Friend leukemia integration 1

Overview
NameFriend leukemia integration 1
Smed IDSMED30014799
Length (bp)1492
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Friend leukemia integration 1 (SMED30014799) t-SNE clustered cells

Violin plots show distribution of expression levels for Friend leukemia integration 1 (SMED30014799) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Friend leukemia integration 1 (SMED30014799) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Friend leukemia integration 1 (SMED30014799) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014799

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014799SMESG000080027.1 SmedASXL_009973SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30014799SMESG000080027.1 SmedASXL_009973SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30014799SMESG000080027.1 dd_Smed_v4_14611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014799SMESG000080027.1 dd_Smed_v4_14611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014799SMESG000080027.1 dd_Smed_v4_14611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30014799SMESG000080027.1 dd_Smed_v4_14611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014799SMESG000080027.1 dd_Smed_v6_14611_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30014799SMESG000080027.1 KJ934799smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014799SMESG000080027.1 Contig33356newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014799SMESG000080027.1 Contig33356uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30014799SMESG000080027.1 Contig33356newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30014799SMESG000080027.1 Contig33356uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30014799SMESG000080027.1 OX_Smed_1.0.18242ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Match: FLI1 (Fli-1 proto-oncogene, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3749])

HSP 1 Score: 192.586 bits (488), Expect = 1.950e-57
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:   84 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 185          
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 192.2 bits (487), Expect = 6.695e-56
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  191 GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 300          
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Match: ERG (ETS transcription factor ERG [Source:HGNC Symbol;Acc:HGNC:3446])

HSP 1 Score: 192.2 bits (487), Expect = 9.307e-56
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  215 GSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 324          
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Match: FLI1 (Fli-1 proto-oncogene, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3749])

HSP 1 Score: 191.815 bits (486), Expect = 1.424e-55
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  211 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 312          
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Match: FLI1 (Fli-1 proto-oncogene, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3749])

HSP 1 Score: 191.815 bits (486), Expect = 2.990e-55
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  244 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 345          
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 182.57 bits (462), Expect = 1.132e-54
Identity = 80/92 (86.96%), Postives = 86/92 (93.48%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQA 827
            G+GQIQLWQFLLELL+D+ N  CI WEG+NGEFKLVDPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIM+KV GKRYAYKFDF GLAQA
Sbjct:   31 GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQA 122          
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Match: ets-5 (ETS domain-containing transcription factor ets-5 [Source:UniProtKB/Swiss-Prot;Acc:Q18579])

HSP 1 Score: 182.57 bits (462), Expect = 3.372e-54
Identity = 80/92 (86.96%), Postives = 86/92 (93.48%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQA 827
            G+GQIQLWQFLLELL+D+ N  CI WEG+NGEFKLVDPDEVAR+WGERKSKPNMNYDKLSRALRYYYDKNIM+KV GKRYAYKFDF GLAQA
Sbjct:   69 GTGQIQLWQFLLELLADAVNAHCIAWEGSNGEFKLVDPDEVARKWGERKSKPNMNYDKLSRALRYYYDKNIMTKVQGKRYAYKFDFQGLAQA 160          
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Match: ast-1 (Axon STeering defect [Source:UniProtKB/TrEMBL;Acc:Q22355])

HSP 1 Score: 182.57 bits (462), Expect = 1.264e-52
Identity = 80/95 (84.21%), Postives = 85/95 (89.47%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
            GSGQ QLWQFLLELLSD R    I WEGT GEFKLVDPDEVAR+WGERKSKPNMNYDK+SRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P
Sbjct:  210 GSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQP 304          
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 121.324 bits (303), Expect = 5.940e-30
Identity = 52/81 (64.20%), Postives = 66/81 (81.48%), Query Frame = 3
Query:  564 IQLWQFLLELLSDSRNISCIIW-EGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            I LWQFLLELL   +N   I W  GT+GEF+L+D + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Match: lin-1 (LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0])

HSP 1 Score: 121.324 bits (303), Expect = 5.940e-30
Identity = 52/81 (64.20%), Postives = 66/81 (81.48%), Query Frame = 3
Query:  564 IQLWQFLLELLSDSRNISCIIW-EGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            I LWQFLLELL   +N   I W  GT+GEF+L+D + VAR+WG+RK+KP+MNYDKLSRALRYYY+KNI+ KV GK++ Y+F
Sbjct:   24 ITLWQFLLELLQQDQNGDIIEWTRGTDGEFRLIDAEAVARKWGQRKAKPHMNYDKLSRALRYYYEKNIIKKVIGKKFVYRF 104          
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077055)

HSP 1 Score: 191.815 bits (486), Expect = 2.119e-57
Identity = 87/98 (88.78%), Postives = 88/98 (89.80%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:   80 GSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 177          
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0077054)

