833e-108
Identity = 170/367 (46.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G+KKQFNKANQLISEKIGG KGTEL SE+L+ EK ID    L ++++ +T E++QPNPA R +L+   T HK +GK G+  LYPQ EG + E   KY  + G +  FG++L+E  D F+++ E KY LED I QNF+ P + L+  ++REIN HR+K++GRRL FD  KR ++KG K+ D ++  A+ KFEE+K++A  AM NFL SE EHI  + SFI+++ +YH +A  + + L + L  K D+A    KPK P+ +    T+S    + N +N    S     +FK       T       P  R L+DF AE+  EL F +G+I+KLIQQVDENWFEGE  G+ G+FP+N+VE++VPL+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKL--KPK-PQPMPKRSTSSRSLYEENPVNDAALSGNS--LFKSNTSQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEIIVPLK 361          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 323.553 bits (828), Expect = 4.179e-107
Identity = 170/367 (46.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G+KKQFNKANQLISEKIGG KGTEL SE+L+ EK ID    L ++++ +T E++QPNPA R +L+   T HK +GK G+  LYPQ EG + E   KY  + G +  FG++L+E  D F+++ E KY LED I QNF+ P + L+  ++REIN HR+K++GRRL FD  KR ++KG K+ D ++  A+ KFEE+K++A  AM NFL SE EHI  + SFI+++ +YH +A  + + L + L  K D+A    KPK P+ +    T+S    + N +N    S     +FK       T       P  R L+DF AE+  EL F +G+I+KLIQQVDENWFEGE  G+ G+FP+N+VE++VPL+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKL--KPK-PQPMPKRSTSSRSLYEENPVNDAALSGNS--LFKSNTSQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEIIVPLK 361          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 322.783 bits (826), Expect = 2.204e-105
Identity = 170/367 (46.32%), Postives = 240/367 (65.40%), Query Frame = 1
Query:   55 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNV-FGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQSTI------PTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEVLVPLR 1134
            M+ +G+KKQFNKANQLISEKIGG KGTEL SE+L+ EK ID    L ++++ +T E++QPNPA R +L+   T HK +GK G+  LYPQ EG + E   KY  + G +  FG++L+E  D F+++ E KY LED I QNF+ P + L+  ++REIN HR+K++GRRL FD  KR ++KG K+ D ++  A+ KFEE+K++A  AM NFL SE EHI  + SFI+++ +YH +A  + + L + L  K D+A    KPK P+ +    T+S    + N +N    S     +FK       T       P  R L+DF AE+  EL F +G+I+KLIQQVDENWFEGE  G+ G+FP+N+VE++VPL+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKL--KPK-PQPMPKRSTSSRSLYEENPVNDAALSGNS--LFKSNTSQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEIIVPLK 361          
The following BLAST results are available for this feature:
BLAST of Endophilin-A3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GL31.177e-8541.67SH3 domain containing GRB2 like 3, endophilin A3 [... [more]
SH3GL12.839e-8539.73SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GL22.332e-8440.17SH3 domain containing GRB2 like 2, endophilin A1 [... [more]
SH3GL31.543e-7840.44SH3 domain containing GRB2 like 3, endophilin A3 [... [more]
SH3GL14.443e-6734.69SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-571.025e-8236.81Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-572.436e-8236.62Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-572.412e-8136.69Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-572.799e-2056.25Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
sorb-14.922e-939.68SORBin homolog [Source:UniProtKB/TrEMBL;Acc:O6248... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EndoA1.007e-7838.01gene:FBgn0038659 transcript:FBtr0083699[more]
EndoA1.007e-7838.01gene:FBgn0038659 transcript:FBtr0334522[more]
EndoA1.007e-7838.01gene:FBgn0038659 transcript:FBtr0083698[more]
POSH1.348e-1045.76gene:FBgn0040294 transcript:FBtr0086828[more]
Asap5.718e-1037.23gene:FBgn0050372 transcript:FBtr0300954[more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3gl1a4.653e-8437.85SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl1b1.906e-8340.00SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl1a1.402e-8237.90SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl1b2.777e-8239.19SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl2a1.578e-8039.72SH3 domain containing GRB2 like 2a, endophilin A1 ... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3gl12.093e-8641.83SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:61936... [more]
