adenylate kinase 8-like

Overview
Nameadenylate kinase 8-like
Smed IDSMED30014791
Uniprot Best hitAdenylate kinase 8 OS=Xenopus laevis OX=8355 GN=ak8 PE=2 SV=1 (E=1.16197e-137)
Length (bp)2001
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of adenylate kinase 8-like (SMED30014791) t-SNE clustered cells

Violin plots show distribution of expression levels for adenylate kinase 8-like (SMED30014791) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of adenylate kinase 8-like (SMED30014791) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for adenylate kinase 8-like (SMED30014791) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014791

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014791SMESG000027219.1 SmedASXL_013049SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014791SMESG000027219.1 dd_Smed_v4_7317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014791SMESG000027219.1 dd_Smed_v4_7317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014791SMESG000027219.1 dd_Smed_v4_7317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014791SMESG000027219.1 dd_Smed_v6_7317_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014791SMESG000027219.1 SMESG000014613.1 OX_Smed_1.0.22066ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014791SMESG000027219.1 dd_Smed_v4_7317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30014791SMESG000027219.1 dd_Smed_v4_7317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of adenylate kinase 8-like vs. Ensembl Human
Match: AK8 (adenylate kinase 8 [Source:HGNC Symbol;Acc:HGNC:26526])

HSP 1 Score: 394.43 bits (1012), Expect = 2.429e-130
Identity = 206/482 (42.74%), Postives = 297/482 (61.62%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLN----PVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MDAT  P +I PE+  Y E++ IFE M+ +LE L+I +P +PI ++I++L +D D+VPRI ILGPPASGK TIA  L   LN  LL      ++ FS   T+    A      +K +P  + ++ ++ R    DC K+GW+L G PETRE    +Q  GI P HV++L+APD VLIER  GKRIDP+TG++YH  FD    SE+ +RL+ PE  +  E  QKL  YHRNI  V P Y  +L  I+ADQP  D+F   L +     R  A  TPR++LLGP GSGKS  A L+ +KY ++ V CG L++EA+AD    G  ++ + EK + VPD +L++++ +RL    C   GW+L+G P  + QA LL+     PNRVFFL VP    +ER   RR+DPVTG++YHL Y PP       R+ ++PKD  + +K K+ ++     +L++ Y   + ++ +Q+ + +FE +ES ++NPLP K+
Sbjct:    1 MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRIVILGPPASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATE----ARRLYLQRKTVPSALLVQLIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKI 478          
BLAST of adenylate kinase 8-like vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 97.8265 bits (242), Expect = 2.126e-22
Identity = 61/206 (29.61%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            R +LLGP G+GK T A  + + + +  +  GD++R  +A  ++ G  +++ ++    V D ++++LIE+ L    C   G+LL G+P +V+QAE+LD      K + + V    +P  + + R   R + P +G  YH  +NPP  +   + ++  P      D+ K +K +L  Y++    L EYY+    H  IDA+Q    +F
Sbjct:   17 RAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKN-GFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPP-KEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVF 220          
BLAST of adenylate kinase 8-like vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 97.8265 bits (242), Expect = 2.701e-22
Identity = 61/206 (29.61%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            R +LLGP G+GK T A  + + + +  +  GD++R  +A  ++ G  +++ ++    V D ++++LIE+ L    C   G+LL G+P +V+QAE+LD      K + + V    +P  + + R   R + P +G  YH  +NPP  +   + ++  P      D+ K +K +L  Y++    L EYY+    H  IDA+Q    +F
Sbjct:   17 RAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKN-GFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPP-KEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVF 220          
BLAST of adenylate kinase 8-like vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 97.8265 bits (242), Expect = 2.864e-22
Identity = 61/206 (29.61%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            R +LLGP G+GK T A  + + + +  +  GD++R  +A  ++ G  +++ ++    V D ++++LIE+ L    C   G+LL G+P +V+QAE+LD      K + + V    +P  + + R   R + P +G  YH  +NPP  +   + ++  P      D+ K +K +L  Y++    L EYY+    H  IDA+Q    +F
Sbjct:   17 RAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKN-GFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPP-KEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVF 220          
BLAST of adenylate kinase 8-like vs. Ensembl Human
Match: AK3 (adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17376])

HSP 1 Score: 92.4337 bits (228), Expect = 1.635e-20
Identity = 58/220 (26.36%), Postives = 112/220 (50.91%), Query Frame = 2
Query:  824 ALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVNPLPMK 1462
            + R  R +++G  GSGK T+++ I   + +  ++ GDL+R+ +    + G+  ++++++   +PD V+ +L    L NL  + Y WLL G+P ++ QAE LD    + + V  L VP  V  +R   R + P +G  Y++ +NPP      + ++  P      D  + +  +L  Y      + EYY+   V++  +  E + I+  V ++L   +P +
Sbjct:    4 SARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNL--TQYSWLLDGFPRTLPQAEALDRA-YQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPP-KTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQR 219          

HSP 2 Score: 53.9138 bits (128), Expect = 2.209e-7
Identity = 47/172 (27.33%), Postives = 77/172 (44.77%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDR----LIKPEGSTAEEMNQKLANYH 700
            R  I+G P SGK T++  ++     + L+  D+  +     T+I  +A+  I   K IP ++  R      K  +  +  W+L GFP T     AL       T V+ L  P  V+ +R   + I P +G VY+  F+P     ++D     LI+ E    E + ++L  Y 
Sbjct:    9 RAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELK--NLTQYSWLLDGFPRTLPQAEALDRAYQIDT-VINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYE 177          
BLAST of adenylate kinase 8-like vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 86.6557 bits (213), Expect = 8.784e-19
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query:  830 RTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNI 1417
            R  R I +GP GSGK T A    +KY    +  GDL+R  +A  ++ G  +++ ++    V D V+ +LIE++L    C  YG++L G+P +  QAE LD      K   + V    +   + + R   R     +G  YHL + PP     +      + +   D+ + ++ +L  Y+   + L +YYK    HV +DA + + ++
Sbjct:   25 RGIRAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECK-YGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAKPMTDV 230          
BLAST of adenylate kinase 8-like vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 86.6557 bits (213), Expect = 8.784e-19
Identity = 58/207 (28.02%), Postives = 100/207 (48.31%), Query Frame = 2
Query:  830 RTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNI 1417
            R  R I +GP GSGK T A    +KY    +  GDL+R  +A  ++ G  +++ ++    V D V+ +LIE++L    C  YG++L G+P +  QAE LD      K   + V    +   + + R   R     +G  YHL + PP     +      + +   D+ + ++ +L  Y+   + L +YYK    HV +DA + + ++
Sbjct:   25 RGIRAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECK-YGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAKPMTDV 230          
BLAST of adenylate kinase 8-like vs. Ensembl Celegans
Match: ZK673.2 (Probable adenylate kinase isoenzyme ZK673.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09629])

HSP 1 Score: 82.4185 bits (202), Expect = 1.330e-17
Identity = 57/206 (27.67%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVN---CGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS----AFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYK--DHVVIDANQELHNIFELV 1429
            R++L G +GSGK TIA ++ +++  +  N    GD IR+ IA   + G+  +S++ K   VPD +L   I   L  +  +    +L GYP ++ Q ++++  +   N +  L+VP  V ++R  ++ + P +G  Y+L  NPP  +         + K   D ++V + +L VY+ T  ++ +YYK  +  +  + +    +FE V
Sbjct:    3 RVLLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKGEHVPDSILNGAI---LAEMLKAGPRVVLDGYPRNMSQLKMVE-EQAPLNLIVELKVPRKVLIDRLSKQLVHPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYKKQNKCITMSGESSKAVFESV 204          
BLAST of adenylate kinase 8-like vs. Ensembl Celegans
Match: F38B2.4 (Adenylate kinase isoenzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20140])

HSP 1 Score: 66.2402 bits (160), Expect = 3.837e-12
Identity = 51/212 (24.06%), Postives = 91/212 (42.92%), Query Frame = 2
Query:  818 LPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEER-LTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDH---VVIDANQELHNIFELVESYL 1441
            L A   P   ++G  GSGK T  + I  KY +  ++ GDL+R+ +   +  G  + + +E    VP  V++ L++E  L  +   + G+L+ GYP  V Q +  +    E   V F +V     ++R   R                        + S    D+   IK +L  + ++   + +YY+     V I+A   + +IF +V + L
Sbjct:   15 LKAAGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHR-----------------------AQTSGRADDNADTIKKRLHTFVTSTAPVVDYYESKGKLVRINAEGSVDDIFAVVVANL 203          
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 87.0409 bits (214), Expect = 6.466e-19
Identity = 58/219 (26.48%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  845 ILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAE----LLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY---KDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            ILLGP GSGK T A L+ +K+ +  ++ GD++R  I+  +K G  ++  ++    V D +++ +I+  L    C   G+LL G+P +V QAE    LLD  K   + V    +   + + R   R +   +G  YH  + PP     +      + +   D+ + +K +L  Y+     L +YY     H  +DA ++  ++F  ++S      P ++ 
Sbjct:   22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQRKRPAQIQ 239          

HSP 2 Score: 55.4546 bits (132), Expect = 3.554e-8
Identity = 59/220 (26.82%), Postives = 100/220 (45.45%), Query Frame = 2
Query:  212 FILGPPASGKHTIAKMLSGRLNCQLLNPVDVF-SECDTDIKDIAE--DCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTH------VVLLTAPDYVLIERADGKRIDPETGDVYHALF----DPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHV----LH-EINADQPLADIFQTVLDFCVKRER 817
             +LGPP SGK T A +L  +     L+  D+  +E  +  K  AE    +   K +  ++ +  +       +C K G++L GFP T   V A + + +          V+     D +L+ R  G+ I   +G  YH  F     P T+    + LI+     AE + ++L  YH+     KPL D+     LH +++A +  +D+F T+ D   +R+R
Sbjct:   22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPEC-KNGFLLDGFPRTV--VQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQ---TKPLVDYYGLRGLHFKVDAAKKSSDVFSTI-DSIFQRKR 234          
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 81.6481 bits (200), Expect = 2.908e-17
Identity = 53/207 (25.60%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSY-NPPV---NQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY--KDHVVIDANQELHNIFELVESYL 1441
            R +++G  GSGK TI+ LICK +  + ++ GD++R+ I    + G   + Y+ +   VPD ++ + +  R+T +   +Y  +L G+P ++ QAE L   + + + V  L+VP  V ++R   R +   +G  Y++ + NP V   +      + +   D   V+  +L +Y+  +  +  +Y  K  V     ++   I+ ++E +L
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSY--ILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFL 210          

HSP 2 Score: 48.1358 bits (113), Expect = 8.344e-6
Identity = 45/187 (24.06%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINA 757
            R  I+G P SGK TI++++     C  ++  D+  +    +T++   A+  I   K +P  I  + +  R  + +   + ++L GFP       AL         V+ L  P  V+I+R   + I   +G VY+  F        N ++   +  T E + Q+  +    +A    LYD V+  + A
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLAR--ITEVGNRSYILDGFPRNIAQAEALAAREQIDA-VITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFK-------NPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIA 183          
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339379)

HSP 1 Score: 81.6481 bits (200), Expect = 2.908e-17
Identity = 53/207 (25.60%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSY-NPPV---NQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY--KDHVVIDANQELHNIFELVESYL 1441
            R +++G  GSGK TI+ LICK +  + ++ GD++R+ I    + G   + Y+ +   VPD ++ + +  R+T +   +Y  +L G+P ++ QAE L   + + + V  L+VP  V ++R   R +   +G  Y++ + NP V   +      + +   D   V+  +L +Y+  +  +  +Y  K  V     ++   I+ ++E +L
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSY--ILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFL 210          

HSP 2 Score: 48.1358 bits (113), Expect = 8.344e-6
Identity = 45/187 (24.06%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINA 757
            R  I+G P SGK TI++++     C  ++  D+  +    +T++   A+  I   K +P  I  + +  R  + +   + ++L GFP       AL         V+ L  P  V+I+R   + I   +G VY+  F        N ++   +  T E + Q+  +    +A    LYD V+  + A
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLAR--ITEVGNRSYILDGFPRNIAQAEALAAREQIDA-VITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFK-------NPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIA 183          
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082330)

