Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30014795
Length (bp)1498
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30014795) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30014795) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30014795) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30014795) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014795

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30014795h1SMcG0010043 dd_Smed_v4_10164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014795h1SMcG0010043 dd_Smed_v4_10164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17A (serine/threonine kinase 17a [Source:HGNC Symbol;Acc:HGNC:11395])

HSP 1 Score: 194.897 bits (494), Expect = 2.016e-56
Identity = 112/276 (40.58%), Postives = 170/276 (61.59%), Query Frame = 3
Query:  219 WRSGYYFH-GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSE 1040
            ++ GY    G+E+GRG F+ V +       KE A K +R+RR G D    I  EI +++  + +    VI L+ V+E+  E+ LV+E A GG +FD  V +      E  VQ++ +++L  +  +H  ++VHLD+K  NILL    P  DI + DFGL+  L + +  RE++GTP+Y+APEI++Y+ ISM TDMWS+GVLTY +LT  SPF+ + K+ T LN+S++N S+ E++F    + A DFI  L+VK+P  R +A E  KH WL+   + E
Sbjct:   55 FQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLE--LAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQE 328          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17A (serine/threonine kinase 17a [Source:HGNC Symbol;Acc:HGNC:11395])

HSP 1 Score: 194.897 bits (494), Expect = 2.016e-56
Identity = 112/276 (40.58%), Postives = 170/276 (61.59%), Query Frame = 3
Query:  219 WRSGYYFH-GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSE 1040
            ++ GY    G+E+GRG F+ V +       KE A K +R+RR G D    I  EI +++  + +    VI L+ V+E+  E+ LV+E A GG +FD  V +      E  VQ++ +++L  +  +H  ++VHLD+K  NILL    P  DI + DFGL+  L + +  RE++GTP+Y+APEI++Y+ ISM TDMWS+GVLTY +LT  SPF+ + K+ T LN+S++N S+ E++F    + A DFI  L+VK+P  R +A E  KH WL+   + E
Sbjct:   55 FQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLE--LAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQE 328          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17B (serine/threonine kinase 17b [Source:HGNC Symbol;Acc:HGNC:11396])

HSP 1 Score: 187.963 bits (476), Expect = 3.383e-54
Identity = 105/271 (38.75%), Postives = 165/271 (60.89%), Query Frame = 3
Query:  210 LSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            + ++ + Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + KS   VI L+ V+E+  E+ L++E A GG +F + + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++      RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   25 MENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLE--LAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWL 293          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: STK17B (serine/threonine kinase 17b [Source:HGNC Symbol;Acc:HGNC:11396])

HSP 1 Score: 187.963 bits (476), Expect = 3.383e-54
Identity = 105/271 (38.75%), Postives = 165/271 (60.89%), Query Frame = 3
Query:  210 LSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            + ++ + Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + KS   VI L+ V+E+  E+ L++E A GG +F + + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++      RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   25 MENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLE--LAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWL 293          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK3 (death associated protein kinase 3 [Source:HGNC Symbol;Acc:HGNC:2676])

HSP 1 Score: 182.185 bits (461), Expect = 3.180e-51
Identity = 97/268 (36.19%), Postives = 165/268 (61.57%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQ-SVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 1028
            +Y  G+E+G G F+ V +       KE A K I++RR    R    R+EI+   +++ +    ++I L+ + E+  +V L++E+  GG LFD + E  + L E+   Q  K++L  +  +H   I H D+K +NI LL +  P+  I L DFG+A ++ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+  +
Sbjct:   12 HYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKES-LTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAI 278          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: dapk-1 (Death-associated protein kinase dapk-1 [Source:UniProtKB/Swiss-Prot;Acc:O44997])

HSP 1 Score: 163.696 bits (413), Expect = 6.522e-43
Identity = 93/261 (35.63%), Postives = 159/261 (60.92%), Query Frame = 3
Query:  249 EIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXX----EIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            E+G G F+ V RV      ++ A K I++RR    R    RQ    E++++Q +   S  +V++L+ V+E+  +V +V+E+  GG LFD V  +   L E       K++L A+  +H  +IVHLDIK +N++L++    + I + DFGL+ ++  G V +++VGTP+++APE++NYE +S  TDMW++GV+TY LL+  SPF+ D ++ T  N++++ + F +  F  +   AKDFI +L V+  + R +  E  +H W+
Sbjct:   33 ELGSGQFAVVRRVRDRKTGEKYAAKFIKKRRYATSRRGVTRQNIEREVRVLQKIRGNS--NVVELHAVYETASDVIIVLELVSGGELFDHVC-AKECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQ-RGDSQIKIIDFGLSREIEPGAVVKDMVGTPEFVAPEVVNYEALSPATDMWAVGVVTYILLSGGSPFLGDNRDETFSNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWI 289          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 157.532 bits (397), Expect = 1.063e-40
Identity = 96/275 (34.91%), Postives = 158/275 (57.45%), Query Frame = 3
Query:  222 RSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYI---EVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLS 1037
            ++ Y  H +E+G+G +  VYR T     K  A K+++ R G          EI +M  L ++      KL  +HE++    E+ L+ E   GG LF+ + E  + + E  V+    ++L  +  MH+  IVHLD+K +NILL+    S ++ + DFGLA +L   K  + L GTP++ APE++NY+ + + TDMW++GV++Y LL+  SPF+ D+ E T+ NVS  ++ F +  +    D AKDFI +L++K    R+S  +A +H W++  +LS
Sbjct: 5227 QAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIH--EISMMNQLHHE------KLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLK-AKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLS 5491          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 157.532 bits (397), Expect = 1.063e-40
Identity = 96/275 (34.91%), Postives = 158/275 (57.45%), Query Frame = 3
Query:  222 RSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYI---EVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLS 1037
            ++ Y  H +E+G+G +  VYR T     K  A K+++ R G          EI +M  L ++      KL  +HE++    E+ L+ E   GG LF+ + E  + + E  V+    ++L  +  MH+  IVHLD+K +NILL+    S ++ + DFGLA +L   K  + L GTP++ APE++NY+ + + TDMW++GV++Y LL+  SPF+ D+ E T+ NVS  ++ F +  +    D AKDFI +L++K    R+S  +A +H W++  +LS
Sbjct: 5227 QAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIH--EISMMNQLHHE------KLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLK-AKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLS 5491          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 157.532 bits (397), Expect = 1.166e-40
Identity = 96/275 (34.91%), Postives = 158/275 (57.45%), Query Frame = 3
Query:  222 RSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYI---EVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLS 1037
            ++ Y  H +E+G+G +  VYR T     K  A K+++ R G          EI +M  L ++      KL  +HE++    E+ L+ E   GG LF+ + E  + + E  V+    ++L  +  MH+  IVHLD+K +NILL+    S ++ + DFGLA +L   K  + L GTP++ APE++NY+ + + TDMW++GV++Y LL+  SPF+ D+ E T+ NVS  ++ F +  +    D AKDFI +L++K    R+S  +A +H W++  +LS
Sbjct: 5227 QAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIH--EISMMNQLHHE------KLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLK-AKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLS 5491          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 156.377 bits (394), Expect = 2.814e-40
Identity = 96/275 (34.91%), Postives = 158/275 (57.45%), Query Frame = 3
Query:  222 RSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYI---EVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLS 1037
            ++ Y  H +E+G+G +  VYR T     K  A K+++ R G          EI +M  L ++      KL  +HE++    E+ L+ E   GG LF+ + E  + + E  V+    ++L  +  MH+  IVHLD+K +NILL+    S ++ + DFGLA +L   K  + L GTP++ APE++NY+ + + TDMW++GV++Y LL+  SPF+ D+ E T+ NVS  ++ F +  +    D AKDFI +L++K    R+S  +A +H W++  +LS
Sbjct: 12557 QAKYIIH-EELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIH--EISMMNQLHHE------KLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKN-SNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLS 12821          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0301020)

HSP 1 Score: 170.629 bits (431), Expect = 6.507e-46
Identity = 96/263 (36.50%), Postives = 148/263 (56.27%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            Y        RG F+ V R          A K ++RRR      + I+ EI ++  ++ +   +++ LN VHE+  + AL++E+A GG L  ++ ++   L E   +   + +L AL  +H  +I HLD+K  NILL        + LCDFG++  +  G   RE+ GTPDY+APE++ YE +S+ TD+WS+GVLTY LL+  SPF  DTK+ T LN+S+   +FP++ F      A DFI + +  +PN R++AT    H WL
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVL--MLCEGEDNIVNLNAVHETRSDTALLLELATGGELQTIL-DNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWL 295          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0301021)

HSP 1 Score: 170.629 bits (431), Expect = 6.507e-46
Identity = 96/263 (36.50%), Postives = 148/263 (56.27%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            Y        RG F+ V R          A K ++RRR      + I+ EI ++  ++ +   +++ LN VHE+  + AL++E+A GG L  ++ ++   L E   +   + +L AL  +H  +I HLD+K  NILL        + LCDFG++  +  G   RE+ GTPDY+APE++ YE +S+ TD+WS+GVLTY LL+  SPF  DTK+ T LN+S+   +FP++ F      A DFI + +  +PN R++AT    H WL
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVL--MLCEGEDNIVNLNAVHETRSDTALLLELATGGELQTIL-DNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWL 295          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Drak (gene:FBgn0052666 transcript:FBtr0340295)

HSP 1 Score: 170.629 bits (431), Expect = 6.507e-46
Identity = 96/263 (36.50%), Postives = 148/263 (56.27%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            Y        RG F+ V R          A K ++RRR      + I+ EI ++  ++ +   +++ LN VHE+  + AL++E+A GG L  ++ ++   L E   +   + +L AL  +H  +I HLD+K  NILL        + LCDFG++  +  G   RE+ GTPDY+APE++ YE +S+ TD+WS+GVLTY LL+  SPF  DTK+ T LN+S+   +FP++ F      A DFI + +  +PN R++AT    H WL
Sbjct:   36 YEVEQTPFARGKFAAVRRAIHKNTGSHFAAKFLKRRRRAQSSDKEIKHEIAVL--MLCEGEDNIVNLNAVHETRSDTALLLELATGGELQTIL-DNEECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWL 295          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: sqa (gene:FBgn0259678 transcript:FBtr0299929)