HSP 1 Score: 194.126 bits (492), Expect = 1.205e-55
Identity = 88/106 (83.02%), Postives = 91/106 (85.85%), Query Frame = 3
Query:  528 TNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            T+ +    GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:  305 TSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 410          
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0273355)

HSP 1 Score: 194.126 bits (492), Expect = 1.283e-55
Identity = 88/106 (83.02%), Postives = 91/106 (85.85%), Query Frame = 3
Query:  528 TNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            T+ +    GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:  305 TSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 410          
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347000)

HSP 1 Score: 194.512 bits (493), Expect = 1.216e-54
Identity = 88/106 (83.02%), Postives = 91/106 (85.85%), Query Frame = 3
Query:  528 TNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            T+ +    GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:  305 TSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 410          
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Match: Ets65A (gene:FBgn0005658 transcript:FBtr0347001)

HSP 1 Score: 194.126 bits (492), Expect = 5.254e-54
Identity = 88/106 (83.02%), Postives = 91/106 (85.85%), Query Frame = 3
Query:  528 TNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            T+ +    GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:  305 TSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 410          
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 190.66 bits (483), Expect = 1.940e-57
Identity = 85/103 (82.52%), Postives = 95/103 (92.23%), Query Frame = 3
Query:  549 QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            +GSGQIQLWQFLLELLSDS N++CI WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQ   P+++   +
Sbjct:   33 KGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAI 135          
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 191.43 bits (485), Expect = 1.945e-57
Identity = 85/103 (82.52%), Postives = 95/103 (92.23%), Query Frame = 3
Query:  549 QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            +GSGQIQLWQFLLELLSDS N++CI WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQ   P+++   +
Sbjct:   53 KGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAI 155          
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 193.356 bits (490), Expect = 1.296e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + ST+      +P
Sbjct:  285 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTMYKYPSELP 394          
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 193.356 bits (490), Expect = 1.333e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + ST+      +P
Sbjct:  276 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTMYKYPSELP 385          
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Match: erg (ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-GENE-041212-40])

HSP 1 Score: 190.274 bits (482), Expect = 9.752e-55
Identity = 86/102 (84.31%), Postives = 93/102 (91.18%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++
Sbjct:  253 GSGQIQLWQFLLELLSDSCNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPDSSI 354          
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Match: FEV (FEV, ETS transcription factor [Source:NCBI gene;Acc:100485880])

HSP 1 Score: 185.652 bits (470), Expect = 3.077e-55
Identity = 86/102 (84.31%), Postives = 89/102 (87.25%), Query Frame = 3
Query:  540 WRP------QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQA 827
            WRP      +GSGQIQLWQFLLELLSD  N +CI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQ 
Sbjct:   32 WRPFSSGVQKGSGQIQLWQFLLELLSDHANANCIAWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMAKVHGKRYAYKFDFHGLAQV 133          
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 192.586 bits (488), Expect = 3.438e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   ST+      +P
Sbjct:  286 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSELP 395          
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 192.586 bits (488), Expect = 5.087e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   ST+      +P
Sbjct:  304 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSELP 413          
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 192.971 bits (489), Expect = 5.609e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   ST+      +P
Sbjct:  313 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSELP 422          
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Match: erg (v-ets avian erythroblastosis virus E26 oncogene homolog [Source:NCBI gene;Acc:100216056])

HSP 1 Score: 191.815 bits (486), Expect = 7.274e-55
Identity = 87/110 (79.09%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   ST+      +P
Sbjct:  287 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESTMYKYPSELP 396          
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 190.66 bits (483), Expect = 2.710e-55
Identity = 86/110 (78.18%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  215 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 324          
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.045 bits (484), Expect = 8.258e-55
Identity = 86/110 (78.18%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  267 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 376          
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Match: Fli1 (Friend leukemia integration 1 [Source:MGI Symbol;Acc:MGI:95554])

HSP 1 Score: 191.045 bits (484), Expect = 8.356e-55
Identity = 85/102 (83.33%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + +++
Sbjct:  277 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTETSM 378          
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.045 bits (484), Expect = 1.112e-54
Identity = 86/110 (78.18%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  284 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 393          
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Match: Erg (ETS transcription factor [Source:MGI Symbol;Acc:MGI:95415])