HSP 1 Score: 81.6481 bits (200), Expect = 2.908e-17
Identity = 53/207 (25.60%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSY-NPPV---NQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY--KDHVVIDANQELHNIFELVESYL 1441
            R +++G  GSGK TI+ LICK +  + ++ GD++R+ I    + G   + Y+ +   VPD ++ + +  R+T +   +Y  +L G+P ++ QAE L   + + + V  L+VP  V ++R   R +   +G  Y++ + NP V   +      + +   D   V+  +L +Y+  +  +  +Y  K  V     ++   I+ ++E +L
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSY--ILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFL 210          

HSP 2 Score: 48.1358 bits (113), Expect = 8.344e-6
Identity = 45/187 (24.06%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINA 757
            R  I+G P SGK TI++++     C  ++  D+  +    +T++   A+  I   K +P  I  + +  R  + +   + ++L GFP       AL         V+ L  P  V+I+R   + I   +G VY+  F        N ++   +  T E + Q+  +    +A    LYD V+  + A
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLAR--ITEVGNRSYILDGFPRNIAQAEALAAREQIDA-VITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFK-------NPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIA 183          
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339378)

HSP 1 Score: 81.6481 bits (200), Expect = 2.908e-17
Identity = 53/207 (25.60%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSY-NPPV---NQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY--KDHVVIDANQELHNIFELVESYL 1441
            R +++G  GSGK TI+ LICK +  + ++ GD++R+ I    + G   + Y+ +   VPD ++ + +  R+T +   +Y  +L G+P ++ QAE L   + + + V  L+VP  V ++R   R +   +G  Y++ + NP V   +      + +   D   V+  +L +Y+  +  +  +Y  K  V     ++   I+ ++E +L
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSY--ILDGFPRNIAQAEAL-AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFL 210          

HSP 2 Score: 48.1358 bits (113), Expect = 8.344e-6
Identity = 45/187 (24.06%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINA 757
            R  I+G P SGK TI++++     C  ++  D+  +    +T++   A+  I   K +P  I  + +  R  + +   + ++L GFP       AL         V+ L  P  V+I+R   + I   +G VY+  F        N ++   +  T E + Q+  +    +A    LYD V+  + A
Sbjct:    7 RAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLAR--ITEVGNRSYILDGFPRNIAQAEALAAREQIDA-VITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFK-------NPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIA 183          
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 387.882 bits (995), Expect = 5.712e-128
Identity = 203/480 (42.29%), Postives = 295/480 (61.46%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEG-STAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD+ +RP++I PE+V YAEKH IF  ++ L+  L++D+P +PI+YLI +L++D  DVPRI +LGPPASGK T+AK L        +   D+  + D+D+   A+   K K+ +P ++WI+ ++ R    DC ++GWVL   P+T++    LQ  GI P HVV+L APD VLIER+ GKRIDP TGDVYH  F    + EV  RL  P      + M+QKL  YH     +K  Y + L  INADQP  D+F  VL+F       P+  TPRI+L GP G+GKS  A LI +KY I+ + CG+L++   ADE+  G  ++ Y+E    VP  ++++++ ERL+ + C+T GW+LYG+P  V++AELL  +   PNRVFFLE+   +++ER   R +DPVTG+ YH  Y PP       R+  +P+     +  +L  Y S  + L+ +Y   V I+A+Q+ H +FE +ES LV  LP  L+
Sbjct:    1 MDSAERPLRIPPEMVIYAEKHDIFHLIQTLVRNLMVDKPDDPIQYLINFLERDNVDVPRIILLGPPASGKRTVAKKLCEHTQAIHITFSDILKD-DSDLTRAAQSYDK-KQNVPKDLWIQLIQQRLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVYHVTFMWPESEEVAQRLETPRTLMPVQVMSQKLQKYHTEAHALKRTYHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTPRILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTTQGWVLYGFPRDVEEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGEWYHSVYKPPPGPEVQARLRFNPQHSEAQLLMRLKEYWSQTVRLQAFYPQAVYINADQDPHTVFESLESRLVGQLPKVLS 478          
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 383.259 bits (983), Expect = 3.641e-126
Identity = 199/480 (41.46%), Postives = 292/480 (60.83%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEG-STAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD+ +RP++I PE+V YAEKH IF  ++ L+  L++D+P +PI+YLI +L++D  DVPRI +LGPPASGK T+AK L        +   D+  + D+D+   A+     K+ +P ++WI+ ++      DC ++GWVL   P+T++    LQ  GI P HVV+L APD VLIER+ GKRIDP TGDVYH  F    + EV  RL  P      + M+QKL  YH     +K  Y + L  INADQP  D+F  VL+F       P+  TPRI+L GP G+GKS  A LI +KY I+ + CG+L++   ADE+  G  ++ Y+E    VP  ++++++ ERL+ + C+  GW+L+G+P  V++AELL  +   PNRVFFLE+   +++ER   R +DPVTG+ YH  Y PP       R+  +P+     +  +L  Y S  + L+ +Y   V I+A+Q+ H +FE +ES LV  LP  L+
Sbjct:    1 MDSAERPLRIPPEMVIYAEKHDIFHLIQTLVRNLMVDKPDDPIQYLINFLERDNVDVPRIILLGPPASGKRTVAKKLCEHTQAIHITFSDILKD-DSDLTRAAQSYYDKKQNVPKDLWIQLIQQHLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVYHVTFMWPESEEVARRLETPRTLMPVQVMSQKLQKYHTEAHALKRTYHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTPRILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTARGWVLHGFPRDVEEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGEWYHSVYKPPPGPEVQARLRFNPQHSEAQLLMRLKEYWSQTVRLQAFYPQAVYINADQDPHTVFESLESRLVGQLPKVLS 479          
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 383.259 bits (983), Expect = 3.641e-126
Identity = 199/480 (41.46%), Postives = 292/480 (60.83%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEG-STAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD+ +RP++I PE+V YAEKH IF  ++ L+  L++D+P +PI+YLI +L++D  DVPRI +LGPPASGK T+AK L        +   D+  + D+D+   A+     K+ +P ++WI+ ++      DC ++GWVL   P+T++    LQ  GI P HVV+L APD VLIER+ GKRIDP TGDVYH  F    + EV  RL  P      + M+QKL  YH     +K  Y + L  INADQP  D+F  VL+F       P+  TPRI+L GP G+GKS  A LI +KY I+ + CG+L++   ADE+  G  ++ Y+E    VP  ++++++ ERL+ + C+  GW+L+G+P  V++AELL  +   PNRVFFLE+   +++ER   R +DPVTG+ YH  Y PP       R+  +P+     +  +L  Y S  + L+ +Y   V I+A+Q+ H +FE +ES LV  LP  L+
Sbjct:    1 MDSAERPLRIPPEMVIYAEKHDIFHLIQTLVRNLMVDKPDDPIQYLINFLERDNVDVPRIILLGPPASGKRTVAKKLCEHTQAIHITFSDILKD-DSDLTRAAQSYYDKKQNVPKDLWIQLIQQHLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVYHVTFMWPESEEVARRLETPRTLMPVQVMSQKLQKYHTEAHALKRTYHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTPRILLFGPPGAGKSLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTARGWVLHGFPRDVEEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGEWYHSVYKPPPGPEVQARLRFNPQHSEAQLLMRLKEYWSQTVRLQAFYPQAVYINADQDPHTVFESLESRLVGQLPKVLS 479          
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Match: ak3 (adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2142])

HSP 1 Score: 95.9005 bits (237), Expect = 6.286e-22
Identity = 61/213 (28.64%), Postives = 110/213 (51.64%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVNPLP 1456
            R +++G  GSGK T+++ I + + +  ++ GD++R  I  +   GL M+S +++   VPD V+ +LI   L  L  ++  WLL G+P +V QAE LDC   + + V  L+VP     ER   R +   +G  Y++ +NPP  +   + ++  P      D  + +  +L  Y      + EYY+   V++  +  E + I+  V ++L   +P
Sbjct:    8 RAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISRLILSSLRGLEKTS--WLLDGFPRTVAQAEALDCV-YDVDSVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPP-KKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLSRKIP 216          

HSP 2 Score: 61.6178 bits (148), Expect = 3.735e-10
Identity = 47/188 (25.00%), Postives = 86/188 (45.74%), Query Frame = 2
Query:  191 IDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFS---ECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVL-LTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDR----LIKPEGSTAEEMNQKLANYHRNIALVKPLY 730
            +  V R  I+G P SGK T++  ++     + L+  D+     E  TD+  + + CI   + +P ++  R     + +   EK  W+L GFP T     AL C  ++    V+ L  P   + ER   + +   +G VY+  F+P     ++D     L++ +  + E ++++L +Y R    V   Y
Sbjct:    3 LQSVFRAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISR--LILSSLRGLEKTSWLLDGFPRTVAQAEALDC--VYDVDSVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYY 186          
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 92.0485 bits (227), Expect = 1.186e-20
Identity = 48/144 (33.33%), Postives = 81/144 (56.25%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS 1270
            R +++GP GSGK TI+  I   + +  ++ GD +RE I+ +   G+  ++Y+ K L VPD V+ +L+  RL  +  + Y WLL G+P ++ QAE L+ +  + +    L +P     ER   R + P +G  Y++ +NPP  Q 
Sbjct:    6 RAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEM--TKYSWLLDGFPRTLAQAEALNSS-CDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQG 146          

HSP 2 Score: 55.8398 bits (133), Expect = 2.630e-8
Identity = 53/183 (28.96%), Postives = 83/183 (45.36%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVND----RLIKPEGSTAEEMNQKLANYHRNIALVKPLYD 733
            R  I+GPP SGK TI++ ++     + L+  D   E     TD   +A+  I     +P ++  R L  R +  +  K  W+L GFP T     AL          + L  P   L ER   + I P +G VY+  F+P     ++D     LI+ E    E +  +L +Y +++A  KP+ D
Sbjct:    6 RAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLE--EMTKYSWLLDGFPRTLAQAEALNSSCDLDV-AINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHY-KDVA--KPVID 182          
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Match: rassf1 (Ras association domain family member 1 [Source:Xenbase;Acc:XB-GENE-494691])

HSP 1 Score: 376.711 bits (966), Expect = 2.124e-123
Identity = 186/475 (39.16%), Postives = 293/475 (61.68%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MDAT++P++I P +  YAE+  +F+ ++K+++ +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P  V S   +D+  +A++   Y+   + +P  +W + ++ R    DC K+GW+L GFP+TRE    LQ  GI P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE   +L  YHRNI  +   Y     +INADQP  D+F  VL F + + R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +   P  +++ ++    + L    +GW++  +     QA +       P RVF L++   V +ER      DPV+G++YH  Y P  +     R+ ++P+   + ++ +L +Y++   EL E+Y D + I+A+Q+ + +FE +ESY V+
Sbjct:    1 MDATRKPLRIPPAMALYAEEQGVFDIIQKMVKKVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPESVLS---SDVSLLAKEAQSYRDKGQEVPDELWAKLMQQRLSKVDCIKRGWILEGFPKTREQALKLQMAGICPDHLVVLDAPDIVLIERNMGKRIDTANGEVYHTTFDWPSDPTVQRNLVEPEGISEEETGLRLIEYHRNIPGILRTYPKTSKKINADQPYMDVFSQVLTFVLSKPRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIVNICCGQVLKEAVADQTKLGEVIQPYIENDQQAPVNIMLVILINHFSPLERGQHGWVIREFGKDETQAAVRKAFSFSPGRVFSLDLSDDVVIERLSLCMTDPVSGERYHDIYKPAPSSEVHERLQQNPRHSEQRVQARLDMYHANAEELDEFYPDVIHINADQDPYTVFEFIESYTVS 472          
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Match: rassf1 (Ras association domain family member 1 [Source:Xenbase;Acc:XB-GENE-494691])