HSP 1 Score: 150.599 bits (379), Expect = 5.797e-40
Identity = 89/257 (34.63%), Postives = 139/257 (54.09%), Query Frame = 3
Query:  249 EIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            E+GRG F  VY+     +  + A K +   +    R      E++IM  L +     +I+L   +E    + +V+E+ +GG LFD V +    L E   +   +++  A+  +H   IVHLD+K +NIL+        I + DFGLA +    K  R L GTP+++APE++N++ IS  TDMWS+GV+ Y L++  SPFM +    TM NV+   + F ++ F     E  DFI+KL+ K  + R++A E  KH WL
Sbjct:   39 EVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVER--EVEIMNSLQH---HLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336647)

HSP 1 Score: 149.828 bits (377), Expect = 7.202e-39
Identity = 101/290 (34.83%), Postives = 149/290 (51.38%), Query Frame = 3
Query:  192 RKTSQDLS--------SWRSGYYFHGK-----EIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            R TS D S        S +SG  F  +     E+G+G F  VY+V       E  +     +       Q + +EI IM+ L +  +   ++L    ES  E+ +VME   GG LF+ V      L E       +++   +  MH  ++VHLD+K +NI+      S  I + DFGLA +L +    R L GTP++I PEII+YE I   +DMWS+GV+ Y LL+  SPFM DT   T  N+++ ++ + ++ F     EAKDFIS+L+V R   RL+A +     WLS
Sbjct:  251 RSTSSDASDRFGQATVSVQSGGDFKSRFEIIEELGKGRFGIVYKVQE-RGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPKL---LQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHT-RTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPFMGDTDVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLS 535          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 199.519 bits (506), Expect = 5.740e-59
Identity = 110/259 (42.47%), Postives = 162/259 (62.55%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            GKE+GRG F+ V R    T  K  A K I++RR G D    +  EI +++   N     V+ LN V+E+  ++ L++E A GG +F+    S   LPE  + ++ +++L  + ++HQ+++VHLD+K  NILL    P  DI + DFGLA +L S    RE++GTP+Y+APEI+NYE I+  TD+WS+GV+TY L+T ESPF  D K+ T LNVS++N  +  + F++  + A DFI KL+VK P  R SA +   H WL
Sbjct:   35 GKELGRGKFAVVKRCVEKTTGKVFAAKFIKKRRRGRDCRADVIHEIAVLEAAKNNP--RVVNLNAVYETDYDLVLMLEFAAGGEIFNHC-VSDELLPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGDIKIVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLLVKAPEDRPSAADCMTHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 199.519 bits (506), Expect = 5.740e-59
Identity = 110/259 (42.47%), Postives = 162/259 (62.55%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            GKE+GRG F+ V R    T  K  A K I++RR G D    +  EI +++   N     V+ LN V+E+  ++ L++E A GG +F+    S   LPE  + ++ +++L  + ++HQ+++VHLD+K  NILL    P  DI + DFGLA +L S    RE++GTP+Y+APEI+NYE I+  TD+WS+GV+TY L+T ESPF  D K+ T LNVS++N  +  + F++  + A DFI KL+VK P  R SA +   H WL
Sbjct:   35 GKELGRGKFAVVKRCVEKTTGKVFAAKFIKKRRRGRDCRADVIHEIAVLEAAKNNP--RVVNLNAVYETDYDLVLMLEFAAGGEIFNHC-VSDELLPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGDIKIVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAGDDKQETFLNVSQVNVEYSRETFSRVSELAVDFIRKLLVKAPEDRPSAADCMTHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17al (serine/threonine kinase 17a like [Source:ZFIN;Acc:ZDB-GENE-061103-427])

HSP 1 Score: 195.282 bits (495), Expect = 2.710e-57
Identity = 108/268 (40.30%), Postives = 165/268 (61.57%), Query Frame = 3
Query:  219 WRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +++ Y   G+E+GRG F+ V +    T  KE A K +R+RR G D    I  EI +++    ++   V+ L+ V+E+  E+ LV+E A GG +F+  V ++     E  V ++ +++L  +  +HQ NIVHLD+K  NILL    P  DI + DFGL+ ++ S    RE++GTP+Y+APEI++YE IS  TDMWS+GVLTY +LT ESPF+ + K+ T LN+S++N  + +D F    D A +FI  L++K P  R +  +   HSWL
Sbjct:   20 FKNNYDLVGRELGRGKFAVVKKCVEKTTGKEHAAKFLRKRRKGQDCRGDILNEIAVLESA--EANPYVVGLHEVYETTSEIILVLECAAGGEIFNQCVADNDEAFTEKDVIRLARQILMGVSCLHQNNIVHLDLKPQNILLTSAQPLGDIRIVDFGLSRRVDSVSEVREILGTPEYVAPEILDYEPISTATDMWSIGVLTYVMLTGESPFLGEEKQETFLNISQVNVDYSQDVFQGISDLAVNFIQSLLIKNPRKRSTVEQCLNHSWL 285          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: stk17a (serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-GENE-030131-5556])

HSP 1 Score: 191.43 bits (485), Expect = 9.468e-56
Identity = 107/260 (41.15%), Postives = 158/260 (60.77%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            GKE+GRG F+ V +    +  KE A K +R+RR G D    I  EI +++  +  +   V+ L+ V+E   E+ LV+E A GG +F+  V +      E  V+++ K++L  +  +H  N+VHLD+K  NILL    P  DI + DFGL+  LS+    RE++GTP+Y+APE++NYE IS  TDMWS+GVL Y +LT  SPF+ D K+ T LN+S+IN S+ E++  +    A  FI  L++K P  R +A +  KH WL
Sbjct:   48 GKELGRGKFAVVRKCVEKSSGKEFAAKYMRKRRKGQDCRTEIIHEIAVLE--LAAACPRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDEAFTEQEVKRLMKQILEGVSFLHNNNVVHLDLKPQNILLTSESPLGDIKIVDFGLSRLLSNSHEVREIMGTPEYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEQLDGSAIRFIKSLLIKEPENRATAEDCLKHQWL 305          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: dapk3 (death-associated protein kinase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-3026])

HSP 1 Score: 182.956 bits (463), Expect = 1.002e-51
Identity = 99/268 (36.94%), Postives = 163/268 (60.82%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQS-VIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 1028
            YY  G+E+G G F+ V +    +   E A K I++RR    R    R+EI+   +++ +   S +I L+ + E+  +V L++E+  GG LFD + E  + L E    Q  K++L  +  +H   I H D+K +NI LL +  P+  I L DFG+A Q+  G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+  +
Sbjct:   12 YYDMGEELGSGQFAIVRKCKEKSSGTEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIQHSNIITLHDIFENKTDVILILELVSGGELFDFLAEKES-LTEEEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHQIKDGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKKRMTIEDSLQHSWIKVI 278          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: ENSXETT00000029423.1 (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:101732252])

HSP 1 Score: 206.838 bits (525), Expect = 1.111e-61
Identity = 116/273 (42.49%), Postives = 169/273 (61.90%), Query Frame = 3
Query:  225 SGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSE 1040
            S Y   GKE+GRG F+ V +   L+  KE A K +R+RR G D    I  EI I++  M +    V+ L+ V+E+  E+ LVME A GG +F+  V +      E  V ++  ++L  +L +H++N+VHLD+K  NILL    P  DI + DFGL+ Q+ + K  RE++GTP+Y+APE+++YE IS  TDMWS+GVLTY +LT  SPF+ DTK+ T LN+S++N  + ++ F    + A DFI  L+VK P  R+ A +  KH WL+    SE
Sbjct:   21 SSYRLVGKELGRGKFAVVRKCVELSSGKEYAAKFLRKRRKGEDCRSDIINEIAILE--MARLSPYVVDLHEVYETNSEIVLVMEYAAGGEIFEQCVADQDEAFTEKDVVRLISQILQGVLHLHRSNVVHLDLKPQNILLTSSSPLGDIRIVDFGLSRQVDAIKEIREILGTPEYVAPEVLSYEPISTATDMWSVGVLTYVMLTGVSPFLGDTKQETFLNISQVNIQYSQEDFQGISEPAIDFIKSLLVKNPRKRIRADQCLKHPWLNSATESE 291          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:Xenbase;Acc:XB-GENE-480800])

HSP 1 Score: 194.126 bits (492), Expect = 4.040e-56
Identity = 105/261 (40.23%), Postives = 163/261 (62.45%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            G E+GRG F+ V +       KE A K +R+RR G D    I  EI +++  + +    VIKL+ V+E+  E+ LV+E A GG +F+  V E      E  V+++ +++L  +  +H+ N+VHLD+K  N+LL    P  DI + DFGL+  L++ +  RE++GTP+Y+APEI++YE IS  TDMWS+GVL Y +LT  SPF+ D K+ T LN+S++N ++  ++F    D A DFI  L++++P  R SA +  +H WL+
Sbjct:   58 GHELGRGKFAVVRKCVEKETGKEFAAKFMRKRRKGQDCRMEIIHEIAVLE--LARGSPWVIKLHEVYETATEMILVLEYAAGGEIFNQCVAEREEAFKEKDVRRLMRQILKGVAFLHRHNVVHLDLKPQNVLLTSACPLGDIKVVDFGLSRILNNNEELREIMGTPEYVAPEILSYEPISTATDMWSVGVLAYVMLTGTSPFLGDDKQQTFLNISQLNVTYSSEEFDGISDSAIDFIKALLIRKPEARSSAVDCLQHPWLA 316          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: dapk3 (death-associated protein kinase 3 [Source:NCBI gene;Acc:549766])

HSP 1 Score: 184.882 bits (468), Expect = 3.023e-52
Identity = 100/269 (37.17%), Postives = 165/269 (61.34%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQ--SVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 1028
            +Y  G+E+G G F+ V +    +   E A K I++RR    R    R+EI+   D++ + +Q  ++I L+ V E+  +V L++E+  GG LFD + +  + L E       K++L  +  +H  NI H D+K +NI LL    PS  I L DFG+A ++ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ DTK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+  +
Sbjct:   12 FYEMGEELGSGQFAIVRKCRERSTGVEYAAKFIKKRRLSSSRRGVSREEIEREVDIL-REIQHPNIITLHDVFENRTDVVLILELVSGGELFDFLAQKES-LSEEEATMFLKQILDGVHYLHHKNIAHFDLKPENIMLLDHSSPSPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLTNISGVNYDFDEEYFSNTSELAKDFIRRLLVKDPKKRMTIDQSLEHSWIKAI 278          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:100144678])