HSP 1 Score: 191.045 bits (484), Expect = 1.257e-54
Identity = 86/110 (78.18%), Postives = 95/110 (86.36%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S++      +P
Sbjct:  291 GSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP 400          
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Match: sp|Q01414|ERG_LYTVA (Transcriptional regulator ERG homolog (Fragment) OS=Lytechinus variegatus OX=7654 GN=ERG PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.063e-56
Identity = 85/94 (90.43%), Postives = 89/94 (94.68%), Query Frame = 3
Query:  555 SGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
            SGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P
Sbjct:    1 SGQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQP 94          
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Match: sp|A3FEM2|FEV_DANRE (Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.468e-56
Identity = 85/103 (82.52%), Postives = 95/103 (92.23%), Query Frame = 3
Query:  549 QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            +GSGQIQLWQFLLELLSDS N++CI WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQ   P+++   +
Sbjct:   53 KGSGQIQLWQFLLELLSDSANMTCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFNGLAQVCQPSSTEQAI 155          
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Match: sp|P29774|ETS3_DROME (DNA-binding protein D-ETS-3 OS=Drosophila melanogaster OX=7227 GN=Ets65A PE=2 SV=3)

HSP 1 Score: 194.126 bits (492), Expect = 1.208e-54
Identity = 88/106 (83.02%), Postives = 91/106 (85.85%), Query Frame = 3
Query:  528 TNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            T+ +    GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLA A  P  S
Sbjct:  305 TSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAS 410          
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Match: sp|Q01543|FLI1_HUMAN (Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.269e-54
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  277 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 378          
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Match: sp|Q29RS8|FLI1_BOVIN (Friend leukemia integration 1 transcription factor OS=Bos taurus OX=9913 GN=FLI1 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.466e-54
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  277 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 378          
BLAST of Friend leukemia integration 1 vs. TrEMBL
Match: A0A1Z1R1Z6 (Friend leukemia integration 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 440/440 (100.00%), Postives = 440/440 (100.00%), Query Frame = 3
Query:  168 EQKLDPFSNGAANKQVNNFEGXXXXXXXXKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAKYHQNLFQHXXXXXXXXXXXXXVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPXXXXXXXXXXXFNSGVSLIPAMHPYNQLVXXXXXXXXXXXXXDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN 1487
            EQKLDPFSNGAANKQVNNFEGRNSNNNSRKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFNSNSENGSGNISNSTTNSTSSHSIPSSLSSNIYAKYHQNLFQHAAAAASSMIAPAPVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPSSSPISQLHSSFNSGVSLIPAMHPYNQLVNSLSHSTSNSNSNDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN
Sbjct:    6 EQKLDPFSNGAANKQVNNFEGRNSNNNSRKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFNSNSENGSGNISNSTTNSTSSHSIPSSLSSNIYAKYHQNLFQHAAAAASSMIAPAPVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPSSSPISQLHSSFNSGVSLIPAMHPYNQLVNSLSHSTSNSNSNDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN 445          
BLAST of Friend leukemia integration 1 vs. TrEMBL
Match: A0A3Q8PZH5 (Transcriptional regulator ERG-like protein, isoform 4 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.267e-61
Identity = 96/118 (81.36%), Postives = 104/118 (88.14%), Query Frame = 3
Query:  522 NSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGS 875
            +S +  WRPQGSGQIQLWQFLLELLSDS N   I WEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P+++  + SS  GS
Sbjct:   78 DSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPSSTDISHSSVCGS 195          
BLAST of Friend leukemia integration 1 vs. TrEMBL
Match: A0A267GH30 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011985g3 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.464e-60
Identity = 95/101 (94.06%), Postives = 96/101 (95.05%), Query Frame = 3
Query:  534 GQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
              WRPQGSGQIQLWQFLLELLSDSRN SCIIWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDF+GLAQAM P
Sbjct:   99 AHWRPQGSGQIQLWQFLLELLSDSRNSSCIIWEGTNGEFKLSDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFAGLAQAMQP 199          
BLAST of Friend leukemia integration 1 vs. TrEMBL
Match: A0A267EC85 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011985g1 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.508e-60
Identity = 95/101 (94.06%), Postives = 96/101 (95.05%), Query Frame = 3
Query:  534 GQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
              WRPQGSGQIQLWQFLLELLSDSRN SCIIWEGTNGEFKL DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDF+GLAQAM P
Sbjct:  100 AHWRPQGSGQIQLWQFLLELLSDSRNSSCIIWEGTNGEFKLSDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFAGLAQAMQP 200          
BLAST of Friend leukemia integration 1 vs. TrEMBL
Match: A0A3Q8PZR7 (Transcriptional regulator ERG-like protein, isoform 2 OS=Crepidula fornicata OX=176853 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.606e-60
Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 3
Query:  522 NSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            +S +  WRPQGSGQIQLWQFLLELLSDS N   I WEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P+++  T 
Sbjct:   78 DSAHAPWRPQGSGQIQLWQFLLELLSDSANAGSITWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQPSSTDPTA 189          
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Match: fev (protein FEV [Source:NCBI gene;Acc:103022914])