HSP 1 Score: 353.984 bits (907), Expect = 7.226e-115
Identity = 185/475 (38.95%), Postives = 289/475 (60.84%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MDAT++P++I P +  YAE+  +F+ ++K+++ +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P  V S   +D+  +A++   Y+   + +P  +W + ++ R    DC K+GW+L GFP+TRE    LQ  GI P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE   +L  YHRNI  +   Y     +INADQP  D+F  VL F + + R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +    +   ++     LTNL  +++         S  +   L       +RVF L++   V +ER      DPV+G++YH  Y P  +     R+ ++P+   + ++ +L +Y++   EL E+Y D + I+A+Q+ + +FE +ESY V+
Sbjct:    1 MDATRKPLRIPPAMALYAEEQGVFDIIQKMVKKVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPESVLS---SDVSLLAKEAQSYRDKGQEVPDELWAKLMQQRLSKVDCIKRGWILEGFPKTREQALKLQMAGICPDHLVVLDAPDIVLIERNMGKRIDTANGEVYHTTFDWPSDPTVQRNLVEPEGISEEETGLRLIEYHRNIPGILRTYPKTSKKINADQPYMDVFSQVLTFVLSKPRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIVNICCGQVLKEAVADQTKLGEVIQPYIENDQQGGNSFFLRF----LTNLNPTSFNK-------SPSEDFHLVALPAVTDRVFSLDLSDDVVIERLSLCMTDPVSGERYHDIYKPAPSSEVHERLQQNPRHSEQRVQARLDMYHANAEELDEFYPDVIHINADQDPYTVFEFIESYTVS 461          
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Match: rassf1 (Ras association domain family member 1 [Source:Xenbase;Acc:XB-GENE-494691])

HSP 1 Score: 349.362 bits (895), Expect = 3.716e-113
Identity = 183/475 (38.53%), Postives = 286/475 (60.21%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MDAT++P++I P +  YAE+  +F+ ++K+++ +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P  V S   +D+  +A++   Y+   + +P  +W + ++ R    DC K+GW+L GFP+TRE    LQ  GI P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE   +L  YHRNI  +   Y     +INADQP  D+F  VL F + + R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +     F  +++   R T+   S+Y +                 T  +P +     +P  V +ER      DPV+G++YH  Y P  +     R+ ++P+   + ++ +L +Y++   EL E+Y D + I+A+Q+ + +FE +ESY V+
Sbjct:    1 MDATRKPLRIPPAMALYAEEQGVFDIIQKMVKKVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPESVLS---SDVSLLAKEAQSYRDKGQEVPDELWAKLMQQRLSKVDCIKRGWILEGFPKTREQALKLQMAGICPDHLVVLDAPDIVLIERNMGKRIDTANGEVYHTTFDWPSDPTVQRNLVEPEGISEEETGLRLIEYHRNIPGILRTYPKTSKKINADQPYMDVFSQVLTFVLSKPRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIVNICCGQVLKEAVADQTKLGEVIQPYIENDQQGGSFDSLRVKTHRATS---SSYFF-----------------TATKPQK-----LPYDVVIERLSLCMTDPVSGERYHDIYKPAPSSEVHERLQQNPRHSEQRVQARLDMYHANAEELDEFYPDVIHINADQDPYTVFEFIESYTVS 447          
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Match: rassf1 (Ras association domain family member 1 [Source:Xenbase;Acc:XB-GENE-494691])

HSP 1 Score: 344.739 bits (883), Expect = 3.745e-111
Identity = 182/475 (38.32%), Postives = 288/475 (60.63%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MDAT++P++I P +  YAE+  +F+ ++K+++ +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P  V S   +D+  +A++   Y+   + +P  +W + ++ R    DC K+GW+L GFP+TRE    LQ  GI P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE   +L  YHRNI  +   Y     +INADQP  D+F  VL F + + R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +     F  +++   R   L    +G +  G   +    +++       N V  +++   V +ER      DPV+G++YH  Y P  +     R+ ++P+   + ++ +L +Y++   EL E+Y D + I+A+Q+ + +FE +ESY V+
Sbjct:    1 MDATRKPLRIPPAMALYAEEQGVFDIIQKMVKKVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPESVLS---SDVSLLAKEAQSYRDKGQEVPDELWAKLMQQRLSKVDCIKRGWILEGFPKTREQALKLQMAGICPDHLVVLDAPDIVLIERNMGKRIDTANGEVYHTTFDWPSDPTVQRNLVEPEGISEEETGLRLIEYHRNIPGILRTYPKTSKKINADQPYMDVFSQVLTFVLSKPRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIVNICCGQVLKEAVADQTKLGEVIQPYIENDQQGGSFDSLRVKTHR--PLERGQHGTICLG---AASNPQIIHFQ----NTVGDVDIYDVV-IERLSLCMTDPVSGERYHDIYKPAPSSEVHERLQQNPRHSEQRVQARLDMYHANAEELDEFYPDVIHINADQDPYTVFEFIESYTVS 462          
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 99.3673 bits (246), Expect = 6.177e-23
Identity = 67/221 (30.32%), Postives = 114/221 (51.58%), Query Frame = 2
Query:  809 RERLPALRTP-----RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            RE  PA R       R ILLGP G+GK T A  + +KY +  +  GD++R  +A  ++ G+ +++ ++    V D ++++LIE+ L    C   G+LL G+P +VKQAE+LD      + + + V   +V   + + R C R +   +G  YH  +NPP  ++  + ++  P      D+   +K +L  Y++    L EYY+    H  +DA Q    +F
Sbjct:    4 REAAPAERGSVMEGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKK-GFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPP-KEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHTAVDAAQSPDVVF 222          
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Match: Ak8 (adenylate kinase 8 [Source:MGI Symbol;Acc:MGI:1916120])

HSP 1 Score: 376.711 bits (966), Expect = 1.345e-123
Identity = 188/479 (39.25%), Postives = 291/479 (60.75%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MDAT  P +I PE+  Y E + IFE M+ +LE L+I +P +PI ++I +L+++ D+VP++ ILGPPASGK TIA  L   LN  L+    +     + +   A+   +  K IP +I +  ++ R    DC +KGW+L G PE RE    +Q  G+ P HV++L APD VLIER  GKRIDP TG++YH  FD     E+ +RL +PEG +  E  +KL  YHR+I  + P Y  +L  I++DQP  D+F   L +     R  A  TP+++L GP GSGK   A L+ +KY ++ ++CG L++EA+A ++  G  ++ + EK + VPD ++ +++ +R+    C   GW+L+G+P  + QA +L+     PNRVFFL VP    LER   RR DPVTG+++HL Y PP       R+ ++PKD  + IK +  ++     +L++YY   ++++ +Q+ + +FE +ES ++NPLP K+ 
Sbjct:    1 MDATTAPHRIPPEMPQYGEDYYIFEMMQNMLEQLLIHQPEDPISFMITHLRRNNDNVPKVVILGPPASGKTTIAMWLCKHLNSNLITKESLLEREFSRLSVEAKSYYQVYKKIPNSILVSLVQERLNEDDCLRKGWILDGIPERREQALMIQTLGLAPKHVIVLNAPDTVLIERNVGKRIDPVTGEIYHTTFDWPPEPEIQNRLRQPEGISEIETAKKLLEYHRHIIRILPSYPKILKTISSDQPCVDVFYQALTYVQSGHRCNAPFTPKVLLCGPLGSGKRLQATLLAQKYGLVNISCGQLLKEAVAAKSSFGELIQPFFEKRMTVPDSIITKVLADRMEQQDCIQKGWVLHGFPRDLDQARMLNSMGYNPNRVFFLSVPLDSILERLTLRRTDPVTGERFHLMYKPPPTIEVQVRLLQNPKDSEEYIKLQTDLFYRNSGDLEQYYDRAIIVNGDQDPYTVFEYIESGIINPLPRKVT 479          
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 95.1301 bits (235), Expect = 1.447e-21
Identity = 60/206 (29.13%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            R +LLGP G+GK T A  + + + +  +  GD++R  +A  ++ G  +++ ++    V D ++++LIE+ L    C   G+LL G+P +V+QAE+LD      K + + V    +   + + R   R + P +G  YH  +NPP  +   + ++  P      D+ K +K +L  Y++    L EYY+    H  IDA+Q    +F
Sbjct:   17 RAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPP-KEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVF 220          
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 95.1301 bits (235), Expect = 1.816e-21
Identity = 60/206 (29.13%), Postives = 107/206 (51.94%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD----CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIF 1420
            R +LLGP G+GK T A  + + + +  +  GD++R  +A  ++ G  +++ ++    V D ++++LIE+ L    C   G+LL G+P +V+QAE+LD      K + + V    +   + + R   R + P +G  YH  +NPP  +   + ++  P      D+ K +K +L  Y++    L EYY+    H  IDA+Q    +F
Sbjct:   17 RAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKN-GFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPP-KEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVF 220          
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Match: Ak3 (adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860835])

HSP 1 Score: 90.1225 bits (222), Expect = 7.152e-20
Identity = 59/217 (27.19%), Postives = 111/217 (51.15%), Query Frame = 2
Query:  830 RTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLC-CSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVNPLP 1456
            R  R +++G  GSGK T+++ I K + +  ++ GDL+R+ +    + G+  ++++++   +PD V+ +L    L  L  CS   WLL G+P ++ QAE LD    + + V  L VP  V  +R   R + P +G  Y++ +NPP      + ++  P      D  + +  +L  Y +    + +YY+   V++  +  E + I+  V S+L   +P
Sbjct:    6 RLLRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKTLTQCS---WLLDGFPRTLPQAEALDKV-YQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPP-KTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQTKVP 217          

HSP 2 Score: 53.9138 bits (128), Expect = 1.382e-7
Identity = 47/173 (27.17%), Postives = 79/173 (45.66%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIR-GLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVL-LTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDR----LIKPEGSTAEEMNQKLANY 697
            R  I+G P SGK T++  ++     + L+  D+  +     T+I  +A+  I   K IP ++  R  L     +  C    W+L GFP T     AL  + ++    V+ L  P  V+ +R   + I P +G VY+  F+P     ++D     LI+ E    E + ++L  Y
Sbjct:    9 RAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKTLTQCS---WLLDGFPRTLPQAEAL--DKVYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAY 176          
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 87.0409 bits (214), Expect = 6.240e-19
Identity = 61/210 (29.05%), Postives = 100/210 (47.62%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP-----KDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVN 1447
            R ++LGP GSGK T+   I + + +  ++ G L+RE +    + G   + Y+EK L VPD V+ +L+   L     S   WLL G+P ++ QAE LD    + + V  L +P     +R   R + P +G  Y+L +NPP  Q   + ++  P      D  + +  +L  Y      + E YK   V+   +  E + I+  V +   N
Sbjct:    7 RAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELE--TRSAQHWLLDGFPRTLVQAEALDGI-CDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQ-GIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSN 212          