HSP 1 Score: 176.792 bits (447), Expect = 2.269e-50
Identity = 99/268 (36.94%), Postives = 165/268 (61.57%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQ--SVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSP 1025
            YY  G+E+G G F+ V +    +     A K I++RR    R    R++I+    ++ K +Q  +VI L+ V+E+  +V L++E+  GG LFD + E  + L E    +  K++L+ +  +H  +I H D+K +NI LL    P+  I + DFGLA ++ SG   + + GTP+++APEI+NYE + + +DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +++ F E+ F+ + D AKDFI +L+VK P  R++  ++  H W+ P
Sbjct:   12 YYDIGEELGSGQFAVVKKCQEKSTGVHYAAKFIKKRRTKSSRRGVTREDIEREVSIL-KEIQHPNVITLHEVYENKADVILILELVAGGELFDFLAEKES-LTEEEATEFIKQILNGVNYLHSLHIAHFDLKPENIMLLDRNAPNPRIKIIDFGLAHRIDSGNEFKNIFGTPEFVAPEIVNYEPLGLESDMWSIGVITYILLSGASPFLGETKQETLANISAVSYDFEEEFFSSTSDLAKDFIRRLLVKDPKKRMTIQDSLCHPWIKP 277          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: c7orf26 (chromosome 7 open reading frame 26 [Source:Xenbase;Acc:XB-GENE-5734232])

HSP 1 Score: 175.252 bits (443), Expect = 1.326e-49
Identity = 101/270 (37.41%), Postives = 159/270 (58.89%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIK----IMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSP 1025
            +Y    E+G G F+ V R        E A K I++R+    R   IR EI+    I++D+ +   Q++I L  V+E+  +V L++E+  GG LFD + +  + L E    +  K++L  +  +H   I H D+K +NI LL +  P   I L DFGLA  +  G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ + K+ T+ N++ +N+ F E+ F+ + + AKDFI KL+VK    RLS  EA +H W++P
Sbjct:   17 FYDIADELGSGQFAIVKRCRERKTGVEYAAKFIKKRQSPASRRGVIRGEIEREVDILKDIQH---QNIITLQDVYENKTDVVLILELVSGGELFDFLAQKES-LSEEEATRFIKQILEGVNYLHTRKIAHFDLKPENIMLLDKTIPMPHIKLIDFGLAHTIEDGVEFKNIFGTPEFVAPEIVNYEPLGLAADMWSIGVITYILLSGASPFLGENKQETLSNITAVNYEFDEEFFSHTSELAKDFIRKLLVKDTRKRLSIQEALRHPWITP 282          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:MGI Symbol;Acc:MGI:2138162])

HSP 1 Score: 189.119 bits (479), Expect = 8.683e-55
Identity = 105/264 (39.77%), Postives = 163/264 (61.74%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + +S   VI L+ V+E+  E+ LV+E A GG +F++ + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++ +    RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   32 YTLTPKELGRGKFAVVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLE--LARSCPHVINLHEVYENATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWL 293          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk2 (death-associated protein kinase 2 [Source:MGI Symbol;Acc:MGI:1341297])

HSP 1 Score: 179.874 bits (455), Expect = 1.939e-51
Identity = 100/280 (35.71%), Postives = 168/280 (60.00%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQ-SVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVESDQM 1064
            +Y  G+E+G G F+ V +    +   E A K I++R+    R    R+EI+    ++ + +  ++I L+ V+E+  +V L++E+  GG LFD + +  + L E       K++L  +  +H   I H D+K +NI LL +  P   I L DFGLA ++  G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ DTK+ T+ N++ +++ F E+ F+++ + AKDFI KL+VK    RL+  EA +H W++PV   +A V  + +
Sbjct:   22 FYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKES-LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDTQQAMVRRESV 300          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 177.563 bits (449), Expect = 9.023e-50
Identity = 96/268 (35.82%), Postives = 166/268 (61.94%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIK----IMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPST-DIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +Y  G+E+G G F+ V +        E A K I++RR    R    R+EI+    I++++ + ++   I L+ V E+  +V L++E+  GG LFD + E  + L E+   Q  K++L  +  +H   I H D+K +NI+L + + ++  I L DFG+A ++ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+
Sbjct:   12 HYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNI---ITLHDVFENKTDVVLILELVSGGELFDFLAEKES-LTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWI 275          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 177.563 bits (449), Expect = 9.023e-50
Identity = 96/268 (35.82%), Postives = 166/268 (61.94%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIK----IMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPST-DIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +Y  G+E+G G F+ V +        E A K I++RR    R    R+EI+    I++++ + ++   I L+ V E+  +V L++E+  GG LFD + E  + L E+   Q  K++L  +  +H   I H D+K +NI+L + + ++  I L DFG+A ++ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+
Sbjct:   12 HYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNI---ITLHDVFENKTDVVLILELVSGGELFDFLAEKES-LTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWI 275          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk3 (death-associated protein kinase 3 [Source:MGI Symbol;Acc:MGI:1203520])

