cGMP-dependent protein kinase

Overview
NamecGMP-dependent protein kinase
Smed IDSMED30014787
Length (bp)2801
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cGMP-dependent protein kinase (SMED30014787) t-SNE clustered cells

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30014787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cGMP-dependent protein kinase (SMED30014787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30014787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014787SMESG000016927.1 dd_Smed_v4_27739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014787SMESG000016927.1 dd_Smed_v4_27739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014787SMESG000016927.1 dd_Smed_v4_27739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30014787SMESG000016927.1 dd_Smed_v4_27739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014787SMESG000016927.1 dd_Smed_v4_27739_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30014787SMESG000016927.1 dd_Smed_v4_7139_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 395/621 (63.61%), Postives = 477/621 (76.81%), Query Frame = 2
Query:  662 RMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
            R KR AIS E   F     S   LP++ K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P +  E PPDD SGWD DF
Sbjct:   73 RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 391/616 (63.47%), Postives = 473/616 (76.79%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLKT---KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K+   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P +  E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 330/691 (47.76%), Postives = 452/691 (65.41%), Query Frame = 2
Query:  539 LNSSQNNQVLCYNCGAKLQLAYIYTDIEENNK-NGDFKLSNERMKRIAISGESGTFISSPEVLPYF-------EKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDL--------PKEILGPSKEYKNLAL------------------KDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            LN  Q+  V+    G+ LQ +     +E + K +G   L + R  +  +S E  T        P F        K    K+LI  ++ +N F+K L+  QIK +V+CM    +   S IIK+GE G+ ++V+ +G++ V +    L  +   T FGELAILYNCTRTA+V AIT+ K WA+DR  FQ+IM RT   + E+  NFL+SV + K+L E  L KI   LE  +Y  GDYIIR+G +G TFFI++ GKV+VT+  +  D   + Q I+ +Q+GE+FGEKAL  +D+R+ANIIA +   V CLV+DRE++ Q +G    LQ+  E  V +L         K  +   K  K L+L                  ++L +IATLG+GGFGRVELV++  N    +A+K ++K HIV+T+QQEH+ +E+ IL  + S FIV+L+RTFKD K++YML+E CLGGELWSILRDR +FDE T+KF  ACV EA  YLH  GI+YRDLKPENL+LD +G+ K+ DFGFAKKIG G+KTWTFCGTPEYVAPE+ILNKGHD   D WSLGIL++ELLTG PPF+  D M  YN+ILKGI+ ++FP+KI++  ++LI++LCR NP ER+G  K G+ + +KH WL  FNW+GL + ++  P+  ++  P D S FD+YPPE  MPPD++SGWD+DF
Sbjct:   79 LNKLQD--VVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHD---QPQLIKTLQKGEYFGEKALISDDVRSANIIAEE-NDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKV-KNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 330/691 (47.76%), Postives = 452/691 (65.41%), Query Frame = 2