HSP 2 Score: 58.9214 bits (141), Expect = 3.102e-9
Identity = 52/196 (26.53%), Postives = 90/196 (45.92%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVL-LTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVND----RLIKPEGSTAEEMNQKLANYHRNIALVKPLYDH--VLHEINADQ 763
            R  ILGPP SGK T+ + ++     Q L+   +  E     T++ D+A+  ++    +P ++  R +   +++     + W+L GFP T     AL  +GI    +V+ L  P   L +R   + I P +G VY+  F+P     ++D     L++ E    E +  +L  Y      V  LY    VLH+ +  +
Sbjct:    7 RAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMM--SELETRSAQHWLLDGFPRTLVQAEAL--DGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTE 198          
BLAST of adenylate kinase 8-like vs. UniProt
Match: sp|Q5M7G4|KAD8_XENLA (Adenylate kinase 8 OS=Xenopus laevis OX=8355 GN=ak8 PE=2 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 1.162e-137
Identity = 201/481 (41.79%), Postives = 313/481 (65.07%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MDAT++P++I P +  YAE+H +F+ ++K++E +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P +V S   +D+  + ++   Y+   + +P  +W + ++ R    DC K+GWVL GFP+TR+    LQ  G+ P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE  Q+L  +HRNI  +   Y  V  +IN DQP  D+F  VL F + ++R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +  VPD  +++++ + L++L  + +GW+L+G+P    QA LL      PNRVF L++   V +ER      DPV+G++YH  Y P        R+ ++PK   + ++ +L VY++   EL+E+Y+D + I+A+Q+ + +FE +ESY+V+PLP  L
Sbjct:    1 MDATRKPLRIPPAMAVYAEEHGVFDIIQKMVEKVLVDRPEDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPENVLS---SDVSLLVKEAQSYRDKGQEVPDELWAKLMRERLSQVDCIKRGWVLEGFPKTRDQALMLQMAGVCPGHLVVLDAPDIVLIERNMGKRIDITDGEVYHTTFDWPSDPAVQRNLVEPEGISEEETGQRLLEFHRNIPGLLRTYSKVSKKINVDQPYMDVFSQVLTFVLSKQRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIINICCGQVLKEAVADQTKLGELIQPYIENDQQVPDNFVLKILTDHLSSLESAKHGWVLHGFPQDTDQAALLKDAGFMPNRVFSLDLSDDVVIERLSLCMTDPVSGERYHSIYKPAPRSEVQERLQQNPKYSEEKVQARLDVYHANADELEEFYQDVIHINADQDPYTVFEFIESYIVSPLPKSL 478          
BLAST of adenylate kinase 8-like vs. UniProt
Match: sp|Q6P618|KAD8_XENTR (Adenylate kinase 8 OS=Xenopus tropicalis OX=8364 GN=ak8 PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.389e-133
Identity = 197/475 (41.47%), Postives = 306/475 (64.42%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYK---KPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MDAT++P++I P +  YAE+  +F+ ++K+++ +++DRP +PI+Y+I++L  D DDVPR+FILGPPASGKHT+AK+L  RLN   L P  V S   +D+  +A++   Y+   + +P  +W + ++ R    DC K+GW+L GFP+TRE    LQ  GI P H+V+L APD VLIER  GKRID   G+VYH  FD  ++  V   L++PEG + EE   +L  YHRNI  +   Y     +INADQP  D+F  VL F + + R  A  TPRI+L GP GSG+S  A+L+ +KY I+ + CG +++EA+AD+ K G  ++ Y+E +  VPD ++++++ E L++L  +T+GW+L+G+P    QA LL      PNRVF L++   V +ER      DPV+G++YH  Y P  +     R+ ++P+   + ++ +L +Y++   EL E+Y D + I+A+Q+ + +FE +ESY V+
Sbjct:    1 MDATRKPLRIPPAMALYAEEQGVFDIIQKMVKKVLVDRPKDPIQYMIDHLSNDNDDVPRVFILGPPASGKHTMAKLLCKRLNATHLTPESVLS---SDVSLLAKEAQSYRDKGQEVPDELWAKLMQQRLSKVDCIKRGWILEGFPKTREQALKLQMAGICPDHLVVLDAPDIVLIERNMGKRIDTANGEVYHTTFDWPSDPTVQRNLVEPEGISEEETGLRLIEYHRNIPGILRTYPKTSKKINADQPYMDVFSQVLTFVLSKPRSLAPHTPRILLYGPPGSGRSLQASLLAQKYGIVNICCGQVLKEAVADQTKLGEVIQPYIENDQQVPDNLVLKILTEHLSSLESATHGWVLHGFPRDTDQAALLKDAGFVPNRVFSLDLSDDVVIERLSLCMTDPVSGERYHDIYKPAPSSEVHERLQQNPRHSEQRVQARLDMYHANAEELDEFYPDVIHINADQDPYTVFEFIESYTVS 472          
BLAST of adenylate kinase 8-like vs. UniProt
Match: sp|Q96MA6|KAD8_HUMAN (Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK8 PE=1 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.167e-129
Identity = 206/482 (42.74%), Postives = 297/482 (61.62%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLN----PVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MDAT  P +I PE+  Y E++ IFE M+ +LE L+I +P +PI ++I++L +D D+VPRI ILGPPASGK TIA  L   LN  LL      ++ FS   T+    A      +K +P  + ++ ++ R    DC K+GW+L G PETRE    +Q  GI P HV++L+APD VLIER  GKRIDP+TG++YH  FD    SE+ +RL+ PE  +  E  QKL  YHRNI  V P Y  +L  I+ADQP  D+F   L +     R  A  TPR++LLGP GSGKS  A L+ +KY ++ V CG L++EA+AD    G  ++ + EK + VPD +L++++ +RL    C   GW+L+G P  + QA LL+     PNRVFFL VP    +ER   RR+DPVTG++YHL Y PP       R+ ++PKD  + +K K+ ++     +L++ Y   + ++ +Q+ + +FE +ES ++NPLP K+
Sbjct:    1 MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRIVILGPPASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATE----ARRLYLQRKTVPSALLVQLIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKI 478          
BLAST of adenylate kinase 8-like vs. UniProt
Match: sp|Q4R3W4|KAD8_MACFA (Adenylate kinase 8 OS=Macaca fascicularis OX=9541 GN=AK8 PE=2 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 3.747e-128
Identity = 202/478 (42.26%), Postives = 292/478 (61.09%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MD+   P +I PE+  Y E++ IFE M+ +LE L+I +P +PI ++I++L KD D+VPRI ILGPPASGK TIA  L   LN  LL   ++     +     A+     +K IP  + ++ ++ R    DC K+GW+L G PETRE    +Q  GI P HV++L+APD VLIER  GKRIDP+TG++YH  FD    SE+ +RL+ PE  +  E  QKL  YHRNI  V P Y  +L  I+ADQP  D+F   L +     R  A  TPR++LLGP GSGKS  A L+ +KY ++ V CG L++EA+AD    G  ++ + EK + V D +L++++ +RL    C   GW+L+G P  + QA LL+     PNRVFFL VP    +ER   RR+DPVTG++YHL Y PP       R+ ++PKD  + +K K+ +      +L++ Y   + ++ +Q+ + +FE +ES ++NPLP K+
Sbjct:    1 MDSASVPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHKDNDNVPRIVILGPPASGKTTIAMWLCKHLNSSLLTLENLVLNEFSLTATKAKRLYLQRKTIPSALLVQLIQERLAEEDCVKRGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAMADRTTFGELIQPFFEKEMAVLDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNSLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEILARLLQNPKDAEEQVKLKMDLSYRNSADLEQLYGSAITVNGDQDPYTVFEYIESGIINPLPKKI 478          
BLAST of adenylate kinase 8-like vs. UniProt
Match: sp|Q502L7|KAD8_DANRE (Adenylate kinase 8 OS=Danio rerio OX=7955 GN=ak8 PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 2.870e-125
Identity = 198/480 (41.25%), Postives = 293/480 (61.04%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEG-STAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD+ +RP++I PE+V YAEKH IF  ++ L+  L++D+P +PI+YLI +L++D  DVPRI +LGPPASGK T+AK L        +   D+  + D+D+   A+     K+ +P ++WI+ ++ R    DC ++GWVL   P+T++    LQ  GI P HVV+L APD VLIER+ GKRIDP TGDVYH  F    + EV  RL  P      + M+QKL  YH     +K  Y + L  INADQP  D+F  VL+F       P+  TPRI+L GP G+G++  A LI +KY I+ + CG+L++   ADE+  G  ++ Y+E    VP  ++++++ ERL+ + C+  GW+L+G+P  V++AELL  +   PNRVFFLE+   +++ER   R +DPVTG+ YH  Y PP       R+  +P+     +  +L  Y S  + L+ +Y   V I+A+Q+ H +FE +ES LV  LP  L+
Sbjct:    1 MDSAERPLRIPPEMVIYAEKHDIFHLIQTLVRNLMVDKPDDPIQYLINFLERDNVDVPRIILLGPPASGKKTVAKKLCEHTQAIHITFCDILKD-DSDLTRAAQSYYDKKQNVPKDLWIQLIQQRLSKPDCVQRGWVLEAIPKTQDEALCLQEAGITPDHVVMLEAPDVVLIERSSGKRIDPVTGDVYHVTFMWPESEEVAQRLETPRTLMPVQVMSQKLQKYHTEAHALKRTYHNCLKIINADQPHVDVFSQVLNFICTPRHSPSPYTPRILLFGPPGAGRNLQAKLIAQKYGIINICCGELLKAVSADESHMGELIKPYLESEQQVPSSIVLRVLTERLSRMDCTARGWVLHGFPRDVEEAELLHKSNFTPNRVFFLEITDDIAIERLALRAVDPVTGEWYHSVYKPPPGPEVQARLRFNPQHSEAQLLMRLKEYWSQTVRLQAFYPQAVYINADQDPHTVFESLESRLVGQLPKVLS 479          
BLAST of adenylate kinase 8-like vs. TrEMBL
Match: gnl|BL_ORD_ID|20348224 (tr|A0A1S3K5Z5|A0A1S3K5Z5_LINUN adenylate kinase 8-like OS=Lingula unguis OX=7574 GN=LOC106179094 PE=3 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 6.325e-160
Identity = 228/479 (47.60%), Postives = 320/479 (66.81%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MDATKRP+ I PE   YAEKH IFE   KLLE L+I++P +P+ +LIE LK+D DD P++ I+GPPA+GK TIAKM+  R+    L   ++  E + +I+  A++ IK  + IP  +W++ +K R K +DC K+GWVL GFP+TRE   ALQ EGI+P H VLL APD VLIERA GKR+DPETGDVYH  FD  +N+EV  RL    G++ +E+  KL  YHR+I  +K  Y  +L  INADQP  D+F   + F   R R  A   PR++LLGP+GSGK   A L+  KY+I+ ++CG LI++AI DE K GLA + Y+EKN+ VPD +L+ ++++RL  L C + GW+++GYP + +Q E L      PNRVFFL+VP+   +ER   R  DP+TG++YH+ YNPP  Q    R+ + PKD  + ++ +L  Y + V EL +YY D   ++A+Q+ H +FE +ES +VNP+P + +
Sbjct:    1 MDATKRPLLIPPEFATYAEKHGIFEMYTKLLEQLLINKPDDPLTFLIELLKRDSDDAPQVVIMGPPAAGKRTIAKMVCNRIRAAYLTMDNLIQEAEIEIRKKAQEYIKKNETIPTELWLKIIKERMKSYDCIKRGWVLEGFPQTREQALALQAEGIYPKHFVLLDAPDTVLIERAAGKRVDPETGDVYHTTFDWPSNAEVAGRLEPVPGNSEDELVNKLVVYHRHIEGLKTCYSKILKIINADQPKGDVFAQTITFLGSRLRNAAPHNPRVVLLGPTGSGKGVQAALLANKYNIVNISCGQLIKQAIVDETKAGLAAKPYLEKNMLVPDAILLNILKQRLGQLDCVSRGWVMHGYPKTTEQGEQLVHAGFTPNRVFFLDVPNDSVIERLTLRATDPITGERYHMLYNPPRTQEVKERLRRAPKDSPEEVQKRLGAYQAFVDELTDYYVDAQHVNADQDPHTVFECLESMMVNPIPQRFD 479          
BLAST of adenylate kinase 8-like vs. TrEMBL
Match: gnl|BL_ORD_ID|15737252 (tr|R7T860|R7T860_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_200548 PE=3 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 8.540e-159
Identity = 229/479 (47.81%), Postives = 323/479 (67.43%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD TKRP+KI P    YAE H IF+  K+LL  L++++P +P+ +LI+ LK+D DDVP+I ILGPPASGK +IAKM++ +L C LL   ++  E DT++++ A+D IK  + IPV +W   +K R K+FDC KKGWVL  FPETRE    L   GI+P H +LL APD VLIERA GKR+DP+TGD++H  FD  T+S+V DRL +  G +  E+ ++L  YHR+I  +   Y   LH  NADQP AD+   V+ F   + R  A  TPRI+LLG +GSGK   A+L+  KY I+ V+ G LI++ IA E++ G A +SY E+N+ VPD +++ +++ERLT+L C+ +GW+L+GYP + +QAE L    L PNRVFFLE+P+   +ER   R  DP+TGD+YHL YNPP  Q   +R+   PKD+ + ++ +LA Y++   EL ++Y D   I+A+Q+ H +FE +ES +V PLP   N
Sbjct:    1 MDPTKRPLKIPPTFSTYAESHGIFDLYKRLLSQLLVEKPEDPLAFLIDLLKRDNDDVPQITILGPPASGKQSIAKMVASKLRCTLLTKDNIIEEADTELRNQAKDLIKAGRQIPVELWGELMKSRLKVFDCIKKGWVLDSFPETREQAIVLASLGIYPKHCILLNAPDTVLIERASGKRVDPKTGDIFHTTFDWPTSSDVADRLKEVPGYSESEITERLVIYHRHIDGILEAYKANLHTFNADQPKADVCSQVMTFLHSKPRTAAPHTPRIVLLGSTGSGKGVQASLLANKYGIINVSMGQLIKQCIAAESRSGQACKSYTERNMLVPDAIVLSILKERLTDLDCAAHGWVLHGYPKTREQAEQLSGAGLLPNRVFFLEIPNDSVMERLSLRATDPITGDRYHLLYNPPRTQEVKDRLKISPKDEEEAVRKRLADYHAYSEELADFYSDSQRINADQDPHTVFESIESMVVKPLPKNPN 479          
BLAST of adenylate kinase 8-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23861411 (tr|V3Z5F9|V3Z5F9_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_195378 PE=3 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 4.758e-157
Identity = 225/478 (47.07%), Postives = 320/478 (66.95%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MD TKRP+ I PE   YAE+H +F+  ++LLE L++ +P  PI +LI+ LK+D DDVP+I ILGPPA+GK +I KM+  +     +   ++ SE D   ++ A + I  KK +P  +W++ ++ R  +FDC KKGWV+ GFP+TRE    LQ  G +P H V+L APD VLIERA GKR+DP TGD+YH  F+  +N E+ DRL+  EG T EEM QKL  YHR I  +K  +  VL  +NADQP AD+F  VL F   + R P   TPRI+LLGPSGSGK+  A L+  KY+++ ++CG LI++AIADE K G A ++YV K   VPD +++ ++++RL  L C T GW+L+GYPLS +Q E L+     PNR+FFL+VP+   +ER  +R  DP+TG++YHL YNPP  Q   +R+ +H KD+ + +K +LA Y++   EL +YY+    I+A+Q+ H +FE +ES +VN LP ++
Sbjct:    1 MDETKRPLLIPPEFAYYAEEHGVFDMYQRLLEQLLVHKPDEPISFLIDLLKRDNDDVPKIIILGPPAAGKRSIGKMICNKTRAAHITMENLISEADISHREEALNYINKKKAVPTELWMKIIEERMVLFDCVKKGWVMEGFPQTREQALGLQERGFYPKHCVILEAPDTVLIERASGKRVDPTTGDIYHTTFNWPSNQEIQDRLVVAEGYTEEEMVQKLILYHRYIESLKHCFGAVLQTVNADQPKADVFAQVLTFICSQARSPTPHTPRIVLLGPSGSGKAVQAALLASKYNLVNISCGHLIKQAIADETKSGKAAKNYVRKGNMVPDTIVLSIVKDRLGQLDCVTRGWVLHGYPLSREQGEQLEKQGFVPNRIFFLDVPNDSVIERLTQRYTDPITGERYHLLYNPPRTQDIKDRLERHEKDEEEHVKKRLAQYHAYYEELTDYYEASQHINADQDPHTVFETIESMIVNQLPKRI 478          
BLAST of adenylate kinase 8-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23901661 (tr|K1PRS8|K1PRS8_CRAGI Putative adenylate kinase-like protein C9orf98-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10009645 PE=3 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 2.248e-156
Identity = 224/479 (46.76%), Postives = 321/479 (67.01%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MD TKRP+ I PE   YAE+H IF+  K+L+E LI+ +P +P+ +L+E LKK+ DDVP++ ILGPPASGK +I+K+ + +L    L   ++  E +TDIK    D IK K+ +P  IW++ L  R K+ DC KKG+VL GFP+TRE   ALQ  GI P H V+L APD VLIERA G+R+DP+TGD+YH  FD   N+E+  RL +  G T E+M  KL  YHR+I  ++  Y  V+ ++NADQP AD+F  V  +   + R  A  TPRI+LLGP+GSGK   A L+  KY+I+ V+ G L++++IADE K G A ++Y+EK++ VPD +++ ++ ERL  L C + GW+L+GYP + +QAE L      PNR+FFL+VP+   +ER   R  DP+TG++YH+ YNPP  Q    R+ KHPKD    ++ +LA Y++ V EL +YY +   ++A+Q+ H +FE +ES +VNPLP + +
Sbjct:    1 MDQTKRPLLIPPEFSTYAEEHGIFDMYKRLMEQLIVSKPSDPLAFLVEQLKKENDDVPQVIILGPPASGKKSISKLCANKLRTAHLTTENLIQESETDIKMKVMDLIKKKETVPTEIWVQILTERLKLMDCVKKGYVLEGFPQTREQALALQSVGIHPKHCVILDAPDTVLIERAQGRRVDPKTGDIYHTTFDWPPNAEIQTRLEETPGYTEEDMVNKLIEYHRHIDEIEECYRKVIKKVNADQPKADVFSQVYSYLCGQPRSNAPHTPRIVLLGPTGSGKGVQAALLANKYNIVNVSSGSLVKQSIADETKAGQAAKAYIEKSMMVPDNIILDIMRERLAQLDCVSRGWVLHGYPRTREQAEALAKDGFVPNRIFFLDVPNDSVIERLTLRATDPITGERYHMLYNPPRTQEIKERLQKHPKDSEDAVRRRLAEYSAYVEELADYYTEGQHVNADQDPHTVFECIESMIVNPLPKRFS 479          
BLAST of adenylate kinase 8-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23525995 (tr|A0A210PLV5|A0A210PLV5_MIZYE Adenylate kinase 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04753 PE=3 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 5.703e-154
Identity = 221/478 (46.23%), Postives = 318/478 (66.53%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MD TKRP+ I PE   YAEKH IFE  KKL+E LI+ +P +P+ +LI+ LK+D  DVP++ I+GPPASGK TI+KM + +L    L   ++  E +TD+K    D  K K+PIP+++W++ ++ R K+ DC +KGWV+ GFP+TRE   A+Q  GI P H VLL APD VLIERA GKR+DP+TGD+YH  FD  +++EV  RL + EG   ++M +KL  YHR+I  +   +   L  +NADQP AD+F  V  +   + R  A  TPR++LLG +GSGK   A+L+  KY+++ V+CG LI++AIADE K G     YV K++ VPD  ++Q++ +RL+ + C + GW+L+GYP + +QAE L      PNRVFFL VP+   +ER   R  DP+TGD+YH+ YNPP  +    R+ K PKD+ + +  +L  YN+ V E+ ++Y D   ++A+Q+ H +FE +ES +VNPLP K+
Sbjct:    1 MDQTKRPLLIPPEFSTYAEKHGIFEMYKKLMEQLIVGKPADPVAFLIDLLKRDTHDVPQVIIIGPPASGKKTISKMCATKLRTAHLTTENLIMEAETDLKMQMLDLQKKKQPIPIDVWVKVIEERIKLPDCVRKGWVMEGFPQTREQALAIQSIGIHPKHCVLLDAPDTVLIERAHGKRVDPKTGDIYHTTFDWPSSTEVQSRLEEAEGYGEDDMVEKLIEYHRHIDGILTCFTKGLKSVNADQPQADVFLQVFTYLCGQARTNAPHTPRVVLLGATGSGKGVQASLLATKYNLVNVSCGSLIKQAIADETKEGQTAIPYVSKDMLVPDVTVMQILRQRLSQMDCMSRGWVLHGYPRTREQAEGLTKGGFVPNRVFFLNVPNDSVVERLTLRATDPITGDRYHMLYNPPRTEDVKARLQKLPKDESEQVNKRLGTYNAYVEEISDFYVDAQHVNADQDPHTVFECIESMIVNPLPRKV 478          
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:553671])