HSP 1 Score: 189.119 bits (479), Expect = 7.552e-57
Identity = 96/141 (68.09%), Postives = 105/141 (74.47%), Query Frame = 3
Query:  429 VPDYCSSSYISTPFNQY--SRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            +P  C     S  FN Y    + NL +  +  S S       +GSGQIQLWQFLLELLSDS N SCI WEGTNGEFKL+DPDEVARRWGERKSKP+MNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDF GLAQ   P ++
Sbjct:    1 MPQRCGGG--SLVFNMYLSDPTENLLKDTKTSSWSPINTGVQKGSGQIQLWQFLLELLSDSSNTSCIAWEGTNGEFKLLDPDEVARRWGERKSKPSMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFHGLAQVCQPTST 139          
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Match: fli1a (Friend leukemia integration 1 transcription factor [Source:NCBI gene;Acc:103025486])

HSP 1 Score: 192.586 bits (488), Expect = 2.609e-55
Identity = 86/102 (84.31%), Postives = 93/102 (91.18%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + ST+
Sbjct:  275 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTM 376          
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Match: fli1a (Friend leukemia integration 1 transcription factor [Source:NCBI gene;Acc:103025486])

HSP 1 Score: 191.43 bits (485), Expect = 2.716e-55
Identity = 86/102 (84.31%), Postives = 93/102 (91.18%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + ST+
Sbjct:  268 GSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESTM 369          
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 191.045 bits (484), Expect = 3.108e-55
Identity = 87/110 (79.09%), Postives = 94/110 (85.45%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S+V      +P
Sbjct:  247 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDLP 356          
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Match: erg (ETS transcription factor ERG [Source:NCBI gene;Acc:103046049])

HSP 1 Score: 192.2 bits (487), Expect = 4.187e-55
Identity = 87/110 (79.09%), Postives = 94/110 (85.45%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIP 881
            GSGQIQLWQFLLELLSDS N  CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+   S+V      +P
Sbjct:  299 GSGQIQLWQFLLELLSDSTNSGCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSVYKYPTDLP 408          
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-426])

HSP 1 Score: 193.741 bits (491), Expect = 2.256e-59
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N +CI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S+V
Sbjct:   30 GSGQIQLWQFLLELLSDSSNANCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSV 131          
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Match: fev (FEV transcription factor, ETS family member [Source:NCBI gene;Acc:791175])

HSP 1 Score: 169.088 bits (427), Expect = 4.318e-50
Identity = 74/86 (86.05%), Postives = 79/86 (91.86%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDF 809
            GSGQIQLWQFLLELLSD+ N  CI WEG  GEFKL DPDEVAR+WG+RK+KPNMNYDKLSRALRYYYDKNIMSKVHGKRYAY+FDF
Sbjct:    2 GSGQIQLWQFLLELLSDAANAHCIAWEGACGEFKLTDPDEVARQWGKRKAKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYRFDF 87          
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002472.1 (pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 gene:ENSPMAG00000002241.1 transcript:ENSPMAT00000002472.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 5.371e-30
Identity = 51/82 (62.20%), Postives = 63/82 (76.83%), Query Frame = 3
Query:  558 GQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            G +QLWQFL+ LL D  +   I+W G   EFKL+DP+EVAR WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:  375 GSLQLWQFLVALLEDPAHAGTIVWTGRGMEFKLLDPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 456          
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Match: etv1 (ETS variant transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-070104-1])

HSP 1 Score: 117.472 bits (293), Expect = 7.445e-30
Identity = 56/100 (56.00%), Postives = 69/100 (69.00%), Query Frame = 3
Query:  549 QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF--DFSGLAQAMHPNN 842
            Q  G +QLWQFL+ LL D  N   I W G   EFKL++P+EVAR+WG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF  D   L     P+N
Sbjct:  160 QRRGSLQLWQFLVALLDDPANGHLITWTGRGMEFKLLEPEEVARKWGVQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSLAFPDN 259          
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Match: ETV3 (ETS variant transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:3492])

HSP 1 Score: 115.931 bits (289), Expect = 1.175e-29
Identity = 52/90 (57.78%), Postives = 63/90 (70.00%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLA 821
            G  Q+QLW F+LELL        I W+G  GEF + +P+EVAR WG RK KP+MNYDKLSRALRYYY+K I+ K  GKRY YKF+ + L 
Sbjct:   14 GCRQVQLWHFILELLGKREFRHVIAWQGDCGEFIIKNPEEVARLWGARKCKPHMNYDKLSRALRYYYNKRILYKTKGKRYTYKFNVNKLV 103          
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Match: EDO39973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F6])