Query:  539 LNSSQNNQVLCYNCGAKLQLAYIYTDIEENNK-NGDFKLSNERMKRIAISGESGTFISSPEVLPYF-------EKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDL--------PKEILGPSKEYKNLAL------------------KDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            LN  Q+  V+    G+ LQ +     +E + K +G   L + R  +  +S E  T        P F        K    K+LI  ++ +N F+K L+  QIK +V+CM    +   S IIK+GE G+ ++V+ +G++ V +    L  +   T FGELAILYNCTRTA+V AIT+ K WA+DR  FQ+IM RT   + E+  NFL+SV + K+L E  L KI   LE  +Y  GDYIIR+G +G TFFI++ GKV+VT+  +  D   + Q I+ +Q+GE+FGEKAL  +D+R+ANIIA +   V CLV+DRE++ Q +G    LQ+  E  V +L         K  +   K  K L+L                  ++L +IATLG+GGFGRVELV++  N    +A+K ++K HIV+T+QQEH+ +E+ IL  + S FIV+L+RTFKD K++YML+E CLGGELWSILRDR +FDE T+KF  ACV EA  YLH  GI+YRDLKPENL+LD +G+ K+ DFGFAKKIG G+KTWTFCGTPEYVAPE+ILNKGHD   D WSLGIL++ELLTG PPF+  D M  YN+ILKGI+ ++FP+KI++  ++LI++LCR NP ER+G  K G+ + +KH WL  FNW+GL + ++  P+  ++  P D S FD+YPPE  MPPD++SGWD+DF
Sbjct:   79 LNKLQD--VVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHD---QPQLIKTLQKGEYFGEKALISDDVRSANIIAEE-NDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKV-KNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 315/670 (47.01%), Postives = 441/670 (65.82%), Query Frame = 2
Query:  539 LNSSQNNQVLCYNCGAKLQLAYIYTDIEENNK-NGDFKLSNERMKRIAISGESGTFISSPEVLPYF-------EKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKK-----TYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            LN  Q+  V+    G+ LQ +     +E + K +G   L + R  +  +S E  T        P F        K    K+LI  ++ +N F+K L+  QIK +V+CM    +   S IIK+GE G+ ++V+ +G++ V +    L  +   T FGELAILYNCTRTA+V AIT+ K WA+DR  FQ+IM RT   + E+  NFL+SV + K+L E  L KI   LE  +Y  GDYIIR+G +G TFFI++ GKV+VT+  +  D   + Q I+ +Q+GE+FGEKAL  +D+R+ANIIA +   V CLV+DRE++ Q +G    LQ+  E  V +L ++     K +   ++ +  +   L +      E++Q+ + VK       +A+K ++K HIV+T+QQEH+ +E+ IL  + S FIV+L+RTFKD K++YML+E CLGGELWSILRDR +FDE T+KF  ACV EA  YLH  GI+YRDLKPENL+LD +G+ K+ DFGFAKKIG G+KTWTFCGTPEYVAPE+ILNKGHD   D WSLGIL++ELLTG PPF+  D M  YN+ILKGI+ ++FP+KI++  ++LI++LCR NP ER+G  K G+ + +KH WL  FNW+GL + ++  P+  ++  P D S FD+YPPE  MPPD++SGWD+DF
Sbjct:   79 LNKLQD--VVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHD---QPQLIKTLQKGEYFGEKALISDDVRSANIIAEE-NDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRD---DEKRHAKRSMSNWKLSKALSL------EMIQLKEKVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 329/627 (52.47%), Postives = 455/627 (72.57%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDG--VNDLPKEILGPSK-------EYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP-KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R K+IA+S E   F + P  L ++ K +  K++I+ ++ +NDF+K L + QI  +V+CM  ++  A   +I+EGE G  ++V+ +G++ VS+EG  L +M+  TV GELAILYNCTRTA+V A+TD +LW +DR  FQ I  R G+ ++ + +NFL  V IF++L E  + K++ V+++ +Y  G YIIRQG KGD FF+I+SG+V+VT++ +  +T  +E  IR + +G++FGE+AL  E++RTANIIA  P GV+ L LDRES+ +LIGDL SL++ Y D   +  + +E   P K       E+  + LK++  +ATLG+GGFGRVELV +  +  KT+ALK LKK HIV+TRQQEHI  ERNI+    +D+IV+L++TF+D+KF+YML+EVCLGGELW+ LRDR  FD+ T +FY ACV+E L YLH + IVYRDLKPEN LL N G+ K+ DFGFAKK+  GRKTWTFCGTPEYV+PEIILNKGHD  AD W+LGI + EL+ G PPF A DPMK Y +ILKG+DA+E P ++I K A  L+KKLCRDNP ER+G G GGV + +KH W   F+W+GL S T+KPPI+P++++P D +NFD YPP+ ++PPD+ SGWD  F