HSP 1 Score: 369.777 bits (948), Expect = 3.933e-121
Identity = 190/476 (39.92%), Postives = 293/476 (61.55%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEE-MNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLP 1456
            MDAT +P++I P++  YAEKH IFE  + L+  L++D+P +PI+YLI+ LK++  DVPR+ +LGPPASGK TIAK L  ++    +   ++  + D+D+   A +  +  + IP ++WI+ ++ R    DC ++GWVL   P+TRE    LQ  GI P HVV+L AP+ VLIER+ GKRIDP TGDVYH  F    ++EV  RL +P+   +E+ + ++L  +HR    ++  Y + L  ++ADQ   D+F  VL F + R R  A  TPRI+LLGP GSG+S  A LI +KY ++ + CG+L++   ADE+  G  ++ ++E    VPD +++Q++ ERL+ L C+T GW+L+G+P  ++QAE L  +K  PNRV FLE+   V++E      +DPVTG+++              R+    ++    ++ KL  Y   V  L+ +Y   V + A+Q+ H +FE +ES LV+ LP
Sbjct:    1 MDATTKPLRIPPDMATYAEKHDIFELFQTLVRSLVVDKPADPIQYLIDMLKRENTDVPRVMLLGPPASGKRTIAKKLCEQIGTIHITASNILKD-DSDLSRAALEYTEKNQEIPQDLWIKLIQQRLLKADCVRRGWVLEAIPKTREEALCLQEAGIAPEHVVMLQAPESVLIERSLGKRIDPVTGDVYHVAFMRPESAEVAQRLERPQSLISEDVIYRQLQGFHREAHALQRTYKNCLKIVDADQAHVDVFAQVLTFILSRHRSSAPYTPRILLLGPPGSGRSLQARLIAQKYGLVNICCGELLKAVAADESSMGELIKPFLESGRRVPDSMVLQILTERLSRLDCTTRGWVLHGFPQDLEQAEALQESKFSPNRVVFLEMTDGVAVEGLTLGAIDPVTGERHSF------------RLQHRLRESEAEVQKKLQQYWRHVEALQAFYPQAVRVRADQDPHTVFECLESTLVDRLP 463          
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 100.908 bits (250), Expect = 9.219e-24
Identity = 52/147 (35.37%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  830 RTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS 1270
            R  R +++GP GSGK TI+  I + + +  ++ GD +RE IA   + G+  ++Y+EK L VPD V+ +L+  RL  + C  + WLL G+P ++ QAE L+ +  E + V  L +P     ER   R +   +G  Y++ +NPP  Q 
Sbjct:    3 RLFRAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTC--HSWLLDGFPRTLAQAEALNSS-CELDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQG 146          

HSP 2 Score: 58.5362 bits (140), Expect = 2.761e-9
Identity = 55/185 (29.73%), Postives = 86/185 (46.49%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYAL--QCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVND----RLIKPEGSTAEEMNQKLANYHRNIALVKPLYD 733
            R  I+GPP SGK TI++ ++     Q L+  D   E    +T+   +A+  I+    +P ++  R L  R +   C    W+L GFP T     AL   CE      V+ L  P   L ER   + I   +G VY+  F+P     V+D     LI+ +    E +  +L +Y +++A  KP+ D
Sbjct:    6 RAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHS--WLLDGFPRTLAQAEALNSSCELDL---VISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHY-KDVA--KPVID 182          
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 101.293 bits (251), Expect = 9.743e-24
Identity = 51/144 (35.42%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS 1270
            R +++GP GSGK TI+  I + + +  ++ GD +RE IA   + G+  ++Y+EK L VPD V+ +L+  RL  + C  + WLL G+P ++ QAE L+ +  E + V  L +P     ER   R +   +G  Y++ +NPP  Q 
Sbjct:   13 RAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTC--HSWLLDGFPRTLAQAEALNSS-CELDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQG 153          

HSP 2 Score: 59.3066 bits (142), Expect = 1.974e-9
Identity = 57/197 (28.93%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  179 LKKDIDDVPRIF---ILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYAL--QCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVND----RLIKPEGSTAEEMNQKLANYHRNIALVKPLYD 733
            + + +DD   +F   I+GPP SGK TI++ ++     Q L+  D   E    +T+   +A+  I+    +P ++  R L  R +   C    W+L GFP T     AL   CE      V+ L  P   L ER   + I   +G VY+  F+P     V+D     LI+ +    E +  +L +Y +++A  KP+ D
Sbjct:    1 MAQKLDDTKLLFRAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHS--WLLDGFPRTLAQAEALNSSCELDL---VISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHY-KDVA--KPVID 189          
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:103033473])