HSP 1 Score: 182.185 bits (461), Expect = 3.419e-56
Identity = 83/98 (84.69%), Postives = 89/98 (90.82%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNS 845
            GSGQIQLWQFLLELLSD +N +CI WEGTNGEFKLVDPDEVARRWGERK+KPNMNYDKLSRALRYYYDKNIM+K+HGKRYAYK+DF GLAQ   P  S
Sbjct:   11 GSGQIQLWQFLLELLSDPKNANCIAWEGTNGEFKLVDPDEVARRWGERKNKPNMNYDKLSRALRYYYDKNIMTKIHGKRYAYKYDFQGLAQLNQPITS 108          
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Match: EDO43493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYB7])

HSP 1 Score: 124.405 bits (311), Expect = 3.268e-34
Identity = 53/80 (66.25%), Postives = 66/80 (82.50%), Query Frame = 3
Query:  564 IQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            IQLWQFLLELL+D      I+W G  GEFKL DP++VA++WG+RK+KP MNY+KLSRALRYYYD +++ KVHGKR+ YKF
Sbjct:    1 IQLWQFLLELLTDKTCRHLIMWVGEEGEFKLNDPEQVAQQWGKRKNKPAMNYEKLSRALRYYYDGDMIHKVHGKRFVYKF 80          
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Match: EDO37550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFF5])

HSP 1 Score: 117.087 bits (292), Expect = 1.468e-31
Identity = 53/85 (62.35%), Postives = 64/85 (75.29%), Query Frame = 3
Query:  549 QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            Q  G +QLWQFL+ LL +    S I W G   EFKL+DP+EVARRWG +K++P MNYDKLSR+LRYYY+K IM KV G+RY YKF
Sbjct:    2 QRRGSLQLWQFLVALLDEPECSSFIAWTGRGLEFKLIDPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF 86          
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Match: EDO44339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW27])

HSP 1 Score: 109.383 bits (272), Expect = 4.680e-29
Identity = 51/81 (62.96%), Postives = 61/81 (75.31%), Query Frame = 3
Query:  564 IQLWQFLLELLSDSRNISCIIWEG-TNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            I LW+FLL+LL+D R  S I W    +GEFKL++ +EVARRWG  K +P MNYDKLSRALRYYY K I+ KVHG+R  YKF
Sbjct:    3 IHLWEFLLDLLADGRYSSIISWTNRESGEFKLLNQEEVARRWGHLKHRPGMNYDKLSRALRYYYQKGIIKKVHGQRLVYKF 83          
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Match: EDO45310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ6])

HSP 1 Score: 107.457 bits (267), Expect = 1.987e-28
Identity = 50/81 (61.73%), Postives = 61/81 (75.31%), Query Frame = 3
Query:  564 IQLWQFLLELLSDSRNISCIIW-EGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKF 803
            + LW+FLLELL+D    S I W +   GEFKL + +EVARRWG+ K +P MNYDKLSRALRYYY KNI+ KV+G+R  YKF
Sbjct:    3 VHLWEFLLELLADESCASMISWTKKEEGEFKLRNQEEVARRWGDLKQRPGMNYDKLSRALRYYYQKNIIKKVNGQRLVYKF 83          
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 194.126 bits (492), Expect = 2.440e-58
Identity = 93/137 (67.88%), Postives = 102/137 (74.45%), Query Frame = 3
Query:  480 SRSANLFQTKQHQSNSTNGQWRP------QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASG 872
            +R A+   T+     S    W P      +GSGQIQLWQFLLELLSDS N+SCI WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQ   P  +   +    G
Sbjct:   39 TRRADRDPTENLLKESKGASWGPLNTGVQKGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQPTTTEQAIYKFQG 175          
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Match: fev (protein FEV [Source:NCBI gene;Acc:111946795])

HSP 1 Score: 191.815 bits (486), Expect = 6.264e-58
Identity = 91/129 (70.54%), Postives = 98/129 (75.97%), Query Frame = 3
Query:  504 TKQHQSNSTNGQWRP------QGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASG 872
            T+     S    W P      +GSGQIQLWQFLLELLSDS N+SCI WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQ   P  +   +    G
Sbjct:   19 TENLLKESKGASWGPLNTGVQKGSGQIQLWQFLLELLSDSTNVSCIAWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLAQVCQPTTTEQAIYKFQG 147          
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.2 bits (487), Expect = 1.440e-55
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  247 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 348          
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.586 bits (488), Expect = 1.850e-55
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  276 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 377          
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Match: fli1a (Fli-1 proto-oncogene, ETS transcription factor [Source:NCBI gene;Acc:101160089])