HSP 1 Score: 177.563 bits (449), Expect = 9.023e-50
Identity = 96/268 (35.82%), Postives = 166/268 (61.94%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIK----IMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPST-DIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +Y  G+E+G G F+ V +        E A K I++RR    R    R+EI+    I++++ + ++   I L+ V E+  +V L++E+  GG LFD + E  + L E+   Q  K++L  +  +H   I H D+K +NI+L + + ++  I L DFG+A ++ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +HSW+
Sbjct:   12 HYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNI---ITLHDVFENKTDVVLILELVSGGELFDFLAEKES-LTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWI 275          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9UEE5|ST17A_HUMAN (Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 9.680e-56
Identity = 112/276 (40.58%), Postives = 170/276 (61.59%), Query Frame = 3
Query:  219 WRSGYYFH-GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSE 1040
            ++ GY    G+E+GRG F+ V +       KE A K +R+RR G D    I  EI +++  + +    VI L+ V+E+  E+ LV+E A GG +FD  V +      E  VQ++ +++L  +  +H  ++VHLD+K  NILL    P  DI + DFGL+  L + +  RE++GTP+Y+APEI++Y+ ISM TDMWS+GVLTY +LT  SPF+ + K+ T LN+S++N S+ E++F    + A DFI  L+VK+P  R +A E  KH WL+   + E
Sbjct:   55 FQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLE--LAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQE 328          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9GM70|ST17A_RABIT (Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus OX=9986 GN=STK17A PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.474e-55
Identity = 116/292 (39.73%), Postives = 175/292 (59.93%), Query Frame = 3
Query:  153 AASIHCIAGSLLPRKTSQDLSSWRSGYYFH-GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            AAS     G L   +T+     ++  Y    G+E+GRG F+ V +       KE A K +R+RR G D    I  EI +++  + +    VI L+ V+E+  E+ LV+E A GG + D  V +      E  VQ++ +++L  +  +H  ++VHLD+K  NILL    P  DI + DFGL+  + + +  RE++GTP+Y+APEI++Y+ ISM TDMWS+GVLTY +LT  SPF+ D K+ T LN+S++N S+ E++F    + A DFI KL+VK+P  R +A E  KH WL+
Sbjct:   16 AASGSGPGGLLTEIRTAIRTEPFQDCYSLSPGRELGRGKFAVVRKCIQKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLE--LAQDNPWVINLHEVYETSSEMILVLEYAAGGEISDQCVADRDEAFNEKDVQRLMRQILEGVHFLHTHDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRIVKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGDNKQETFLNISQMNLSYSEEEFDTVSESAVDFIKKLLVKKPEDRATAEECLKHPWLT 305          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q91XS8|ST17B_RAT (Serine/threonine-protein kinase 17B OS=Rattus norvegicus OX=10116 GN=Stk17b PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 2.671e-54
Identity = 106/276 (38.41%), Postives = 168/276 (60.87%), Query Frame = 3
Query:  195 KTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +T     ++ + Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + +S   VI L+ V+E+  E+ LV+E A GG +F++ + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++ +    RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   20 QTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLE--LARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWL 293          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8BG48|ST17B_MOUSE (Serine/threonine-protein kinase 17B OS=Mus musculus OX=10090 GN=Stk17b PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 6.074e-54
Identity = 105/264 (39.77%), Postives = 163/264 (61.74%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + +S   VI L+ V+E+  E+ LV+E A GG +F++ + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++ +    RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   32 YTLTPKELGRGKFAVVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLE--LARSCPHVINLHEVYENATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWL 293          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O94768|ST17B_HUMAN (Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.625e-53
Identity = 105/271 (38.75%), Postives = 165/271 (60.89%), Query Frame = 3
Query:  210 LSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDV-VRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            + ++ + Y    KE+GRG F+ V +  S +  +E A K +++RR G D    I  EI +++  + KS   VI L+ V+E+  E+ L++E A GG +F + + E    + EN V ++ K++L  +  +HQ NIVHLD+K  NILL   YP  DI + DFG++ ++      RE++GTP+Y+APEI+NY+ I+  TDMW++G++ Y LLT  SPF+ +  + T LN+S++N  + E+ F+     A DFI  L+VK P  R +A     HSWL
Sbjct:   25 MENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLE--LAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWL 293          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4E0RZ56 (Serine/threonine kinase OS=Fasciola hepatica OX=6192 GN=D915_004404 PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.395e-61
Identity = 128/280 (45.71%), Postives = 170/280 (60.71%), Query Frame = 3
Query:  225 SGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL-SPVVLSEAPVESDQ 1061
            S  Y    EIGRG F+KV RV +   N+  A KVIRR R G D +Q + +EI+I Q  +  S   V ++   H    EV L+ E A GG L+ +V +S   LP ++VQ    +LL A+  +H  ++VHLD+K +NILLR P P  D+ LCDFGLA  L +G + R+LVGTPDY APEI++Y  I + TD+WS+G +TYYLLT  SPF A TKE T  NV     S+PED F +   EA +FI KL+VK P +R SA +     W  S  + S  PV+S +
Sbjct:   28 SSKYTFKSEIGRGRFAKVNRVVNRNSNESFAAKVIRRWRNGKDTLQNVMREIRIAQ--ICCSCDRVAQIRDYHIGEREVILIFEHAVGGDLYHLVNDSDLNLPVDFVQSAVFQLLRAVSFLHSHSVVHLDVKPENILLRRPLPDCDVVLCDFGLAKFLDNGCLVRDLVGTPDYAAPEILDYNPIHLNTDIWSVGAVTYYLLTGVSPFWAPTKEQTFENVCLQRISYPEDLFGEVPREAVEFIRKLLVKNPRLRPSAADCLNDPWFQSKNIQSVPPVDSQE 305          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A068Y4I1 (Serine:threonine protein kinase 17A OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000724100 PE=4 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.249e-61
Identity = 139/345 (40.29%), Postives = 193/345 (55.94%), Query Frame = 3
Query:  168 CIAGSLLPRKTSQDLS---SWRSGYYFHGKEIGRGHFSKVYR-------------------------------VTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLM--NK---SVQSVIKLNF-VHESYIEVALVMEIAKGGCLFDVVRE---------SHNG-----------LPENYVQQITKRLLSALLVMHQ-TNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            C   S  P++ + D++   SWR  Y   G  IGRG   KV+R                               V  + D K  A+K+IRR R G D I+ IR EI++++ L   NK   +  +V  L F VHE   +VA+VME A+GG LFD+            S +G           +PE+YV  +  R+ +AL  MH+  NIVHLDIKA+NILLR+PYPSTD+ + DFGLA+ L+  K H+EL GTPDY APE+I+Y+ +S  TDMWS+GVL Y+LLT  SPF+A++K +T+ N++++   +P   F      A DFI  LI + P  RLSA++  +H WL
Sbjct:    7 CRGSSSCPKRFNSDMALNESWRQFYDTDGDAIGRGGAGKVFRIRLRCAGILHERKSSMPACLPTGEFRPSFELVNDIPDGKSLAIKIIRRFRCGRDSIEKIRNEIELIRTLQPSNKDYNAPSAVAPLLFSVHEDPTQVAIVMEFAEGGSLFDLCSPKTLNRPLLPSGDGDFSDGTTPQSRIPESYVASVLSRITNALAFMHEKANIVHLDIKAENILLRKPYPSTDVFITDFGLASVLNKSKPHKELAGTPDYAAPEVISYDPVSFATDMWSVGVLAYFLLTGVSPFLAESKALTLSNITQMKIDYPSHLFEVVSPLALDFIRSLIKRNPKARLSASQCCQHEWL 351          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A068WWE5 (Serine:threonine protein kinase 17A OS=Echinococcus granulosus OX=6210 GN=EgrG_000724100 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.210e-61
Identity = 137/345 (39.71%), Postives = 192/345 (55.65%), Query Frame = 3
Query:  168 CIAGSLLPRKTSQDLS---SWRSGYYFHGKEIGRGHFSKVYR-------------------------------VTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKS-----VQSVIKLNF-VHESYIEVALVMEIAKGGCLFDVVRE---------SHNG-----------LPENYVQQITKRLLSALLVMHQ-TNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            C   S  P++ + D++   SWR  Y   G  IGRG   KV+R                               V  + D K  A+K+IRR R G D I+ IR EI++++ L + +       +V  L F VHE   +VA+VME A+GG LFD+            S +G           +PE+YV  +  R+ +AL  MH+  NIVHLDIKA+NILLR+PYPSTD+ + DFGLA+ L+  K H+EL GTPDY APE+I+Y+ +S  TDMWS+GVL Y+LLT  SPF+A++K +T+ N++++   +P   F      A DFI  LI + P  RLSA++  +H WL
Sbjct:    7 CRGSSSRPKRFNSDMALNESWRQFYDTDGDAIGRGGAGKVFRIRLRCAGILHERKSSMPACLPTGEFRPSFELVNDIPDGKSLAIKIIRRFRCGRDSIEKIRNEIELIRTLQSSNKDYNVPSAVAPLLFSVHEDPTQVAIVMEFAEGGSLFDLCSPKTFNRPPLPSGDGDFSDGTTPQSRIPESYVSSVLSRITNALAFMHEKANIVHLDIKAENILLRKPYPSTDVFITDFGLASVLNKSKPHKELAGTPDYAAPEVISYDPVSFATDMWSVGVLAYFLLTGVSPFLAESKALTLSNITQMKIDYPSHLFEVVSPLALDFIRSLIKRNPKARLSASQCCQHEWL 351          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A504Z2A4 (Serine/threonine kinase OS=Fasciola gigantica OX=46835 GN=FGIG_02050 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.356e-61
Identity = 128/280 (45.71%), Postives = 169/280 (60.36%), Query Frame = 3
Query:  225 SGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL-SPVVLSEAPVESDQ 1061
            S  Y    EIGRG F+KV RV +   N+  A KVIRR R G D +Q + +EI+I Q  +  S   V ++   H    EV L+ E A GG L+ +V +S   LP ++VQ    +LL A+  +H  ++VHLD+K +NILLR P P  D+ LCDFGLA  L +G + R+LVGTPDY APEI++Y  I + TD+WS+G +TYYLLT  SPF A TKE T  NV     S+PED F +   EA +FI KL+VK P +R SA +     W  S    S  PV+S +
Sbjct:   28 SSKYTFKSEIGRGRFAKVNRVVNRNSNESFAAKVIRRWRNGRDTLQNVMREIRIAQ--ICCSCDRVAQIRDYHIGQREVILIFEHAVGGDLYHLVNDSDLNLPVDFVQSAVFQLLRAVSFLHSHSVVHLDVKPENILLRRPLPDCDVVLCDFGLAKFLENGCLVRDLVGTPDYAAPEILDYNPIHLNTDIWSVGAVTYYLLTGISPFWAPTKEQTFENVCLQRISYPEDLFGEVPREAVEFIRKLLVKNPRLRPSAADCLNDPWFQSKNTQSVPPVDSQE 305          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A452I5V2 (Protein kinase domain-containing protein OS=Gopherus agassizii OX=38772 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.428e-59
Identity = 118/281 (41.99%), Postives = 171/281 (60.85%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL----SPVVLSEAPVESD 1058
            Y   G+E+GRG F+ V +       +E A K +R+RR G D    I  EI ++ +L  +S   V+ L+ V+E+  E+ LV+E A GG +F   + E      E  V ++ +++L  +  +HQ N+VHLD+K  NILL    P  DI + DFGL+ ++ + +  RE++GTP+Y+APE+++YE IS  TDMWS+GVLTY +LT ESPF+ DTK+ T LN+S++N  FP D F    D+A DFI  L+VK P  R  A +  +H WL    SP V   APV +D
Sbjct:   23 YTLLGRELGRGKFAVVKKCLEKATGREFAAKFLRKRRKGEDCRLDIINEIAVL-ELAARSPH-VVDLHEVYETPAEIVLVLECAAGGEIFQQCIAEQDEAFTEQDVIRLVRQILRGVAFLHQHNVVHLDLKPQNILLTSSSPLGDIRIVDFGLSRRVDAVQEVREILGTPEYVAPEVLSYEPISTATDMWSIGVLTYVMLTGESPFLGDTKQETFLNISQVNVQFPPDVFQGISDQAIDFIRSLLVKNPRKRAKAEQCLQHPWLAPAPSPAVELAAPVRAD 301          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17al (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:103021349])

HSP 1 Score: 193.356 bits (490), Expect = 1.117e-56
Identity = 110/283 (38.87%), Postives = 170/283 (60.07%), Query Frame = 3
Query:  177 GSLLPRKTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            G +   +T   +  + + Y   G+E+GRG F+ V +       KE A K +R+RR G    + I  EI +++    K+ Q V+ L+ V+E+  E+ LV+E A GG +FD  V +S     E  V ++ +++L+ +  +H+ N+VHLD+K  NILL    P  DI + DFGL+  ++S    RE+VGTP+Y+APEI++YE+IS  TDMWS+GVLTY +LT ESPF+ +  + T LN+S++N  + +D F      A DFI  L+ K P  R +A +  +H WL+
Sbjct:   11 GMVTEPQTRTRMEPFTNYYDLVGRELGRGKFAVVKKCVEKATGKEYAAKFLRKRRKGKSCREDIMNEIAVLESA--KANQYVVGLHEVYETSNEIILVLECAAGGEIFDQCVGDSDEAFTEKDVIRLARQILTGVAFLHKKNVVHLDLKPQNILLTCTQPLGDIRIVDFGLSRHVNSTSEVREIVGTPEYVAPEILDYEKISTATDMWSIGVLTYVMLTGESPFLGNDNQETYLNISQVNVDYSQDVFHGISSLAVDFIKSLLHKNPADRATAEQCLQHPWLN 291          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17a (serine/threonine kinase 17a [Source:NCBI gene;Acc:103045004])

HSP 1 Score: 194.126 bits (492), Expect = 1.554e-56
Identity = 107/260 (41.15%), Postives = 161/260 (61.92%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            GKE+GRG F+ V +    +  +E A K +R+RR G D    I  EI +++  +  S Q V+ L+ V+E   E+ LV+E A GG +F+  V E      E  V+++ +++L  +  +H+ ++VHLD+K  NILL    P  DI + DFGL+  +S+ +  RE++GTP+Y+APE++NYE IS  TDMWS+GVL Y +LT  SPF+ D K+ T LN+S+IN S+ E++  +    A  FI  L++K P  R +A E  KH WL
Sbjct:   43 GKELGRGKFAVVRKCVEKSTGREYAAKFMRKRRKGQDCRTEIIHEIAVLE--LAASCQRVVNLHEVYELPSEMVLVLEFAAGGEIFNQCVAERDEAFKEEDVKRLLRQILEGVSFLHKRDVVHLDLKPQNILLTSNDPLGDIKIVDFGLSRMVSNNQEIREIMGTPEYVAPEVLNYEPISTATDMWSIGVLAYVMLTGISPFLGDDKQETFLNISQINISYTEEELEQLDKAAIQFIKSLLIKEPEGRATAEECLKHQWL 300          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: si:dkey-240h12.4 (death-associated protein kinase 2-like [Source:NCBI gene;Acc:103045656])

HSP 1 Score: 186.037 bits (471), Expect = 7.798e-54
Identity = 105/276 (38.04%), Postives = 163/276 (59.06%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXX----XXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREP-YPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEA 1043
            +Y  G+ +G GHF +V  +         A K ++ RR    R     +++ +E++I+Q L + ++ +   L  V ES  EV +V+E+ +GG LFD V E  N L E    +  K++L  +  MH   I H D+K +NI+L +      +I + DFGLA +L+ G+ +R L GTP YI PE+INYE +S+ +DMWS+GV+TY LL+  SPF  DT E T+ N+  + + F E  F+++ D AKDFI KL++K P+ R++A E   H W+ P+   +A
Sbjct:   12 FYEIGEILGSGHFGQVRELRERASGVSWAGKFVKLRRSVSSRLGLERKSVEREVEILQALQHTNIMA---LKDVFESRAEVVIVVELIRGGELFDFVAEKEN-LTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEYRSLCGTPQYIGPEVINYEPLSVASDMWSIGVITYILLSGLSPFQGDTDEETLRNIVDMKYEFEEQYFSQTSDMAKDFIEKLLIKEPSERMTAEECLLHPWIKPLTRKQA 283          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: si:dkey-240h12.4 (death-associated protein kinase 2-like [Source:NCBI gene;Acc:103045656])