HSP 1 Score: 100.138 bits (248), Expect = 2.074e-23
Identity = 67/218 (30.73%), Postives = 112/218 (51.38%), Query Frame = 2
Query:  827 LRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD--CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVNPLP 1456
            LR  R +++GP GSGK T++N I   + +  ++ GD++R  I  + + GL M+S +++   VPD V+ +LI   L N+  S+  WLL G+P +V QAE LD  CT    + V  L+VP     ER   R L   +G  Y+  +NPP    ++      + +   D  + +  +L  Y      + EYY+   V++  +  E + I+  V ++L   +P
Sbjct:    4 LRVFRAVIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRANIKAKTELGLLMKSCIDQGQLVPDDVISRLILSNLRNMDHSS--WLLDGFPRTVAQAESLDSMCTV---DTVINLDVPFQTIKERLTSRWLHLPSGRVYNTDFNPPKIPGLDDVTGEPLIQREDDTPETVTRRLKAYEFQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLTRKIP 216          

HSP 2 Score: 55.0694 bits (131), Expect = 4.548e-8
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFS---ECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFD----PATNSEVNDRLIKPEGSTAEEMNQKLANY 697
            R  I+GPP SGK T++  ++     + L+  D+     +  T++  + + CI   + +P ++  R     + + + +   W+L GFP T     +L       T V+ L  P   + ER   + +   +G VY+  F+    P  +    + LI+ E  T E + ++L  Y
Sbjct:    8 RAVIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRANIKAKTELGLLMKSCIDQGQLVPDDVISR--LILSNLRNMDHSSWLLDGFPRTVAQAESLDSMCTVDT-VINLDVPFQTIKERLTSRWLHLPSGRVYNTDFNPPKIPGLDDVTGEPLIQREDDTPETVTRRLKAY 175          
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 89.7373 bits (221), Expect = 7.740e-20
Identity = 60/200 (30.00%), Postives = 100/200 (50.00%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD------CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDAN 1399
            R ILLGP G+GK T A  + +K+ +  +  GD++R  +A  ++ G  ++  ++    V D ++++LIE+ L    C   G+LL G+P +VKQAE+LD        KL  + V    V   + + R C R +   +G  YH  +NPP     +      +S+   D+   ++ +L  Y+     L EYY     H  +DA+
Sbjct:   19 RAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKN-GFLLDGFPRTVKQAEMLDDLLDKRTEKL--DSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEHMKDDVTGEPLSRRSDDNENTLRSRLESYHRQTAPLVEYYSARGLHRAVDAS 215          
BLAST of adenylate kinase 8-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004823.1 (pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 gene:ENSPMAG00000004380.1 transcript:ENSPMAT00000004823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.346e-8
Identity = 51/247 (20.65%), Postives = 112/247 (45.34%), Query Frame = 2
Query:  842 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYP------LSV-KQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHL----------SYNPPVNQSA------------------------FNRMSKHPKDDVKVIKHKLAVYNSTVIE-LKEYYKDH-----VVIDANQELHNIFELVESYL 1441
            +++LG  G GK+T+A  + K +  + V    +I++ I  + + G+ ++  + K   + +  + +L+ E+L +   + YG++L G+P      L++ +Q EL+    L+P+ +  ++ P+    +R+  +R DP+TG  Y L            NP  + +                          +R+ + P D    +   + +YN T++  L++   DH     + +D N+  + + + V + L
Sbjct:   18 LLVLGKPGVGKATLARRLTKVWRCVLVEGVAVIQQHIDAQTETGIMLQERLVKGEVISEETVTRLLLEKLASPQVAHYGYVLCGFPSLSEENLTIPQQIELIKSWSLKPDVIINIKCPNDDLHKRRTRQRQDPLTGQVYVLDELGREAARDGKNPQADNATEREEEGEEMEEKEEEAEAGLDKGLLSRLVRRPGDSPDDVMRVITLYNDTLLRPLEDLMADHDPRYLIELDGNESPNALLDGVLARL 264          
BLAST of adenylate kinase 8-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005320.1 (pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gene:ENSPMAG00000004809.1 transcript:ENSPMAT00000005320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.653e-8
Identity = 40/148 (27.03%), Postives = 68/148 (45.95%), Query Frame = 2
Query:  767 LADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIA-------------DENKHGLAMRSYVEKNLPVPDFV------------------LIQLIEERLTNLCCSTYGWLLYGYPLSVKQA 1117
            LA++ + V +F   R+  P     RI +LGP  +GK+T+A ++CK Y I  VN  D+I EA++             +   H   + ++ E      DF+                  L++L +E L++  C   G++L G+P +  QA
Sbjct:  252 LANLERVVREFRATRKLQPI----RICILGPPVTGKTTVAQMLCKHYKIHHVNMKDVITEALSKLERIVGSASRKEETEWHEEDVEAFTEDVQEAQDFLEALRENMLQNEGRLEDSYLVRLYKETLSSPPCQNQGFVLDGFPKTFSQA 395          
BLAST of adenylate kinase 8-like vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 88.9669 bits (219), Expect = 1.649e-20
Identity = 55/201 (27.36%), Postives = 103/201 (51.24%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLD------CTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVV---IDANQ 1402
            R++L+GP G+GK T A  + +++    +  GD++R  IA   + GL  +  +++   V D +++ +I++ LTN      G++L G+P ++ QAE LD       T LE  +   L+V   + + R   R + P +G  YH  +NPP     +      + +   D+   +K +LA Y++    + ++YK   +   +DA+Q
Sbjct:    8 RMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLE--KAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQ 206          

HSP 2 Score: 60.077 bits (144), Expect = 1.110e-10
Identity = 52/213 (24.41%), Postives = 92/213 (43.19%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSEC---DTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHV----YALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVND----RLIKPEGSTAEEMNQKLANYHRNIALVKPLYD-----HVLHEINADQPLADIFQTVLD 796
            R+ ++GPP +GK T A  L  R +   L   D+        T +   A+  +     +  +I +  +K         K G++L GFP T          L+ +G      + L   D +L+ R  G+ I P +G  YH +F+P      +D     L++     A+ + ++LA YH   A  +P+ D      +   ++A QP A ++  +L+
Sbjct:    8 RMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYH---AQTEPIVDFYKKTGIWAGVDASQPPATVWADILN 217          
BLAST of adenylate kinase 8-like vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 80.4925 bits (197), Expect = 1.316e-17
Identity = 59/185 (31.89%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  854 GPSGSGKSTIANLICKKY-SIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCC--STYGWLLYGYPLSVKQA----ELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYK 1375
            G  GSGK T  + + K+   +  ++ GD++R+ I  E+  G    +Y+ +   +PD ++ +LI  RL+ L     +  WLL G+P +  QA    ELL       N V  L+VP    LER   R +   +G  Y+L YNPP    ++      ++K   D  +V K +L  Y  T   LK+YYK
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYK 205          
BLAST of adenylate kinase 8-like vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 57.7658 bits (138), Expect = 4.640e-10
Identity = 45/209 (21.53%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  842 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIR-EAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLT-NLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY--KDHVV-IDANQELHNIFELVESYLVNPL 1453
            I +LG  G+GK T    + K YS + ++ GDL+R E     +++G  +++ +++   VP  + + L+   ++ N+  + + +L+ G+P  + QA   +   +E   + F + P  + LER  ER                        + S    D+++ IK +   +  T + + EY+  K  VV +  ++ + ++++ V+  + + L
Sbjct:   19 IFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLER-----------------------GKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAIRDSL 204          
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Match: EDO43271 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ3])

HSP 1 Score: 352.058 bits (902), Expect = 8.516e-115
Identity = 189/479 (39.46%), Postives = 291/479 (60.75%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD-HVVIDANQELHNIFELVESYLVNPLPMKL 1465
            MDATK+P+ I PE  NYAEKH IF+  ++LL  LI+++P +P+  +I+ L+++ + VP+I I GPP SGK ++A M+S  L+C  LN  ++ SE ++ +        +Y + +P +IW+  +  R K  DC  KGW+L GFP+TRE   ALQ EGI P+H +LL  PD VLIER  GKR+DPETGDVYH  FDP ++ EV  RL+     T   M  +L  YHR+I  +   Y+++   +NADQP AD+F  VL +     R  A  TPR++LLGP+G GKS  A L+  KY ++ V+C +LI++++AD +K G +++ Y+++ +   +F       +++ NL   T    L   PL       +      P  V F+++P+   LER   R +DPVTG++YHL YNPP +    +R+ ++ KD    +  + A Y + + E+ E Y++    I+A+Q++H +FE +ES +VN +P K+
Sbjct:    1 MDATKKPLLIPPEFANYAEKHGIFQIYERLLSRLIVEQPTDPLTCMIDILQQE-ESVPQIVIHGPPGSGKRSMAVMISKHLDCVCLNVNNIISESESKLASKVRTN-RYTE-VPTHIWVNLIAERIKKTDCLTKGWLLEGFPQTREQALALQVEGIIPSHFILLDCPDTVLIERVMGKRVDPETGDVYHTTFDPPSDPEVVRRLVPDPKCTEAAMVGRLMEYHRHIDGILACYENIYKTVNADQPKADVFSQVLAYIKTNPRSQAPHTPRVVLLGPTGCGKSVQAELLASKYGLINVSCTELIKQSLADGSKIGESIQPYIDRKMMGREF------SDKILNLSERTKRDFL--VPLQYLHGTFIVGFGYIPE-VVFMDIPNDTILERLTLRSIDPVTGERYHLIYNPPRSSEVKDRLQRNKKDQEDEVNDRTAQYQAYIEEIAECYEEIGQHINADQDIHTVFECIESIIVNRIPRKV 467          
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 83.1889 bits (204), Expect = 2.742e-18
Identity = 57/203 (28.08%), Postives = 100/203 (49.26%), Query Frame = 2
Query:  851 LGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS----AFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYL 1441
            +GP GSGK T++  I + + +  ++ G+L+R  + +    G   ++Y+ K   VPD +++ LI   L  L      WLL G+P +V QAE L   K + + V  ++VP    ++R  +R +  V+G  Y+L +NPP  +         +++   D  + +  +L  Y      L EYY    V+   +  E + I+  V+ YL
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNHTDLGEEAQAYILKGELVPDELMVDLI---LHELDAKKGNWLLDGFPRTVGQAETL-SEKHKIDVVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETVMARLKKYEEQTKPLIEYYNKKGVLASFSGTETNVIWPRVKKYL 199          
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 78.9518 bits (193), Expect = 1.758e-16
Identity = 62/214 (28.97%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  830 RTPRIILLGPSGSGKSTIANLICKKYSIMKVNC---GDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAE----LLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS----AFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQELHNIFELV 1429
            R  R ILLGP GSGK T      K+  I  V C    D++R  +A  +  G  ++S ++    V D ++++LI++ LT   C   GWLL G+P +V QAE    LL+    + + V    +   + ++R   R L   +G  YH  +NPP            + +   D+   +  +L  Y+S    L +YY     H  IDA++    ++  V
Sbjct:   13 RGVRAILLGPPGSGKGTQ----VKRRRISIVVCLLFCDMLRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTKPECQN-GWLLDGFPRTVAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDITGEPLERRSDDNEATLTKRLQAYHSQTTPLIDYYTKRGIHHKIDASKPPDTVYSSV 221          

HSP 2 Score: 49.2914 bits (116), Expect = 1.760e-6
Identity = 52/226 (23.01%), Postives = 94/226 (41.59%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAK-----MLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTH------VVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEE----MNQKLANYHRNIALVKPLYDH-----VLHEINADQPLADIFQTVL---DFCVKRE 814
            R  +LGPP SGK T  K     ++   L C +L  V         +    +  +   + +  ++ +  +       +C+  GW+L GFP T      L  +G+          VV     D +L++R  G+ +   +G  YH  F+P      +D   +P    +++    + ++L  YH       PL D+     + H+I+A +P   ++ +VL   D  V R+
Sbjct:   16 RAILLGPPGSGKGTQVKRRRISIVVCLLFCDMLRAVVASGSA---LGKKVKSVMDAGQLVSDDLVVELIDDNLTKPECQN-GWLLDGFPRTVAQAEKL--DGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDITGEPLERRSDDNEATLTKRLQAYHSQTT---PLIDYYTKRGIHHKIDASKPPDTVYSSVLKAFDDAVARQ 232          
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 64.3142 bits (155), Expect = 7.029e-12
Identity = 50/208 (24.04%), Postives = 90/208 (43.27%), Query Frame = 2
Query:  842 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVV---IDANQELHNIFELVESYLVNPLP 1456
            II LG  G+GK TI + + KKY+   ++ GDL+RE +   N+ G  +   + +   VP  + I L+++ +        G+L+ G+P  + Q    +    + + V +LE    V  ER  +R                          S  P D+++ IK +   +    + + E+Y+       IDA++ L  ++  + S L   LP
Sbjct:    4 IITLGGPGAGKGTICDSVVKKYNYCHLSAGDLLREEVTRGNERGQMITEMMREGKLVPKEITIGLLQDAMRE-HKDMPGFLIDGFPRDIDQGITFEEQVTDSDFVLYLECTEEVMQERLLKR-----------------------AETSGRPDDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISS-LFAELP 186          
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Match: EDO38691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC73])