HSP 1 Score: 192.971 bits (489), Expect = 1.889e-55
Identity = 86/102 (84.31%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  552 GSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTV 857
            GSGQIQLWQFLLELLSDS N SCI WEGTNGEFK+ DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF G+AQA+ P+ + S++
Sbjct:  283 GSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSM 384          
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Match: SMESG000080027.1 (SMESG000080027.1)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 3
Query:  153 MIEGLEQKLDPFSNGAANKQVNNFEGXXXXXXXXKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAKYHQNLFQHXXXXXXXXXXXXXVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPXXXXXXXXXXXFNSGVSLIPAMHPYNQLVXXXXXXXXXXXXXDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN 1487
            MIEGLEQKLDPFSNGAANKQVNNFEGRNSNNNSRKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFNSNSENGSGNISNSTTNSTSSHSIPSSLSSNIYAKYHQNLFQHAAAAASSMIAPAPVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPSSSPISQLHSSFNSGVSLIPAMHPYNQLVNSLSHSTSNSNSNDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN
Sbjct:    1 MIEGLEQKLDPFSNGAANKQVNNFEGRNSNNNSRKKQCEILASDSVVELKNHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFNSNSENGSGNISNSTTNSTSSHSIPSSLSSNIYAKYHQNLFQHAAAAASSMIAPAPVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPSSSPISQLHSSFNSGVSLIPAMHPYNQLVNSLSHSTSNSNSNDPTKSRPFSSIFYGNHNNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN 445          
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 211.46 bits (537), Expect = 1.235e-63
Identity = 105/151 (69.54%), Postives = 116/151 (76.82%), Query Frame = 3
Query:  435 DYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDF 887
            D   + Y  +P    S   +L  T + Q+N+   QWRPQGSGQIQLWQFLLELLSDSRN + I WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P  +  TVS    S   F
Sbjct:   37 DVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTN--QWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQP--ASPTVSGPGASPTSF 183          
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Match: SMESG000078333.1 (SMESG000078333.1)