HSP 1 Score: 186.037 bits (471), Expect = 7.798e-54
Identity = 105/276 (38.04%), Postives = 163/276 (59.06%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXX----XXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREP-YPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEA 1043
            +Y  G+ +G GHF +V  +         A K ++ RR    R     +++ +E++I+Q L + ++ +   L  V ES  EV +V+E+ +GG LFD V E  N L E    +  K++L  +  MH   I H D+K +NI+L +      +I + DFGLA +L+ G+ +R L GTP YI PE+INYE +S+ +DMWS+GV+TY LL+  SPF  DT E T+ N+  + + F E  F+++ D AKDFI KL++K P+ R++A E   H W+ P+   +A
Sbjct:   12 FYEIGEILGSGHFGQVRELRERASGVSWAGKFVKLRRSVSSRLGLERKSVEREVEILQALQHTNIMA---LKDVFESRAEVVIVVELIRGGELFDFVAEKEN-LTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEYRSLCGTPQYIGPEVINYEPLSVASDMWSIGVITYILLSGLSPFQGDTDEETLRNIVDMKYEFEEQYFSQTSDMAKDFIEKLLIKEPSERMTAEECLLHPWIKPLTRKQA 283          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:103028616])

HSP 1 Score: 181.415 bits (459), Expect = 2.814e-52
Identity = 108/283 (38.16%), Postives = 163/283 (57.60%), Query Frame = 3
Query:  171 IAGSLLPRKTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            +A  LL    +  L+      Y    E+GRG F+ V +       K  A K +R+RR G D    +  E+ +++    KS   V+ L+  +E+  ++ L++E A GG +F+    S   L E  V ++ ++ L  +  +HQ+N+VHLD+K  NILL    P  DI L DFGLA +L S    RE++GTP+Y+APEI+NYE I+  +D+WS+GV+TY L+T ESPF  + K+ T LNVS++N  + ++ F +  + A  FI KL+VK P  R SA +   H WL
Sbjct:   11 LAAGLLGEVQTAILTESLDSLYLVTGELGRGKFAVVKKCVEKATGKVFAAKFVRKRRRGRDCKAEVIHEMAVLE--AAKSNPRVVNLHAAYETEHDIVLLLEYAAGGEIFEHC-VSDELLSEGQVIRLIRQTLEGIHQLHQSNVVHLDLKPQNILLTSLNPLGDIKLVDFGLARRLGSAGELREILGTPEYVAPEILNYEPITTASDLWSVGVITYMLITGESPFAGEDKQQTFLNVSQVNVDYSKEAFARVSELAVHFIRKLLVKAPEDRPSAADCLSHPWL 290          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 182.185 bits (461), Expect = 3.815e-53
Identity = 101/256 (39.45%), Postives = 157/256 (61.33%), Query Frame = 3
Query:  258 RGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            RG F+ V R   +    E A K +R+RR G D    +  E+ I++    +S   +I L+   E+  E+ LV+E A GG +F+  V E  +   E  V+++ +++L  +  +H+ ++VHLD+K  NILL    P  DI + DFGL+ +++S +  RE++GTP+Y+APE++NYE IS  TDMWS+GVL Y +LT ESPF+ + K+ T LNVS++N S+  + F     +A  FI +L+VK P+ R +A    +H WLS
Sbjct:    3 RGKFAVVRRCVEVATGIEFAAKFLRKRRKGQDCRADVTHEMAILE--AARSCPHIIDLHDAFETPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPFLGEDKQETFLNVSQLNVSYEPEVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWLS 256          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 1.044e-46
Identity = 82/219 (37.44%), Postives = 135/219 (61.64%), Query Frame = 3
Query:  375 EIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPY-PSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNM-RLSATEADKHSWLSP 1025
            E+ I+++L + ++   I L+ V+E+  +V L++E+  GG LFD +    + L E+   +  K++L  +  +H   I H D+K +NI+L E   P   + + DFGLA  +  G   R + GTP+++ PEI+NYE + +  DMWS+GV+TY LL+  SPF+ DTKE T+ N+S + + F E+ F ++   AK+FI +L++K PN  R++  EA  H W+ P
Sbjct:   46 EVSILRELRHPNI---ISLHEVYENDTDVTLILELVSGGELFDFLAHKES-LSEDEATEFLKQILDGVSYLHCRRIAHFDLKPENIMLLENRAPKAHVKIIDFGLAQSIVDGVEFRHIFGTPEFVVPEIVNYEPLGVQADMWSIGVMTYILLSGASPFLGDTKEETLSNISAVEYKFDEEYFKQTSALAKNFIQRLLLKSPNRERMNVEEAIHHPWIKP 260          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.431e-42
Identity = 96/264 (36.36%), Postives = 148/264 (56.06%), Query Frame = 3
Query:  252 IGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSE 1040
            +G G F +V++    T     A KVI+ +            EI IM  L +    ++++L   +ES  +  L+ME   GG LFD +V E +N L E       +++   +  MHQ  I+HLD+K +NIL         I + DFGLA +    +  +   GTP+++APE++NY+ +S  TDMWSLGV+ Y LL+  SPFM +    T+ N+  +N+ F ++ F    +EAKDFIS+L++K  + R+SA++  KH+WL  V LSE
Sbjct:   39 LGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEKDEVNN--EISIMNQLKH---NNLLQLYDAYESKNDFVLIMEYIHGGELFDRIVSEDYN-LTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVN-RKGNQIKIIDFGLARRYKPREKLKVHFGTPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWL--VNLSE 293          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 159.844 bits (403), Expect = 3.724e-42
Identity = 90/261 (34.48%), Postives = 149/261 (57.09%), Query Frame = 3
Query:  261 GHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXX-----XXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREP-YPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSP 1025
            GHF+ V R    T  +E A K+IR+ R      + +      +E+ +++ L + +V   I L+ V ES  +V L++E+  GG LFD + +  + L E    +  K++L  +  +H  +I H D+K    +L E   P+  I L DFGLA  +  G   R + GTP+++APE++NYE + +  DMWS+GV+TY LL+  SPF+ D+K+ T+ N++ + + F E+ F ++   A DFI +L+VK P  R++  +   H W+ P
Sbjct:    2 GHFAVVKRCREKTSGEEFAAKLIRKSRSARSSRRGVVREDIEREVNVLRGLRHPNV---IALHDVFESKADVILILELVSGGELFDFLAKK-DALSEEEATEFIKQILDGVHYLHSKHIAHFDLKKPFFMLLECNQPNPRIKLIDFGLAHIIEEGIEFRNIFGTPEFVAPEVVNYEPLGLEADMWSIGVITYILLSGASPFLGDSKQETLTNITGVKYEFDEEYFDQTSQLAMDFIRRLLVKDPKKRMTVKDCLSHPWIKP 258          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 143.28 bits (360), Expect = 4.111e-39
Identity = 94/268 (35.07%), Postives = 147/268 (54.85%), Query Frame = 3
Query:  228 GYYF---HGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVK-RPNMRLSATEADKHSWL 1019
            G YF   H   +G G F +V R    +     A KVIR +            EI IM  L + ++   ++L   +ES  ++ L+ME  +GG LF+ + +  +GL E       +++   +  MHQ  I+HLD+K +NIL    +    I + DFGLA +    +  +   GT +++APE++NYE +S  TDMWS+GV+TY LL+  SPF+ D +  T+ N+   N+ F  + F++  ++AKDFI+ L+VK +   RLSA  A +H WL
Sbjct:   22 GTYFSLSHSDVLGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKN--EINIMNQLNHVNL---VQLFDAYESRSDITLIMEYVEGGELFNRIID-QSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRW-GYQIKIIDFGLARRYKPREKLKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGDDESETLNNIVTSNWEFDGEVFSEVSEDAKDFITNLLVKGKKRWRLSAKGALQHQWL 282          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 121.709 bits (304), Expect = 7.965e-30
Identity = 85/274 (31.02%), Postives = 140/274 (51.09%), Query Frame = 3
Query:  252 IGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIIN----------YEE---ISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSW--LSPV 1028
            +G+G F+ V +    T  K  AVK+I +R+   +     R E++++Q L +  +   ++L   +E      +VME   GG L D V  +H  + E+  ++I++++L+A+  +H   I H D+K DNIL+ +  P   + + DFGLA    +G   +   GT  Y+APE+I           YEE    S   DMWS+G L Y +LT   PF   T++     + + ++     K  +  +EA+DFI  L+   PN R +A +A  H W  +SP+
Sbjct:  204 VGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTR-ELEVLQKLNHPRI---VRLKGFYEDTESYYMVMEFVSGGDLMDFV-AAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVL-VKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSPL 471          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: MEK1 (Meiosis-specific serine/threonine protein kinase; functions in meiotic checkpoint, promotes recombination between homologous chromosomes by suppressing double strand break repair between sister chromatids; stabilizes Hop1-Thr318 phosphorylation to promote interhomolog recombination and checkpoint responses during meiosis [Source:SGD;Acc:S000005878])

HSP 1 Score: 106.301 bits (264), Expect = 4.201e-25
Identity = 70/201 (34.83%), Postives = 102/201 (50.75%), Query Frame = 3
Query:  477 IAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVH-RELVGTPDYIAPEI---INYEEISMFT--------------DMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKIN-FSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            +AKG CL          + E     I  ++L AL  +H  +IVH D+K DNILL  P P T I L DFG+A  L+S K     +VGTP+Y APE+    N +    F+              D+WSLGV+T+ +LT  SPF  D  E +++  +KI   +F   ++    D AK F+  L+      RL++ +  KH W++
Sbjct:  253 LAKGDCL--------TSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQRGYDSKCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQTDVVKRLNSKQGLKHIWIA 445          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 104.375 bits (259), Expect = 1.424e-24
Identity = 81/275 (29.45%), Postives = 141/275 (51.27%), Query Frame = 3
Query:  222 RSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXX--XEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELV----GTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKE--MTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            R+ Y F G+ +G G F  V +   L+ N++ A+K++ ++    + +Q     +E+ I+Q L   S  +++      ES  +  +V ++A GG LFD +  S     E    +I  ++L A+  MH  N+VH D+K +N+L  +   ++ + + DFG+A QL   K   +L+    G+  Y+APE++  +      D+WS+GV+TY LL   SPF+A++ E  M     S+   +F    +     + K FI K +   P  R +ATE     W++
Sbjct:   44 RTNYIF-GRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKL---SHPNIVSFKDWFESKDKFYIVTQLATGGELFDRIL-SRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQL---KGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWIT 310          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 101.293 bits (251), Expect = 6.626e-24
Identity = 72/263 (27.38%), Postives = 129/263 (49.05%), Query Frame = 3
Query:  246 KEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKR-PNMRLSATEADKHSWLSPVV 1031
            + +G G F +V+ V S+ + +  A+KV+++++    +      + + M  L+      +I++    +    + +VM+  +GG LF ++R+S    P    +     ++ AL  +H  NI++ D+K +NILL     +  I + DFG A ++ +  V   L GTPDYIAPE+I  +  +   D WSLGVL Y +L   +PF   T   T   + +    +P       +D     I+  + +R  N++  + +   H W S VV
Sbjct:   74 RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPF--LIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDR---NGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVV 328          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 103.219 bits (256), Expect = 7.608e-24
Identity = 82/295 (27.80%), Postives = 133/295 (45.08%), Query Frame = 3
Query:  195 KTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHR-ELVGTPDYIAPEII--NYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSW--------LSPVVLSEAP 1046
            KT   L   R   Y  G  +G G F++ +++   +     A  V +         + +  EI+I + + + ++   I      E    V +++EI   G L ++++     L E  V+  T ++  A+  MH   ++H D+K  NI     Y   ++ + DFGLA  L++    +  + GTP+YIAPE++   +   S   D+WSLGV+ Y LL  + PF A         +   +FSFP DK     DE K  I  ++   P  R S TE   + W        +   V+SEAP
Sbjct:   69 KTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFID---CFEDDSNVYILLEICPNGSLMELLKR-RKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNY---NLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPIS--DEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAP 354          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Z6])