gipc23.223e-8440.83GIPC PDZ domain containing family member 2 [Source... [more]
sh3gl27.733e-8441.39SH3-domain GRB2-like 2 [Source:NCBI gene;Acc:10003... [more]
sh3gl12.665e-8239.73SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:61936... [more]
gipc21.265e-7639.88GIPC PDZ domain containing family member 2 [Source... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3gl24.011e-8740.72SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl34.170e-8742.50SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl12.903e-8439.19SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl39.633e-7240.74SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl22.407e-7139.05SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62420|SH3G2_MOUSE2.806e-8640.72Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 P... [more]
sp|Q62421|SH3G3_MOUSE6.910e-8642.22Endophilin-A3 OS=Mus musculus OX=10090 GN=Sh3gl3 P... [more]
sp|O35180|SH3G3_RAT3.712e-8541.60Endophilin-A3 OS=Rattus norvegicus OX=10116 GN=Sh3... [more]
sp|Q8AXV0|SH3G1_CHICK3.877e-8540.43Endophilin-A2 OS=Gallus gallus OX=9031 GN=SH3GL1 P... [more]
sp|Q99963|SH3G3_HUMAN5.651e-8541.67Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE... [more]
back to top
BLAST of Endophilin-A3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K9F94.823e-10344.99endophilin-A3 isoform X3 OS=Lingula unguis OX=7574... [more]
W6USB01.229e-10145.60Endophilin-A3 OS=Echinococcus granulosus OX=6210 G... [more]
A0A1S3K9288.651e-10144.50endophilin-A3 isoform X2 OS=Lingula unguis OX=7574... [more]
A0A4S2LB471.991e-10044.47Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3PT283.616e-10043.96Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053701.15.820e-8841.83endophilin-A1 [Source:NCBI gene;Acc:103033999][more]
sh3gl3a3.422e-8239.89endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
sh3gl1b3.985e-8239.36SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
sh3gl3a2.784e-8140.16endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
sh3gl3a5.674e-8138.44endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GL11.683e-7235.90SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GL11.217e-2537.75SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GLB21.224e-1322.16SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sorbs13.061e-1141.54sorbin and SH3 domain containing 1 [Source:ZFIN;Ac... [more]
nebl3.912e-1044.44nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151][more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HSE14.341e-1239.34Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
YSC848.721e-1142.62Actin-binding protein; involved in bundling of act... [more]
LSB32.357e-838.60Protein containing a C-terminal SH3 domain; binds ... [more]
RVS1677.609e-734.55Calmodulin-binding actin-associated protein; roles... [more]
LSB11.813e-635.29Negative regulator of actin nucleation-promoting f... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311615.677e-8442.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472122.449e-5832.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382016.927e-2123.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444041.153e-1346.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298642.310e-940.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037055.12.777e-8439.94endophilin-A1 [Source:NCBI gene;Acc:101160542][more]
sh3gl1b1.568e-8339.17endophilin-A2 [Source:NCBI gene;Acc:101164792][more]
sh3gl1a5.782e-8237.27endophilin-A2 [Source:NCBI gene;Acc:101161753][more]
sh3gl1a1.523e-8137.22endophilin-A2 [Source:NCBI gene;Acc:101161753][more]
ENSORLT00000025093.26.917e-7838.72endophilin-A1 [Source:NCBI gene;Acc:101160542][more]
back to top