HSP 1 Score: 211.075 bits (536), Expect = 1.355e-63
Identity = 105/151 (69.54%), Postives = 116/151 (76.82%), Query Frame = 3
Query:  435 DYCSSSYISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDF 887
            D   + Y  +P    S   +L  T + Q+N+   QWRPQGSGQIQLWQFLLELLSDSRN + I WEGTNGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF+GLAQAM P  +  TVS    S   F
Sbjct:   40 DVGQNPYPYSPLGSCSPCYSLGSTNKSQTNTN--QWRPQGSGQIQLWQFLLELLSDSRNTTFITWEGTNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFAGLAQAMQP--ASPTVSGPGASPTSF 186          
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.942e-57
Identity = 86/99 (86.87%), Postives = 91/99 (91.92%), Query Frame = 3
Query:  540 WRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
            W+ QG+GQIQLWQFLLELL+DSRN   I WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQAM P
Sbjct:   48 WKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQP 146          
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Match: SMESG000036336.1 (SMESG000036336.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.354e-57
Identity = 86/99 (86.87%), Postives = 91/99 (91.92%), Query Frame = 3
Query:  540 WRPQGSGQIQLWQFLLELLSDSRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGKRYAYKFDFSGLAQAMHP 836
            W+ QG+GQIQLWQFLLELL+DSRN   I WEG NGEFKL+DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIM+KVHGKRYAYKFDF GLAQAM P
Sbjct:   74 WKSQGTGQIQLWQFLLELLADSRNSGFISWEGNNGEFKLIDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLAQAMQP 172          
The following BLAST results are available for this feature:
BLAST of Friend leukemia integration 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLI11.950e-5784.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
ERG6.695e-5679.09ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
ERG9.307e-5679.09ETS transcription factor ERG [Source:HGNC Symbol;A... [more]
FLI11.424e-5584.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
FLI12.990e-5584.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets-51.132e-5486.96ETS domain-containing transcription factor ets-5 ... [more]
ets-53.372e-5486.96ETS domain-containing transcription factor ets-5 ... [more]
ast-11.264e-5284.21Axon STeering defect [Source:UniProtKB/TrEMBL;Acc... [more]
lin-15.940e-3064.20LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
lin-15.940e-3064.20LIN-1 [Source:UniProtKB/TrEMBL;Acc:G5EDL0][more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ets65A2.119e-5788.78gene:FBgn0005658 transcript:FBtr0077055[more]
Ets65A1.205e-5583.02gene:FBgn0005658 transcript:FBtr0077054[more]
Ets65A1.283e-5583.02gene:FBgn0005658 transcript:FBtr0273355[more]
Ets65A1.216e-5483.02gene:FBgn0005658 transcript:FBtr0347000[more]
Ets65A5.254e-5483.02gene:FBgn0005658 transcript:FBtr0347001[more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev1.940e-5782.52FEV transcription factor, ETS family member [Sourc... [more]
fev1.945e-5782.52FEV transcription factor, ETS family member [Sourc... [more]
fli1a1.296e-5579.09Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fli1a1.333e-5579.09Fli-1 proto-oncogene, ETS transcription factor a [... [more]
erg9.752e-5584.31ETS transcription factor ERG [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FEV3.077e-5584.31FEV, ETS transcription factor [Source:NCBI gene;Ac... [more]
erg3.438e-5579.09v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg5.087e-5579.09v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg5.609e-5579.09v-ets avian erythroblastosis virus E26 oncogene ho... [more]
erg7.274e-5579.09v-ets avian erythroblastosis virus E26 oncogene ho... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Erg2.710e-5578.18ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg8.258e-5578.18ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Fli18.356e-5583.33Friend leukemia integration 1 [Source:MGI Symbol;A... [more]
Erg1.112e-5478.18ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
Erg1.257e-5478.18ETS transcription factor [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Friend leukemia integration 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01414|ERG_LYTVA1.063e-5690.43Transcriptional regulator ERG homolog (Fragment) O... [more]
sp|A3FEM2|FEV_DANRE1.468e-5682.52Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=... [more]
sp|P29774|ETS3_DROME1.208e-5483.02DNA-binding protein D-ETS-3 OS=Drosophila melanoga... [more]
sp|Q01543|FLI1_HUMAN2.269e-5484.31Friend leukemia integration 1 transcription factor... [more]
sp|Q29RS8|FLI1_BOVIN2.466e-5484.31Friend leukemia integration 1 transcription factor... [more]
back to top
BLAST of Friend leukemia integration 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1Z60.000e+0100.00Friend leukemia integration 1 (Fragment) OS=Schmid... [more]
A0A3Q8PZH58.267e-6181.36Transcriptional regulator ERG-like protein, isofor... [more]
A0A267GH301.464e-6094.06ETS domain-containing protein OS=Macrostomum ligna... [more]
A0A267EC851.508e-6094.06ETS domain-containing protein OS=Macrostomum ligna... [more]
A0A3Q8PZR73.606e-6083.04Transcriptional regulator ERG-like protein, isofor... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev7.552e-5768.09protein FEV [Source:NCBI gene;Acc:103022914][more]
fli1a2.609e-5584.31Friend leukemia integration 1 transcription factor... [more]
fli1a2.716e-5584.31Friend leukemia integration 1 transcription factor... [more]
erg3.108e-5579.09ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
erg4.187e-5579.09ETS transcription factor ERG [Source:NCBI gene;Acc... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fli1a2.256e-5984.31Fli-1 proto-oncogene, ETS transcription factor a [... [more]
fev4.318e-5086.05FEV transcription factor, ETS family member [Sourc... [more]
ENSPMAT00000002472.15.371e-3062.20pep scaffold:Pmarinus_7.0:GL476893:38150:62026:-1 ... [more]
etv17.445e-3056.00ETS variant transcription factor 1 [Source:ZFIN;Ac... [more]
ETV31.175e-2957.78ETS variant transcription factor 3 [Source:HGNC Sy... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399733.419e-5684.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434933.268e-3466.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375501.468e-3162.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443394.680e-2962.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453101.987e-2861.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fev2.440e-5867.88protein FEV [Source:NCBI gene;Acc:111946795][more]
fev6.264e-5870.54protein FEV [Source:NCBI gene;Acc:111946795][more]
fli1a1.440e-5584.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a1.850e-5584.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
fli1a1.889e-5584.31Fli-1 proto-oncogene, ETS transcription factor [So... [more]
back to top
BLAST of Friend leukemia integration 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080027.10.000e+0100.00SMESG000080027.1[more]
SMESG000078333.11.235e-6369.54SMESG000078333.1[more]
SMESG000078333.11.355e-6369.54SMESG000078333.1[more]
SMESG000036336.11.942e-5786.87SMESG000036336.1[more]
SMESG000036336.12.354e-5786.87SMESG000036336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014799 ID=SMED30014799|Name=Friend leukemia integration 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1492bp
TCCTAATTGGAATAATAAAACCAACAAACAACAAGTAGATCCACAAAAAC
TGAGAAGTGACTGATCTTCTTAGAAATAAAGGAAGTAGTGTCATTCATTT
CCCGATTGAAGACGAGCTGAAATCCGGATTGTAGTTATATATTAGACAGC
CGATGATAGAAGGACTCGAGCAGAAGTTAGATCCATTTTCGAATGGAGCA
GCAAACAAACAAGTAAACAATTTTGAAGGAAGGAATTCTAATAACAATTC
GAGGAAAAAACAATGTGAAATTCTAGCATCGGATTCAGTTGTTGAACTGA
AAAATCACAATTTCACTATTGGAAACAATGCCAGCGGACTTGGACTATCG
GAAATTTGTGGAATGGGATTCGGTAGTTTAGACCCGTCTTTCAATATCAA
GTCACAATGGCCGATGGGAACGAATCTCGTTCCAGATTATTGCAGTTCAT
CCTATATTTCGACTCCCTTCAATCAGTACTCCAGATCAGCCAATTTGTTC
CAAACAAAACAACATCAATCAAATTCCACTAATGGACAATGGAGACCTCA
AGGATCCGGGCAAATCCAATTGTGGCAATTTCTATTAGAGCTGCTATCGG
ATTCAAGAAATATTAGCTGCATTATTTGGGAAGGTACAAATGGAGAGTTT
AAACTCGTTGATCCGGATGAAGTAGCTAGAAGATGGGGAGAAAGAAAAAG
TAAACCAAACATGAATTACGATAAACTAAGTCGAGCACTAAGATATTATT
ATGATAAAAATATAATGAGCAAAGTTCATGGTAAACGGTATGCTTATAAG
TTTGATTTTTCTGGTCTTGCTCAAGCAATGCATCCGAATAATTCACTTTC
AACAGTCAGTTCTGCATCAGGAAGCATACCAGATTTTAATAGTAATTCTG
AAAATGGAAGTGGAAATATTTCAAATTCTACTACTAATTCAACTAGTTCC
CATTCTATTCCTTCCTCCTTATCGTCTAATATTTATGCCAAATATCATCA
AAACTTATTTCAACACGCAGCAGCCGCTGCATCATCAATGATTGCTCCTG
CACCAGTAAATAATTTGATTTCACAATCATCAACCCTTAGTGTTCAATCT
CCAACTTCATTCAATCCTTTATCCTTCAAATGCGGTCAAATGTCTTCATC
AAATTCAGAACAGTATTTGATTAATCCTAGTTCCAGTCCGATAAGTCAGT
TACACTCTTCATTCAACTCAGGTGTATCCCTGATTCCCGCAATGCATCCC
TACAATCAGTTAGTAAATTCTCTCTCTCATTCAACAAGCAATTCAAATTC
CAATGATCCTACGAAATCGAGACCTTTTTCTTCAATATTTTATGGTAACC
ACAACAACGATTGCGACCCCTCTCCATTTCAGATATCTCCTTATCCAATC
AATTCCTATCAATGGCCAACAAATCTGACCAGATCTTTTGCCGATGCCAG
TAATTATGCTGGCTACCAGTCCACTGTGTATTATAACTAGTT
back to top