HSP 1 Score: 157.532 bits (397), Expect = 9.472e-45
Identity = 90/247 (36.44%), Postives = 150/247 (60.73%), Query Frame = 3
Query:  243 GKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSV--QSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPN 977
            G EIG G F+ V + +  +   E A K +++RR    R     ++I I +  + +SV  Q +I L+ ++E+ +E  L++E+  GG LF+ + E  + L E+       +++ A+  +H  +IVHLDIK +NI+L+       + L DFGLA ++S G+  RE++GTP+++APEII++E +   TDMWS+GVLTY +L+  SPF+ D    T  N+S +++ F ++ F +    AKDFI  L++K+P 
Sbjct:   20 GDEIGSGQFAVVKKCSEKSSGLEFAAKFMKKRRSKALRRGVTLEQI-IREATVLRSVAHQGIIYLHDIYETKMEFVLILELLSGGELFEFLSE-QDFLTEDEAVGFLIQVIRAIEYLHDLSIVHLDIKPENIVLKNRTRPLHLKLIDFGLARKISKGEPVREMMGTPEFVAPEIIDFEVVGFPTDMWSIGVLTYIMLSGASPFLGDDNNETFSNISHVDYEFDDEYFKEISQPAKDFIEGLLIKKPR 264          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 150.984 bits (380), Expect = 8.207e-42
Identity = 94/281 (33.45%), Postives = 152/281 (54.09%), Query Frame = 3
Query:  225 SGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVESDQMN 1067
            + YY    E+G+G F  V +  +    K+ A K I+  +           E++IM  + +K +  +    F   S  E+ LVME+  GG LF+ V E    + EN V    K++L  L  MH+  ++HLD+K +NI++ +   S  I L DFGLA + +  +  + + GTP+++APE++ Y+ I+  TDMWS+GV+ Y LL+  SPFM D    T+ NV    + F +  F    DEAKDFI KL+V +   R+S  +  +H WL+    +   +++D++ 
Sbjct:   18 TKYYTIKDELGKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQDREDVIH--EMEIMNTIRHKRLLRLADA-FETPSQQEMILVMELVTGGELFEKVVEEE-FISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVK-QDSRQIKLIDFGLARKYNPKENLKVMFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGLSPFMGDNDAETLANVQTAEWDFDDPVFDDISDEAKDFIEKLLVLKATARISVAKCMEHPWLTTKKETGKRIKTDRLK 293          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO37024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH03])

HSP 1 Score: 145.206 bits (365), Expect = 4.191e-40
Identity = 97/263 (36.88%), Postives = 145/263 (55.13%), Query Frame = 3
Query:  258 RGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQ--SVIKLNFVHESYIEVALVMEIAKGG-----CLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLR--EPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            RG ++ V RVT  T   E A K +R+RR G D    +  E++++    N   Q   +I+L+ V+E+  E+ LV+E+A GG     C+     E  +   E  V  + +++L  +  +H+ N VHLDIK +NILL   E YP  +I + DFGLA ++  G+    +VGTP+Y+APEI+ +E +   +D+WS+GVL Y +LT  SPF  D K  T  NVS     FPE  F      A+DFI  ++ + P  R +  +   H WL
Sbjct:    1 RGQYAVVRRVTHKTTGLEYAAKFVRKRRKGQDCRSEVWHEVEVLWS-TNHPYQHTKIIQLHEVYETRTELILVLELALGGDLHRHCVALDSDEPASSRSEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNILLMTDEIYP--EIKIIDFGLARRIKPGEQICLIVGTPEYVAPEILEFEPVGKPSDIWSIGVLAYVMLTGMSPFAGDDKHETCYNVSLCAIDFPESHFDNISYTAQDFIRTVLQRCPGDRPTVEDCLSHPWL 260          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI47])

HSP 1 Score: 134.035 bits (336), Expect = 4.019e-36
Identity = 84/246 (34.15%), Postives = 136/246 (55.28%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVK 968
            +Y   +EIG+G +  V +       +  A KV+      + +      EI++M+ L   S + ++ L   + +  E+ +++E   GG LF+ + E    + E+ +  + + LL AL  MH  NIVHLD+K +NI+  E   S  I L DFGLA +L   +  +   GTPD++APE+I  + +S  +DMWSLGV+TY LL+   PF  D    T++ V+K  + F ++ F +  ++AKDFI  L+VK
Sbjct:   11 FYDMNEEIGKGAYGIVKKCVDKATGQTYAAKVVTTSNSNLRKETMR--EIEVMRKL--GSHKKLVGLIDAYHTPFEIVMILEFIPGGELFERIIEEDYLMEEDAIYYVHQVLL-ALDYMHGNNIVHLDLKPENIMC-ESINSNQIKLVDFGLARELKKDEEVKSSFGTPDFVAPEVIRMKPVSTASDMWSLGVVTYVLLSGLMPFSGDNDHDTLVKVAKAEWDFDDECFDEVSEDAKDFIEGLLVK 250          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H1])

HSP 1 Score: 132.109 bits (331), Expect = 1.603e-35
Identity = 86/243 (35.39%), Postives = 128/243 (52.67%), Query Frame = 3
Query:  252 IGRGHFSKVYRVTSLTDNKEGAVK----VXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVK 968
            I RG F  V RVT   D K G V     +             + +EI IM  + +K +  ++     +++   + ++ME   GG LF+ V +  + L E        +LL  +  +H+ N++HLD+K +NI+      S DI L DFGLA +   G     L GTP+++APE  N+E IS  TDMWS+GV+ Y LL+  SPFM D    T+ NV+   + F ++ F    D+AKDFIS L++K
Sbjct:    4 IVRGKFGVVKRVT---DKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLVGLLD---AYDANRNIVMIMEFISGGELFERVVD-EDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCVSK-DSWDIKLIDFGLAQEYKEGFKMTALKGTPEFMAPEAANFEPISKATDMWSVGVIAYILLSGLSPFMGDDNNETLSNVNMCEWDFDDESFDVISDQAKDFISSLLIK 238          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk17al (serine/threonine-protein kinase 17A [Source:NCBI gene;Acc:101163818])

HSP 1 Score: 200.29 bits (508), Expect = 2.924e-59
Identity = 109/269 (40.52%), Postives = 167/269 (62.08%), Query Frame = 3
Query:  219 WRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFD-VVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLS 1022
            + + Y   GKE+GRG F+ V + T     K+ A K +R+RR G D    I  EI +++    K+   V+ L+ V+E+  E+ LV+E A GG +F+  V ++     E  V ++ K++L+ +  +H+ N+VHLD+K  NILL    P  DI + DFGL+ ++ + +  RE++GTP+Y+APE+++YE IS  TDMWS+GVLTY +LT ESPF+ D K+ T LN+S++N  + +D F      A DFI  L+VK P  R +A E  +H WL+
Sbjct:   19 FSANYELVGKELGRGKFAVVKKCTEKATGKQYAAKFLRKRRKGEDCRMDIMNEIAVLESA--KANPYVVALHEVYETTSEIILVLECAAGGEIFNQCVADNDEAFTEKDVIRLAKQILTGVAFLHRNNVVHLDLKPQNILLTCAKPLGDIRIVDFGLSRRMDNVREVREILGTPEYVAPEVLSYEPISTATDMWSIGVLTYVMLTGESPFLGDEKQQTFLNISQVNVDYSQDTFEGISSLAVDFIKSLLVKNPRKRATAEECLRHPWLN 285          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:101163368])

HSP 1 Score: 194.512 bits (493), Expect = 3.078e-57
Identity = 108/264 (40.91%), Postives = 160/264 (60.61%), Query Frame = 3
Query:  228 GYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            G Y    E+GRG F+ V R       K  A K +R+RR G D    +  E+ +++   N +   V+ L+  HE+  ++ L++E A GG +FD+   S   LPE  + ++ ++ L  +  +HQ+N+VHLD+K  NILL    P  DI + DFGLA +L +    RE++GTP+Y+APE++NYE I+  TDMWS+GV+ Y L+T ESPF  D K+ T LNVS++N  + ++ F+K  + A DFI KL+VK P  R +A E   H WL
Sbjct:   31 GVYEVTGELGRGKFAVVKRCVEKASGKVFAAKFLRKRRRGRDCRAEVIHEMAVLELARNNA--RVVNLHSAHETDHDIVLILEYAAGGEIFDLCV-SEEMLPEPQITRLIRQTLEGVHNLHQSNLVHLDLKPQNILLTSQLPPGDIKIVDFGLARRLGAVGELREILGTPEYVAPEVLNYEPITTATDMWSVGVIAYMLVTGESPFAGDDKQETYLNVSQVNVDYSKEAFSKVSELAVDFIQKLLVKAPEDRPTAAECMTHPWL 291          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: stk17b (serine/threonine kinase 17b [Source:NCBI gene;Acc:101163368])