BLAST of Endophilin-A3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061276.10.000e+099.72SMESG000061276.1[more]
SMESG000043383.11.985e-13653.28SMESG000043383.1[more]
SMESG000022674.18.833e-10846.32SMESG000022674.1[more]
SMESG000022674.14.179e-10746.32SMESG000022674.1[more]
SMESG000022674.12.204e-10546.32SMESG000022674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014810 ID=SMED30014810|Name=Endophilin-A3|organism=Schmidtea mediterranea sexual|type=transcript|length=1367bp
TTCAAAGATTTAAATAATTTAAAGTTTTTCAATTGATAATTTTCAAATAT
TGGAATGGCTTTTGCTGGAATTAAAAAACAATTTAATAAAGCTAATCAGC
TTATTTCAGAAAAAATTGGAGGTGTTAAAGGGACCGAGTTAAGTAGTGAA
TATTTAGAAAATGAAAAGTTAATAGATAATTACAAACATTTATTTGATGA
TATATTATTAAAAACTACTGAATATTTGCAACCTAATCCTGCTCATCGAA
CAAAATTATTGGCTGCGAAAACATTTCACAAAATAGCTGGTAAAGATGGT
GAAAAACCGCTTTATCCACAAATCGAAGGACAGATATCTGAGACATTTGC
AAAATACTCAAATGAATCAGGTGGAAATGTTTTCGGAAAGTCATTAATGG
AGATCAGTGATACTTTTAAGGAATTAGAGGAAAAAAAATATGGATTAGAA
GATACAATAATGCAAAATTTCATCAGTCCACTAACGAAATTACGTCAAAG
TGACATTAGAGAAATTAATTTACACAGAAGAAAGGTTCAAGGTCGACGAT
TGACGTTCGATGGATTGAAAAGAAACAAAGAAAAAGGGAATAAAGTAACA
GACGCTGATTTGGACGATGCACAAAAGAAATTCGAAGAAGCAAAAAATAT
TGCTTCTGATGCTATGGATAACTTTTTAGATTCAGAAGCTGAACATATCA
ATATTATATCATCCTTCATTAAAGCTGAAAGAGATTACCATCATCAGGCT
GCTGATATTTTTGAGTCCCTATATTCCAAATTAATGCAAAAGCGCGATGA
AGCTAATTCATCAGAAAAACCCAAAGCACCCAGGAATGTTAATAGTTATA
AAACCGCAAGCTGGGGCAGTGAGGATACGAACAGTTTGAACAGCCAACCA
AACAGTCCGAAACAACCGTACATTTTCAAGAAAGGATATGATTCACAATC
AACTATTCCTACTTGTCGAGCTTTATATGATTTTGCTGCGGAATCTCCGA
ATGAACTTCAGTTTTCTGACGGGGATATCATTAAACTTATTCAACAAGTT
GATGAAAACTGGTTTGAGGGAGAATTTCAAGGTAAAACGGGATTTTTCCC
CATAAACTTTGTGGAGGTCTTGGTGCCTTTAAGAGATTAAATTCAATTTT
TCAAATCATTTTCTTTGATTTCTATTTGTGATATGTATTTTGATGTTTTG
TGTTTTCTTTTTCTACTTTGCTGGTGACAAAACGTGCATACACTTTTTGT
ACTGCAGGCGTAGATGCTGAACATAACTAGCGATATTGCTCATCACAATA
TTTATTATCAACCGATATTTTCAATACTATATATTAATTATTTTCTAATA
GATGATTTACGCTAGAA
back to top

protein sequence of SMED30014810-orf-1

>SMED30014810-orf-1 ID=SMED30014810-orf-1|Name=SMED30014810-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDI
LLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAK
YSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSD
IREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIA
SDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEA
NSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQPYIFKKGYDSQST
IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPI
NFVEVLVPLRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR028501Endophilin-A
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR004148BAR_dom
IPR027267AH/BAR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 186..206
NoneNo IPR availablePRINTSPR00499P67PHOXcoord: 324..340
score: 45.59
coord: 304..324
score: 33.33
coord: 340..353
score: 51.79
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 292..361
e-value: 2.6E-25
score: 89.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 256..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 247..285
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 3..359
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 333..342
score: 27.0
coord: 344..356
score: 41.72
coord: 316..331
score: 31.57
coord: 302..312
score: 43.47
IPR001452SH3 domainSMARTSM00326SH3_2coord: 302..357
e-value: 7.6E-21
score: 85.3
IPR001452SH3 domainPFAMPF00018SH3_1coord: 305..349
e-value: 9.6E-15
score: 53.9
IPR001452SH3 domainPROSITEPS50002SH3coord: 299..358
score: 26.139
IPR004148BAR domainSMARTSM007215barcoord: 5..245
e-value: 6.0E-45
score: 165.3
IPR004148BAR domainPFAMPF03114BARcoord: 6..243
e-value: 2.2E-49
score: 168.3
IPR004148BAR domainPROSITEPS51021BARcoord: 18..252
score: 22.38
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 1..249
e-value: 1.6E-63
score: 217.0
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 11..243
IPR028501Endophilin-APANTHERPTHR14167:SF45ENDOPHILIN-A3coord: 3..359
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 299..357