HSP 1 Score: 65.0846 bits (157), Expect = 5.182e-11
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLA--MRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPV 1222
            RI ++GP  SGK+T+A     +Y +++++ G+ IR+ + +++   LA  +   V  +  V +  ++Q ++  L N+   T G++L GYPL+ +Q EL+   K+ P +V  L V     + R    R DP 
Sbjct:  203 RIAIIGPPKSGKTTLAKRFTAEYGVVRLSIGEAIRKVLNNQSHTELARQINLRVGAHRVVDEASMVQAVDITLLNMHFQTGGFVLDGYPLTARQVELMTERKIIPVKVLELRVTDEEVIRRGIADRNDPA 332          
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Match: ak8 (adenylate kinase 8 [Source:NCBI gene;Acc:101157866])

HSP 1 Score: 338.191 bits (866), Expect = 5.076e-109
Identity = 178/472 (37.71%), Postives = 273/472 (57.84%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVN 1447
            MD T +P++I P++ NYAEKH++    + L+  L+ID+P +PI YLI+ L+    D PR+ +LGPPA GK+T+ K LS  L         V    ++ ++  +E     +K +P  + +R L+ R K  DC KKGWVL G P+TR     LQ  G+ P HVV+L APD VL ER  G+ +DP+T D YH + +  ++  +  RL K    + E+++++L ++   ++ ++  Y HVL  I+ DQ  ADI+Q  L F   R R    R  RI+LLGP GSGKS  A L+ + Y ++ V+CG L+R   A  +  G  ++ Y++  LPVPD  ++Q++EERL+   CS+ GW+L+G+P ++ QA  L  ++ EPNRVFFLE    V LER   +  DPV+G ++H   NP       +R+   P+D  + +  +L  Y      LK  Y D   +DA+ +  ++FE ++S L  
Sbjct:    1 MDETVKPLRIPPQMRNYAEKHELTHLAQGLVSNLLIDQPDDPISYLIDLLQGSSLDTPRVMVLGPPAVGKYTLCKRLSAELQA-------VHVTTESLLQGQSELSALSEKDLPSELLVRILQQRLKEVDCLKKGWVLQGIPKTRLQALNLQQVGVLPKHVVMLEAPDDVLQERNQGRMVDPQTKDTYHQILNWPSDDTIAGRLQKGRSLSNEQLSEELQHHSCEVSGLRSAYQHVLKVISGDQSHADIYQQALAFVQTRHRS---RPQRIVLLGPPGSGKSLQAQLLAETYKMVDVSCGRLLRSIAAGGSALGEDIQLYLDGGLPVPDSKVLQVLEERLSQEDCSSRGWVLHGFPKNLLQARSLQESQHEPNRVFFLEATDEVCLERITLQATDPVSGQRFHAVSNPAPTSEFHSRLQTRPQDGTEEVLRRLREYRELSDALKSVYPDAAHVDADPQPRSVFEALQSRLTT 462          
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:101175146])

HSP 1 Score: 99.7525 bits (247), Expect = 2.659e-23
Identity = 61/211 (28.91%), Postives = 107/211 (50.71%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQS----AFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYLVNPL 1453
            R  +LGP GSGK TI+  I + + +  V+ GD +R  I    + G+ M++Y+E+ L VPD V+  L+  +L  L  S++ WLL G+P ++ QA +L+    + + V  L +P     +R  +R + P +G  Y++S+NPP  Q         + +H  D  + +  +L  Y      + + YK   ++   +  E + I+  + S L   L
Sbjct:    6 RAAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHVVTGLVLPKLEQL--SSHSWLLDGFPRTLAQALVLNNV-YQLDLVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEALMSRLRQYKEVAKPVIDLYKTQGILHSFSGTETNKIWPYINSLLSTKL 213          

HSP 2 Score: 51.9878 bits (123), Expect = 4.944e-7
Identity = 50/196 (25.51%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  206 RIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSE---CDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVL-LTAPDYVLIERADGKRIDPETGDVYHALFDP----ATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLY--DHVLHEINADQ 763
            R  ILGPP SGK TI+K ++     Q ++  D        +T+     +  I+    +P ++ + GL    K+       W+L GFP T     AL    ++   +V+ L  P   L +R   + I P +G VY+  F+P      +    + LI+ +    E +  +L  Y      V  LY    +LH  +  +
Sbjct:    6 RAAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHV-VTGLVL-PKLEQLSSHSWLLDGFPRTLAQ--ALVLNNVYQLDLVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEALMSRLRQYKEVAKPVIDLYKTQGILHSFSGTE 197          
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:101160331])

HSP 1 Score: 93.2041 bits (230), Expect = 4.898e-21
Identity = 63/213 (29.58%), Postives = 107/213 (50.23%), Query Frame = 2
Query:  824 ALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP---KDDVK--VIKHKLAVYNSTVIELKEYYKDHVVID--ANQELHNIFELVESYL 1441
            + R  R +++GP GSGK T++  I K + +  ++ GD++R  I  + + GL +RS +++   VPD ++ +LI + L ++      WLL G+P +V QAE LD      + V  L VP     ER   R     +G  Y+  +NPP     F+ ++  P   +DD K   +  +L  Y +    + E+Y+   V+      E + I+  VE +L
Sbjct:    4 STRILRAVIMGPPGSGKGTVSARIVKSFGVKHISSGDILRANIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSM--EHISWLLDGFPRTVSQAEALDQA-YTLDTVINLNVPFQTIKERLTSRWTHISSGRVYNTDFNPP-KVPGFDDVTGEPLVQRDDDKPDTVTQRLKAYETQTQPVLEFYRSKGVVKTFTGTETNKIWPHVEEFL 212          
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:101169712])

HSP 1 Score: 93.2041 bits (230), Expect = 7.927e-21
Identity = 60/199 (30.15%), Postives = 99/199 (49.75%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAE----LLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKD---HVVIDANQ 1402
            R ILLGP G+GK T A  + +KY +  +  GD++R  +A  ++ G  ++  ++    V D ++++LIE+ L    C   G+LL G+P +VKQAE    LLD  + + + V    V   + + R C R +   +G  YH  +NPP     +      + +   D+   ++ +L  Y+     L +YY     H  IDA Q
Sbjct:   19 RAILLGPPGAGKGTQAPRLAEKYCVCHLATGDMLRAMVASGSELGKRLKQTMDSGKLVSDEMVVELIEKNLDTAACKN-GFLLDGFPRTVKQAEMLDDLLDKRQEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDVTGEPLIRRSDDNETTLRSRLDAYHRQTAPLVQYYSARGIHTAIDAAQ 216          
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 59.6918 bits (143), Expect = 7.938e-10
Identity = 33/122 (27.05%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  842 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCER 1207
            I ++G  GSGK T    I  KY    ++ GDL+R  +A  +  G  +++ ++K   VP   ++ +I++ +      + G+L+ GYP  VKQ E  +    +P  + +++  S   ++R  +R
Sbjct:   17 IFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKR 138          
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Match: SMESG000027219.1 (SMESG000027219.1)

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 475/479 (99.16%), Postives = 477/479 (99.58%), Query Frame = 2
Query:   32 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIFQTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 1468
            MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIK+IAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRN+ALVKPLYDHVLHEINADQPLADIFQ VLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLER CERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN
Sbjct:    1 MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYLKKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIKEIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEVNDRLIKPEGSTAEEMNQKLANYHRNLALVKPLYDHVLHEINADQPLADIFQIVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERLCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDHVVIDANQELHNIFELVESYLVNPLPMKLN 479          
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Match: SMESG000061897.1 (SMESG000061897.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.662e-15
Identity = 47/148 (31.76%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  815 RLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPP 1258
            R  +L + + +++G  GSGK TI++ I K +SI  ++ GDL+R  +A++ + G+    ++     VPD ++  LI   +          L+ GYP +V+QA++LD  +   N V  L++P  V ++R  +R     +G  YHL +NPP
Sbjct:    3 RSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKY--KNENLLIDGYPRTVEQAKVLDKEE-TINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPP 147          
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 75.485 bits (184), Expect = 4.880e-15
Identity = 56/186 (30.11%), Postives = 94/186 (50.54%), Query Frame = 2
Query:  845 ILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNR----VFFLEVPSFVSLERQCERRLDPVT-GDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYK 1375
            ILLGPSGSGK T A  + +K+ I  ++ GD++R  ++  +  G  +   ++K   + D ++ +LI E L +  C   G++L G+P +V QAE LD    + N     V  L     + LER+   RL  +T G  YH  + PP    ++     ++ +   D++  +K  L  Y + +  L  YY+
Sbjct:   16 ILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRN-GFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHI-LERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLRSYRTEMEPLVCYYE 199          
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Match: SMESG000043841.1 (SMESG000043841.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.136e-14
Identity = 58/205 (28.29%), Postives = 107/205 (52.20%), Query Frame = 2
Query:  839 RIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLA--MRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDH----VVIDANQELHNIFELVES 1435
            ++ +LG   SGK+T+A    K+Y ++++  G  +R  + +     LA  ++SY+ K L VP  ++I+ IE  L N  C+T G++L GYPL+++Q  +++  K+ P+RVF L     VS  R+   R      D+  +    P++ S+            K+I  K+A Y++ + E++ +Y +       IDA +    ++E  +S
Sbjct: 1343 KVCILGLPKSGKTTLAERFVKEYGLLRITGGSALRTVLNENWNTELAKEIKSYLVKGLVVPHELVIKAIELLLMNSQCATKGYVLDGYPLAIEQIAMMNDKKIIPSRVFEL-----VSCPRELILR---ANKDRAGIELPFPMHDSS------------KIIAIKMANYSNNINEIRRWYGEEHDNIRSIDAEKGTWYLWEKTKS 1527          

HSP 2 Score: 63.5438 bits (153), Expect = 4.953e-10
Identity = 38/146 (26.03%), Postives = 78/146 (53.42%), Query Frame = 2
Query:  842 IILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSV-------KQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQY-HLSYNP 1255
             IL+G  G+G +T+A L   ++    +N  +LI + I  + + G  +++ +E    + + ++I LI +++ +   +  G+L+ G+P +        +Q  +L   K++P+ + +L++P      R   +RLDP TGD Y   +Y+P
Sbjct:   45 FILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDP 190          