HSP 1 Score: 194.897 bits (494), Expect = 5.616e-57
Identity = 108/264 (40.91%), Postives = 160/264 (60.61%), Query Frame = 3
Query:  228 GYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWL 1019
            G Y    E+GRG F+ V R       K  A K +R+RR G D    +  E+ +++   N +   V+ L+  HE+  ++ L++E A GG +FD+   S   LPE  + ++ ++ L  +  +HQ+N+VHLD+K  NILL    P  DI + DFGLA +L +    RE++GTP+Y+APE++NYE I+  TDMWS+GV+ Y L+T ESPF  D K+ T LNVS++N  + ++ F+K  + A DFI KL+VK P  R +A E   H WL
Sbjct:   31 GVYEVTGELGRGKFAVVKRCVEKASGKVFAAKFLRKRRRGRDCRAEVIHEMAVLELARNNA--RVVNLHSAHETDHDIVLILEYAAGGEIFDLCV-SEEMLPEPQITRLIRQTLEGVHNLHQSNLVHLDLKPQNILLTSQLPPGDIKIVDFGLARRLGAVGELREILGTPEYVAPEVLNYEPITTATDMWSVGVIAYMLVTGESPFAGDDKQETYLNVSQVNVDYSKEAFSKVSELAVDFIQKLLVKAPEDRPTAAECMTHPWL 291          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:101165975])

HSP 1 Score: 180.259 bits (456), Expect = 1.208e-51
Identity = 101/279 (36.20%), Postives = 164/279 (58.78%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIK----IMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPS-TDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVE 1052
            +Y  G+++G G F+ V R    +   E A K I++R     R    R+EI+    I+Q L + ++   + L+ V+E+  +V L+ME+  GG LFD + +  + L E    Q  K++L  +  +H   I H D+K +NI+L +   S   I L DFGLA Q+ +G   + + GTP+++APEI+NYE++ +  DMWS+GV+TY LL+  SPF+ DTK+ T+ N+S +N+ F ED F  + + AK FI +L+ K    R++  +A  H W+ P+   +A V+
Sbjct:   17 FYEMGEQLGSGQFAVVKRCKEKSSGTEFAAKFIKKRISRASRRGVKREEIEREVGILQQLQHPNI---VALHDVYENRTDVVLIMELVSGGELFDFLAQKES-LSEEEATQFIKQILDGVQYLHSKRIAHFDLKPENIMLLDRNASLPRIKLIDFGLAHQIEAGADFKNIFGTPEFVAPEIVNYEQLGLEADMWSIGVITYILLSGASPFLGDTKQETLGNISAVNYEFDEDFFGNTSELAKSFIRQLLEKDTRKRMAIEDALNHPWIKPLNSRQAMVK 291          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000027698.1 (death associated protein kinase 3 [Source:NCBI gene;Acc:101168492])

HSP 1 Score: 180.644 bits (457), Expect = 8.624e-51
Identity = 101/280 (36.07%), Postives = 167/280 (59.64%), Query Frame = 3
Query:  231 YYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQS-VIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNI-LLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEA-PVESDQ 1061
            +Y  G+E+G G F+ V +    +   E A K I++RR    R    R+EI+   +++ +   S +I L+ + E+  +V L++E+  GG LFD + E  + L E    Q  K++L  +  +H   I H D+K +NI LL +  P+  I L DFG+A Q+ +G   + + GTP+++APEI+NYE + +  DMWS+GV+TY LL+  SPF+ +TK+ T+ N+S +N+ F E+ F+ + + AKDFI +L+VK P  R++  ++ +H W+  +      P E DQ
Sbjct:   23 HYEMGEELGSGQFAIVRKCREKSTGGEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIQHSNIITLHDIFENKTDVILILELVSGGELFDFLAEKES-LTEEEATQFLKQILDGVQYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHQIKAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKKRMTIDDSLEHPWIKVIKRRNVRPEEGDQ 301          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000064400.1 (SMESG000064400.1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 342/342 (100.00%), Postives = 342/342 (100.00%), Query Frame = 3
Query:  114 MIATEGVKYRANRAASIHCIAGSLLPRKTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVESDQMNQXXXXXXXXXXXXXXXXXGYESCL 1139
            MIATEGVKYRANRAASIHCIAGSLLPRKTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVIRRRRGGIDRIQTIRQEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVESDQMNQKSDLEILEESKSLSSDSGYESCL
Sbjct:    1 MIATEGVKYRANRAASIHCIAGSLLPRKTSQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVIRRRRGGIDRIQTIRQEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPVESDQMNQKSDLEILEESKSLSSDSGYESCL 342          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000061289.1 (SMESG000061289.1)

HSP 1 Score: 283.108 bits (723), Expect = 3.237e-87
Identity = 152/284 (53.52%), Postives = 202/284 (71.13%), Query Frame = 3
Query:  201 SQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQS-VIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPV 1049
            + D+S+WR  Y F+   +GRGHFSKVY+    +  K  A+KVIRRRR G+D+I  I +EI+IMQ L+N+S+ S  I+L   H S  EVA+++E A GG +++V+RES  GLPE Y + I  +++SAL +MH  NIVHLDIKADNILLR PYPSTD+AL DFGLA +LS  KVH+E++GTPDYIAPE+ NY+ IS  +DMWS+GVLTY++LT+ SPF ADTKE T+  V+K  F F       +L  A+DFI KL++K P  RLS  +   H++LS V + E P 
Sbjct:   22 TSDVSNWRDSYTFNPVILGRGHFSKVYKAKCTSTGKYVAIKVIRRRRLGVDKIDDIMREIEIMQ-LLNQSMNSGFIQLLKFHTSVSEVAVLLEFASGGSIYNVIRESETGLPEAYTKIILSKVISALCIMHGQNIVHLDIKADNILLRHPYPSTDVALADFGLARKLSKSKVHKEMIGTPDYIAPEVANYDSISTKSDMWSVGVLTYFILTNISPFFADTKEETLNRVTKTQFEFLGQLKNDNLQAARDFIQKLLIKIPEKRLSVEDCHSHAFLSSVPIVEYPA 304          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000061289.1 (SMESG000061289.1)

HSP 1 Score: 282.722 bits (722), Expect = 5.649e-87
Identity = 152/284 (53.52%), Postives = 202/284 (71.13%), Query Frame = 3
Query:  201 SQDLSSWRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQS-VIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPVVLSEAPV 1049
            + D+S+WR  Y F+   +GRGHFSKVY+    +  K  A+KVIRRRR G+D+I  I +EI+IMQ L+N+S+ S  I+L   H S  EVA+++E A GG +++V+RES  GLPE Y + I  +++SAL +MH  NIVHLDIKADNILLR PYPSTD+AL DFGLA +LS  KVH+E++GTPDYIAPE+ NY+ IS  +DMWS+GVLTY++LT+ SPF ADTKE T+  V+K  F F       +L  A+DFI KL++K P  RLS  +   H++LS V + E P 
Sbjct:   38 TSDVSNWRDSYTFNPVILGRGHFSKVYKAKCTSTGKYVAIKVIRRRRLGVDKIDDIMREIEIMQ-LLNQSMNSGFIQLLKFHTSVSEVAVLLEFASGGSIYNVIRESETGLPEAYTKIILSKVISALCIMHGQNIVHLDIKADNILLRHPYPSTDVALADFGLARKLSKSKVHKEMIGTPDYIAPEVANYDSISTKSDMWSVGVLTYFILTNISPFFADTKEETLNRVTKTQFEFLGQLKNDNLQAARDFIQKLLIKIPEKRLSVEDCHSHAFLSSVPIVEYPA 320          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000035615.1 (SMESG000035615.1)