protein sequence of SMED30014799-orf-1

>SMED30014799-orf-1 ID=SMED30014799-orf-1|Name=SMED30014799-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MIEGLEQKLDPFSNGAANKQVNNFEGRNSNNNSRKKQCEILASDSVVELK
NHNFTIGNNASGLGLSEICGMGFGSLDPSFNIKSQWPMGTNLVPDYCSSS
YISTPFNQYSRSANLFQTKQHQSNSTNGQWRPQGSGQIQLWQFLLELLSD
SRNISCIIWEGTNGEFKLVDPDEVARRWGERKSKPNMNYDKLSRALRYYY
DKNIMSKVHGKRYAYKFDFSGLAQAMHPNNSLSTVSSASGSIPDFNSNSE
NGSGNISNSTTNSTSSHSIPSSLSSNIYAKYHQNLFQHAAAAASSMIAPA
PVNNLISQSSTLSVQSPTSFNPLSFKCGQMSSSNSEQYLINPSSSPISQL
HSSFNSGVSLIPAMHPYNQLVNSLSHSTSNSNSNDPTKSRPFSSIFYGNH
NNDCDPSPFQISPYPINSYQWPTNLTRSFADASNYAGYQSTVYYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0000461lateral branch
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0030154cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000418Ets domainPRINTSPR00454ETSDOMAINcoord: 200..218
score: 52.63
coord: 162..180
score: 55.58
coord: 181..199
score: 72.42
coord: 138..151
score: 66.06
IPR000418Ets domainSMARTSM00413etsneu2coord: 137..222
e-value: 1.0E-55
score: 201.1
IPR000418Ets domainPFAMPF00178Etscoord: 139..217
e-value: 7.0E-35
score: 119.3
IPR000418Ets domainPROSITEPS00346ETS_DOMAIN_2coord: 184..199
IPR000418Ets domainPROSITEPS00345ETS_DOMAIN_1coord: 140..148
IPR000418Ets domainPROSITEPS50061ETS_DOMAIN_3coord: 138..218
score: 47.222
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 101..235
e-value: 2.9E-48
score: 165.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 247..267
NoneNo IPR availablePANTHERPTHR11849:SF274DNA-BINDING PROTEIN D-ETS-3coord: 110..275
NoneNo IPR availablePANTHERPTHR11849ETScoord: 110..275
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 135..271