HSP 3 Score: 52.373 bits (124), Expect = 1.317e-6
Identity = 40/153 (26.14%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  191 IDDVPRIFIL-GPPASGKHTIAKMLSGRLNCQLLNPVDVFS---ECDTDIKDIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPET-------REHVYALQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHAL-FDP 613
            ++  P  FIL G P +G  T+AK+      C+ +N  ++     E  T++    +  ++    I   + I  ++ + +  +   +G+++ GFP          E    L+   I P  ++ L  PD  L  R   +R+DPETGDVY    +DP
Sbjct:   38 LNSKPSCFILMGKPGAGSTTLAKLFIDEFQCEYINGKELIEQHIEGQTEVGKKLQTILEDGGLISEEMVIDLIRQKIESPEVAHRGYLIDGFPNANSTDVTIHEQFNILKSFKIQPDILIYLKIPDGDLKNRLLSQRLDPETGDVYFKQNYDP 190          
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 56.6102 bits (135), Expect = 6.808e-9
Identity = 52/220 (23.64%), Postives = 95/220 (43.18%), Query Frame = 2
Query:  812 ERLPALRTPRII-LLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYY-KDHVV--IDANQELHNIFELVESYLVNPLPM 1459
            E    L++ ++I +LG  GSGK T    I  KY    ++ GDL+RE +   ++ G  ++  +EK   V   +++ LI + +      ++G+L+ GYP  ++Q +  +   +    V    V   V   R  +R                          S    D+ + I  +L  +N     + ++Y K H    IDA+  +  IFE V +++++ L M
Sbjct:    8 EAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKR-----------------------GETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFEKV-THVIDKLHM 203          
The following BLAST results are available for this feature:
BLAST of adenylate kinase 8-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK82.429e-13042.74adenylate kinase 8 [Source:HGNC Symbol;Acc:HGNC:26... [more]
AK22.126e-2229.61adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK22.701e-2229.61adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK22.864e-2229.61adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK31.635e-2026.36adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
let-7548.784e-1928.02Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
let-7548.784e-1928.02Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
ZK673.21.330e-1727.67Probable adenylate kinase isoenzyme ZK673.2 [Sour... [more]
F38B2.43.837e-1224.06Adenylate kinase isoenzyme 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk26.466e-1926.48gene:FBgn0283494 transcript:FBtr0072163[more]
Adk32.908e-1725.60gene:FBgn0042094 transcript:FBtr0082331[more]
Adk32.908e-1725.60gene:FBgn0042094 transcript:FBtr0339379[more]
Adk32.908e-1725.60gene:FBgn0042094 transcript:FBtr0082330[more]
Adk32.908e-1725.60gene:FBgn0042094 transcript:FBtr0339378[more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak85.712e-12842.29adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
ak83.641e-12641.46adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
ak83.641e-12641.46adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
ak36.286e-2228.64adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.186e-2033.33adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rassf12.124e-12339.16Ras association domain family member 1 [Source:Xen... [more]
rassf17.226e-11538.95Ras association domain family member 1 [Source:Xen... [more]
rassf13.716e-11338.53Ras association domain family member 1 [Source:Xen... [more]
rassf13.745e-11138.32Ras association domain family member 1 [Source:Xen... [more]
ak26.177e-2330.32adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak81.345e-12339.25adenylate kinase 8 [Source:MGI Symbol;Acc:MGI:1916... [more]
Ak21.447e-2129.13adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak21.816e-2129.13adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak37.152e-2027.19adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860... [more]
Ak46.240e-1929.05adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of adenylate kinase 8-like vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5M7G4|KAD8_XENLA1.162e-13741.79Adenylate kinase 8 OS=Xenopus laevis OX=8355 GN=ak... [more]
sp|Q6P618|KAD8_XENTR1.389e-13341.47Adenylate kinase 8 OS=Xenopus tropicalis OX=8364 G... [more]
sp|Q96MA6|KAD8_HUMAN1.167e-12942.74Adenylate kinase 8 OS=Homo sapiens OX=9606 GN=AK8 ... [more]
sp|Q4R3W4|KAD8_MACFA3.747e-12842.26Adenylate kinase 8 OS=Macaca fascicularis OX=9541 ... [more]
sp|Q502L7|KAD8_DANRE2.870e-12541.25Adenylate kinase 8 OS=Danio rerio OX=7955 GN=ak8 P... [more]
back to top
BLAST of adenylate kinase 8-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203482246.325e-16047.60tr|A0A1S3K5Z5|A0A1S3K5Z5_LINUN adenylate kinase 8-... [more]
gnl|BL_ORD_ID|157372528.540e-15947.81tr|R7T860|R7T860_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|238614114.758e-15747.07tr|V3Z5F9|V3Z5F9_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|239016612.248e-15646.76tr|K1PRS8|K1PRS8_CRAGI Putative adenylate kinase-l... [more]
gnl|BL_ORD_ID|235259955.703e-15446.23tr|A0A210PLV5|A0A210PLV5_MIZYE Adenylate kinase 8 ... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak83.933e-12139.92adenylate kinase 8 [Source:NCBI gene;Acc:553671][more]
ak49.219e-2435.37adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak49.743e-2435.42adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak32.074e-2330.73adenylate kinase 3 [Source:NCBI gene;Acc:103033473... [more]
ak27.740e-2030.00adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004823.11.346e-820.65pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 ... [more]
ENSPMAT00000005320.11.653e-827.03pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gen... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ADK11.649e-2027.36Adenylate kinase, required for purine metabolism; ... [more]
ADK21.316e-1731.89Mitochondrial adenylate kinase; catalyzes the reve... [more]
URA64.640e-1021.53Uridylate kinase; catalyzes the seventh enzymatic ... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432718.516e-11539.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425832.742e-1828.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305501.758e-1628.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388637.029e-1224.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386915.182e-1130.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of adenylate kinase 8-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak85.076e-10937.71adenylate kinase 8 [Source:NCBI gene;Acc:101157866... [more]
ak42.659e-2328.91adenylate kinase 4 [Source:NCBI gene;Acc:101175146... [more]
ak34.898e-2129.58adenylate kinase 3 [Source:NCBI gene;Acc:101160331... [more]
ak27.927e-2130.15adenylate kinase 2 [Source:NCBI gene;Acc:101169712... [more]
ak17.938e-1027.05adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
back to top
BLAST of adenylate kinase 8-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027219.10.000e+099.16SMESG000027219.1[more]
SMESG000061897.11.662e-1531.76SMESG000061897.1[more]
SMESG000037481.14.880e-1530.11SMESG000037481.1[more]
SMESG000043841.12.136e-1428.29SMESG000043841.1[more]
SMESG000060686.16.808e-923.64SMESG000060686.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014791 ID=SMED30014791|Name=adenylate kinase 8-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2001bp
TTACCAAAAAAATTGATTATTAAATTTTATAATGGATGCTACTAAAAGAC
CAATTAAAATTTCTCCTGAATTAGTTAACTATGCTGAGAAGCATAAAATT
TTTGAAAATATGAAGAAACTTTTAGAATTATTAATAATTGATCGTCCCAT
AAATCCAATTAAATATCTAATCGAATACTTAAAGAAAGATATTGATGATG
TTCCAAGGATATTTATCTTGGGACCCCCGGCGTCTGGTAAACACACTATA
GCCAAAATGTTATCTGGTAGATTAAATTGTCAATTATTAAATCCAGTCGA
TGTTTTCTCAGAGTGTGACACTGACATCAAAGACATAGCAGAAGATTGTA
TAAAATATAAAAAACCTATTCCAGTAAATATCTGGATTCGGGGTTTGAAA
TTCCGCACGAAAATGTTTGATTGTGAGAAAAAAGGATGGGTTTTGTGTGG
ATTTCCAGAAACAAGAGAACACGTTTATGCACTTCAGTGCGAGGGGATTT
TCCCCACCCATGTTGTGCTCCTTACTGCCCCGGATTACGTTCTCATCGAA
CGAGCTGATGGAAAACGGATCGATCCGGAAACTGGCGACGTCTATCACGC
ACTTTTCGACCCAGCCACGAACTCAGAGGTAAACGATCGCCTAATAAAGC
CAGAAGGTTCCACTGCTGAAGAAATGAACCAGAAATTGGCAAATTACCAT
CGAAACATCGCTCTAGTAAAACCGTTATATGACCACGTTTTGCACGAGAT
AAATGCCGATCAACCATTGGCTGATATTTTCCAAACCGTTTTGGATTTCT
GCGTTAAACGAGAACGCTTACCAGCTCTAAGAACACCGAGAATTATCTTA
TTAGGACCATCCGGTTCAGGAAAATCCACAATAGCCAATTTGATTTGCAA
GAAATACAGCATAATGAAAGTGAATTGTGGAGATTTGATTCGAGAAGCAA
TTGCAGACGAAAACAAACATGGCTTAGCAATGCGCAGTTACGTGGAAAAG
AACCTGCCAGTTCCTGACTTCGTTCTCATACAACTCATCGAGGAAAGGCT
AACGAATCTCTGTTGTTCCACTTACGGCTGGCTTCTTTATGGATATCCGC
TGTCAGTAAAGCAGGCCGAACTTCTTGACTGCACGAAATTGGAACCAAAC
AGGGTGTTTTTCCTTGAAGTTCCGTCATTCGTCAGTTTGGAACGCCAGTG
CGAAAGGCGATTGGATCCTGTGACCGGGGATCAATACCATCTCAGCTACA
ATCCCCCGGTCAACCAATCAGCATTCAACCGGATGAGCAAGCACCCGAAG
GACGATGTGAAAGTCATCAAGCACAAATTGGCCGTGTATAATTCCACAGT
AATCGAACTGAAGGAATATTACAAAGATCATGTTGTAATCGATGCCAATC
AGGAACTCCACAACATTTTTGAACTTGTCGAATCGTATTTGGTCAATCCG
TTACCGATGAAGTTGAATTGAAATTTCAATTTATCAGGGAGATTAGATTG
CGACCTAAATATATTATGATTGGTTCTTTGATTTTTATTGGATTTAGCGT
GTTATTTACTCGTGTTATTGGAGTGCTGATCTTAAGGTTACAGATCGTTT
GCCAGATCATTTGTATTCTTTTAATGGACTTTCTACTTAATATTGATTAA
TATTACGTTGTTTTTCAAGCAGTGAAAGTAAATAAAAAAGGATTTATATA
GAGAAATTTAGGTAGAACGATAGAACGAAGATTGTCTTAAAATCGTTAAG
TTTTACAAATATTACTTTTACTGTTCCTTTTATTGTCTTCAAGTCTTCCA
TCTCTTCATGAATTAACTCTTATGTGACAAATGTCCACTACATATGGCTC
CGCCACAAACCGGAGCAACACCAATAAAGCCAGTGGTGAGGTATATGGGG
CTCGCGTGAGCACTTTGTTATTTTTTTTGATAATTTGCTAGCTTTTATTA
TCTATGGATTTTATTACAATTTATTCAAACATTTAATTTTATATGTAGCA
G
back to top

protein sequence of SMED30014791-orf-1

>SMED30014791-orf-1 ID=SMED30014791-orf-1|Name=SMED30014791-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MDATKRPIKISPELVNYAEKHKIFENMKKLLELLIIDRPINPIKYLIEYL
KKDIDDVPRIFILGPPASGKHTIAKMLSGRLNCQLLNPVDVFSECDTDIK
DIAEDCIKYKKPIPVNIWIRGLKFRTKMFDCEKKGWVLCGFPETREHVYA
LQCEGIFPTHVVLLTAPDYVLIERADGKRIDPETGDVYHALFDPATNSEV
NDRLIKPEGSTAEEMNQKLANYHRNIALVKPLYDHVLHEINADQPLADIF
QTVLDFCVKRERLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCG
DLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGW
LLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERQCERRLDPVTGD
QYHLSYNPPVNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYKDH
VVIDANQELHNIFELVESYLVNPLPMKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0006165nucleoside diphosphate phosphorylation
GO:0009142nucleoside triphosphate biosynthetic process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036193ADK_active_lid_dom_sf
IPR000850Adenylat/UMP-CMP_kin
IPR027417P-loop_NTPase
IPR007862Adenylate_kinase_lid-dom
Vocabulary: molecular function
TermDefinition
GO:0019205nucleobase-containing compound kinase activity
GO:0005524ATP binding
GO:0004017adenylate kinase activity
GO:0000166nucleotide binding
GO:0004127cytidylate kinase activity
GO:0004550nucleoside diphosphate kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 350..366
score: 42.07
coord: 300..314
score: 36.16
coord: 421..436
score: 26.06
coord: 272..285
score: 55.81
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 13..254
coord: 270..475
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 59..249
e-value: 1.0169E-28
score: 110.019
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 270..462
e-value: 9.75457E-50
score: 166.643
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 55..259
e-value: 1.7E-44
score: 153.9
NoneNo IPR availablePFAMPF00406ADKcoord: 273..450
e-value: 1.9E-26
score: 93.0
NoneNo IPR availablePFAMPF00406ADKcoord: 62..232
e-value: 3.2E-7
score: 30.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 260..472
e-value: 2.9E-54
score: 186.0
NoneNo IPR availablePANTHERPTHR23359:SF81ADENYLATE KINASE 8coord: 13..254
coord: 270..475
IPR036193Adenylate kinase, active site lid domain superfamilySUPERFAMILYSSF57774Microbial and mitochondrial ADK, insert "zinc finger" domaincoord: 392..418
IPR036193Adenylate kinase, active site lid domain superfamilySUPERFAMILYSSF57774Microbial and mitochondrial ADK, insert "zinc finger" domaincoord: 177..206
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 269..470
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 58..255