HSP 1 Score: 262.692 bits (670), Expect = 5.320e-80
Identity = 141/270 (52.22%), Postives = 189/270 (70.00%), Query Frame = 3
Query:  219 WRSGYYFHGKEIGRGHFSKVYRVTSLTDNKEGAVKVXXXXXXXXXXXXXXXXEIKIMQDLMNKSVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 1028
            WR  Y    KEIGRG FSKV++VT  T  K  A KVIRR++GGIDR+  IR+E +I++ L +K++ +VI+L   +E++ EV L+ E A GG L++++ E  +GL +NY++ +  ++L AL  MH  NIVHLDIKADNILLREPYPS++IA+CDFGLAT+L  G  +++LVGTPDY+APEIINYE+I+   DMWS+GVL YYL T  SPFM  TK+ T++NVSK+  SF            KD IS L VK P +RLS++ A  H W   +
Sbjct:   34 WRKNYIVKPKEIGRGFFSKVFQVTCKTREKSFAAKVIRRKKGGIDRLDKIRREAEIIKKLNDKTISAVIQLYETYETFSEVILICEFAIGGSLYNLIEEFTHGLNQNYIKCVIYKILKALECMHFENIVHLDIKADNILLREPYPSSNIAICDFGLATELKKGMNYKDLVGTPDYMAPEIINYEKITFNADMWSVGVLIYYLSTGLSPFMGSTKDETLINVSKVKMSFHPLFDNPDYSNTKDLISSLCVKLPGLRLSSSTAQNHKWFDDI 303          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000081259.1 (SMESG000081259.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.108e-39
Identity = 94/277 (33.94%), Postives = 148/277 (53.43%), Query Frame = 3
Query:  216 SWRSGYYFH----GKEIGRGHFSKVYRVTSLTDNKEGAVK-VXXXXXXXXXXXXXXXXEIKIMQDLMNK-SVQSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKRLLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKVHRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKEMTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHSWLSPV 1028
            ++  G +F     G+++G GHF++V        N E A K +  R+           +EI+    ++   + Q++IKL F H     VALV+E+  GG LFD + +S   L E    +  +++L  +  MH+  +VHLD+K +N+++ E      I L DFGLA ++       E+ GT +++APE+INYE IS  TDMW++GV+TY +LT  SPF  D +  T  N+      F ED  +   + AK FI+ L++  P  R +A    KH W+ P+
Sbjct:    2 NFEPGTFFDIYKVGEKLGHGHFAEVKHCIDKQTNTEFAAKFIRVRQLLDSKSAGMSIEEIEREAHILKMLNHQNIIKLFFCHHLGKTVALVLELVAGGELFDHISDSE-KLSEEEASEFIEQILYGVQHMHEKKVVHLDLKPENVMI-EDLDERKIKLIDFGLAREIKKQDTIIEMQGTAEFLAPEVINYEAISYATDMWAIGVITYIMLTGVSPFSGDDQSSTFQNIVTCKLDFEEDVCSDMSEMAKGFINSLLLLDPRKRSTANLCLKHHWIKPM 276          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK17A2.016e-5640.58serine/threonine kinase 17a [Source:HGNC Symbol;Ac... [more]
STK17A2.016e-5640.58serine/threonine kinase 17a [Source:HGNC Symbol;Ac... [more]
STK17B3.383e-5438.75serine/threonine kinase 17b [Source:HGNC Symbol;Ac... [more]
STK17B3.383e-5438.75serine/threonine kinase 17b [Source:HGNC Symbol;Ac... [more]
DAPK33.180e-5136.19death associated protein kinase 3 [Source:HGNC Sym... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dapk-16.522e-4335.63Death-associated protein kinase dapk-1 [Source:Un... [more]
ttn-11.063e-4034.91Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.063e-4034.91Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.166e-4034.91Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-12.814e-4034.91Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drak6.507e-4636.50gene:FBgn0052666 transcript:FBtr0301020[more]
Drak6.507e-4636.50gene:FBgn0052666 transcript:FBtr0301021[more]
Drak6.507e-4636.50gene:FBgn0052666 transcript:FBtr0340295[more]
sqa5.797e-4034.63gene:FBgn0259678 transcript:FBtr0299929[more]
Strn-Mlck7.202e-3934.83gene:FBgn0265045 transcript:FBtr0336647[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b5.740e-5942.47serine/threonine kinase 17b (apoptosis-inducing) [... [more]
stk17b5.740e-5942.47serine/threonine kinase 17b (apoptosis-inducing) [... [more]
stk17al2.710e-5740.30serine/threonine kinase 17a like [Source:ZFIN;Acc:... [more]
stk17a9.468e-5641.15serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-G... [more]
dapk31.002e-5136.94death-associated protein kinase 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000029423.11.111e-6142.49serine/threonine-protein kinase 17A-like [Source:N... [more]
fzd84.040e-5640.23frizzled class receptor 8 [Source:Xenbase;Acc:XB-G... [more]
dapk33.023e-5237.17death-associated protein kinase 3 [Source:NCBI gen... [more]
dapk12.269e-5036.94death associated protein kinase 1 [Source:NCBI gen... [more]
c7orf261.326e-4937.41chromosome 7 open reading frame 26 [Source:Xenbase... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk17b8.683e-5539.77serine/threonine kinase 17b (apoptosis-inducing) [... [more]
Dapk21.939e-5135.71death-associated protein kinase 2 [Source:MGI Symb... [more]
Dapk39.023e-5035.82death-associated protein kinase 3 [Source:MGI Symb... [more]
Dapk39.023e-5035.82death-associated protein kinase 3 [Source:MGI Symb... [more]
Dapk39.023e-5035.82death-associated protein kinase 3 [Source:MGI Symb... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UEE5|ST17A_HUMAN9.680e-5640.58Serine/threonine-protein kinase 17A OS=Homo sapien... [more]
sp|Q9GM70|ST17A_RABIT1.474e-5539.73Serine/threonine-protein kinase 17A OS=Oryctolagus... [more]
sp|Q91XS8|ST17B_RAT2.671e-5438.41Serine/threonine-protein kinase 17B OS=Rattus norv... [more]
sp|Q8BG48|ST17B_MOUSE6.074e-5439.77Serine/threonine-protein kinase 17B OS=Mus musculu... [more]
sp|O94768|ST17B_HUMAN1.625e-5338.75Serine/threonine-protein kinase 17B OS=Homo sapien... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RZ562.395e-6145.71Serine/threonine kinase OS=Fasciola hepatica OX=61... [more]
A0A068Y4I13.249e-6140.29Serine:threonine protein kinase 17A OS=Echinococcu... [more]
A0A068WWE55.210e-6139.71Serine:threonine protein kinase 17A OS=Echinococcu... [more]
A0A504Z2A46.356e-6145.71Serine/threonine kinase OS=Fasciola gigantica OX=4... [more]
A0A452I5V21.428e-5941.99Protein kinase domain-containing protein OS=Gopher... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17al1.117e-5638.87serine/threonine-protein kinase 17A-like [Source:N... [more]
stk17a1.554e-5641.15serine/threonine kinase 17a [Source:NCBI gene;Acc:... [more]
si:dkey-240h12.47.798e-5438.04death-associated protein kinase 2-like [Source:NCB... [more]
si:dkey-240h12.47.798e-5438.04death-associated protein kinase 2-like [Source:NCB... [more]
stk17b2.814e-5238.16serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b3.815e-5339.45serine/threonine kinase 17b (apoptosis-inducing) [... [more]
ENSPMAT00000001278.11.044e-4637.44pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
ENSPMAT00000000175.11.431e-4236.36pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
dapk13.724e-4234.48death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
mylk34.111e-3935.07myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD537.965e-3031.02DNA damage response protein kinase; required for c... [more]
MEK14.201e-2534.83Meiosis-specific serine/threonine protein kinase; ... [more]
CMK21.424e-2429.45Calmodulin-dependent protein kinase; may play a ro... [more]
TPK26.626e-2427.38cAMP-dependent protein kinase catalytic subunit; p... [more]
CDC57.608e-2427.80Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422879.472e-4536.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
OBSCURIN8.207e-4233.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370244.191e-4036.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490904.019e-3634.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428371.603e-3535.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17al2.924e-5940.52serine/threonine-protein kinase 17A [Source:NCBI g... [more]
stk17b3.078e-5740.91serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
stk17b5.616e-5740.91serine/threonine kinase 17b [Source:NCBI gene;Acc:... [more]
dapk2b1.208e-5136.20death associated protein kinase 2 [Source:NCBI gen... [more]
ENSORLT00000027698.18.624e-5136.07death associated protein kinase 3 [Source:NCBI gen... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064400.10.000e+0100.00SMESG000064400.1[more]
SMESG000061289.13.237e-8753.52SMESG000061289.1[more]
SMESG000061289.15.649e-8753.52SMESG000061289.1[more]
SMESG000035615.15.320e-8052.22SMESG000035615.1[more]
SMESG000081259.11.108e-3933.94SMESG000081259.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014795 ID=SMED30014795|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1498bp
ATTTAATGCTATATATTAATGCTAATATTTCAAATAAATTAAAAAATCAG
AAAAATTAATTTATGCTTTATCGAAATATCAAAAAAGAAAATTGACAAAA
CTGACAGTAGAAAATGATTGCAACAGAAGGAGTAAAATATCGAGCCAATC
GTGCTGCAAGCATTCATTGTATAGCCGGATCATTATTGCCTCGTAAAACT
AGTCAGGATTTGTCATCATGGAGATCTGGATATTATTTTCACGGAAAAGA
AATCGGAAGGGGACACTTTTCAAAGGTTTATCGTGTGACGTCTTTAACTG
ACAATAAAGAAGGAGCTGTTAAAGTAATCCGAAGAAGACGAGGAGGAATT
GACAGAATCCAAACTATCAGACAGGAAATTAAAATAATGCAAGATTTAAT
GAACAAAAGCGTTCAATCGGTTATTAAACTAAATTTTGTCCACGAATCTT
ACATTGAAGTAGCATTAGTTATGGAAATTGCCAAAGGAGGTTGCTTGTTC
GATGTTGTCAGAGAATCACACAATGGACTACCAGAAAATTATGTCCAACA
GATCACTAAAAGACTATTATCAGCACTTCTTGTTATGCATCAAACAAATA
TCGTCCATCTTGATATAAAAGCAGATAATATCCTGCTTCGAGAGCCTTAT
CCATCAACCGATATTGCATTATGTGACTTCGGCTTAGCCACTCAACTCAG
CTCAGGAAAGGTGCACCGAGAACTAGTGGGAACACCTGATTATATTGCAC
CAGAAATCATCAACTATGAAGAAATTTCCATGTTCACCGATATGTGGAGC
TTGGGGGTCTTAACTTACTATCTGTTGACATCTGAATCTCCATTCATGGC
CGACACGAAAGAAATGACAATGTTGAATGTTTCGAAAATAAATTTCAGTT
TTCCTGAAGACAAATTCACCAAATCGTTAGATGAAGCTAAAGATTTCATT
TCGAAATTAATTGTCAAAAGACCAAATATGAGATTAAGTGCCACAGAGGC
TGACAAACATTCTTGGTTGTCGCCAGTTGTTTTGTCAGAGGCACCGGTCG
AGTCAGATCAAATGAATCAGAAATCAGACCTAGAAATCCTTGAAGAATCA
AAGTCTTTATCATCAGATTCCGGCTATGAGAGTTGTTTATGAAGCACAAT
TGTAACAGATTTTTTCGTTGAATTGTGTAGATGTAGAGTTTTCATGTTTT
TTTTCTCACACGGTTTAGATAAAAGAAACAAAATTCAGATATTATTTCTT
TTAATGGTGTCGTGAAGCACTTTGTTTTGAACCTTTTTCGTTTCATCCTT
TGTTTTTTCATTTGCTTCAGTAATTCTATTCAACTTACAACTGACATTTC
TGAGGCTAGAGTACTCAAATTATGCATTTCAGAACCTTTATCAATCGAAT
TGCCTTGGATATTTGTTTATTTGACAAATTTATTAATGTATTCCTCAATT
AGAAATTGAGAGGTTTTCTAAAAAATATAAATCATGTTTTAAAAAAAA
back to top

protein sequence of SMED30014795-orf-1

>SMED30014795-orf-1 ID=SMED30014795-orf-1|Name=SMED30014795-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MIATEGVKYRANRAASIHCIAGSLLPRKTSQDLSSWRSGYYFHGKEIGRG
HFSKVYRVTSLTDNKEGAVKVIRRRRGGIDRIQTIRQEIKIMQDLMNKSV
QSVIKLNFVHESYIEVALVMEIAKGGCLFDVVRESHNGLPENYVQQITKR
LLSALLVMHQTNIVHLDIKADNILLREPYPSTDIALCDFGLATQLSSGKV
HRELVGTPDYIAPEIINYEEISMFTDMWSLGVLTYYLLTSESPFMADTKE
MTMLNVSKINFSFPEDKFTKSLDEAKDFISKLIVKRPNMRLSATEADKHS
WLSPVVLSEAPVESDQMNQKSDLEILEESKSLSSDSGYESCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003688DNA replication origin binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 41..302
e-value: 2.4E-69
score: 246.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 44..302
e-value: 2.4E-58
score: 197.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 41..302
score: 41.092
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 43..128
e-value: 1.1E-17
score: 66.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 129..339
e-value: 4.5E-52
score: 178.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 313..342
NoneNo IPR availablePANTHERPTHR24342:SF12DEATH-ASSOCIATED PROTEIN KINASE RELATEDcoord: 38..324
NoneNo IPR availablePANTHERPTHR24342SERINE/THREONINE-PROTEIN KINASE 17coord: 38..324
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 163..175
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 32..311