Sbjct:  127 QRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIE-GETEPRE--IRVLNQGDFFGERALLGEEVRTANIIAQAP-GVEVLTLDRESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 329/627 (52.47%), Postives = 455/627 (72.57%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDG--VNDLPKEILGPSK-------EYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP-KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R K+IA+S E   F + P  L ++ K +  K++I+ ++ +NDF+K L + QI  +V+CM  ++  A   +I+EGE G  ++V+ +G++ VS+EG  L +M+  TV GELAILYNCTRTA+V A+TD +LW +DR  FQ I  R G+ ++ + +NFL  V IF++L E  + K++ V+++ +Y  G YIIRQG KGD FF+I+SG+V+VT++ +  +T  +E  IR + +G++FGE+AL  E++RTANIIA  P GV+ L LDRES+ +LIGDL SL++ Y D   +  + +E   P K       E+  + LK++  +ATLG+GGFGRVELV +  +  KT+ALK LKK HIV+TRQQEHI  ERNI+    +D+IV+L++TF+D+KF+YML+EVCLGGELW+ LRDR  FD+ T +FY ACV+E L YLH + IVYRDLKPEN LL N G+ K+ DFGFAKK+  GRKTWTFCGTPEYV+PEIILNKGHD  AD W+LGI + EL+ G PPF A DPMK Y +ILKG+DA+E P ++I K A  L+KKLCRDNP ER+G G GGV + +KH W   F+W+GL S T+KPPI+P++++P D +NFD YPP+ ++PPD+ SGWD  F
Sbjct:  127 QRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIE-GETEPRE--IRVLNQGDFFGERALLGEEVRTANIIAQAP-GVEVLTLDRESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 329/627 (52.47%), Postives = 455/627 (72.57%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDG--VNDLPKEILGPSK-------EYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP-KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R K+IA+S E   F + P  L ++ K +  K++I+ ++ +NDF+K L + QI  +V+CM  ++  A   +I+EGE G  ++V+ +G++ VS+EG  L +M+  TV GELAILYNCTRTA+V A+TD +LW +DR  FQ I  R G+ ++ + +NFL  V IF++L E  + K++ V+++ +Y  G YIIRQG KGD FF+I+SG+V+VT++ +  +T  +E  IR + +G++FGE+AL  E++RTANIIA  P GV+ L LDRES+ +LIGDL SL++ Y D   +  + +E   P K       E+  + LK++  +ATLG+GGFGRVELV +  +  KT+ALK LKK HIV+TRQQEHI  ERNI+    +D+IV+L++TF+D+KF+YML+EVCLGGELW+ LRDR  FD+ T +FY ACV+E L YLH + IVYRDLKPEN LL N G+ K+ DFGFAKK+  GRKTWTFCGTPEYV+PEIILNKGHD  AD W+LGI + EL+ G PPF A DPMK Y +ILKG+DA+E P ++I K A  L+KKLCRDNP ER+G G GGV + +KH W   F+W+GL S T+KPPI+P++++P D +NFD YPP+ ++PPD+ SGWD  F
Sbjct:  127 QRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIE-GETEPRE--IRVLNQGDFFGERALLGEEVRTANIIAQAP-GVEVLTLDRESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 329/627 (52.47%), Postives = 455/627 (72.57%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDG--VNDLPKEILGPSK-------EYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP-KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R K+IA+S E   F + P  L ++ K +  K++I+ ++ +NDF+K L + QI  +V+CM  ++  A   +I+EGE G  ++V+ +G++ VS+EG  L +M+  TV GELAILYNCTRTA+V A+TD +LW +DR  FQ I  R G+ ++ + +NFL  V IF++L E  + K++ V+++ +Y  G YIIRQG KGD FF+I+SG+V+VT++ +  +T  +E  IR + +G++FGE+AL  E++RTANIIA  P GV+ L LDRES+ +LIGDL SL++ Y D   +  + +E   P K       E+  + LK++  +ATLG+GGFGRVELV +  +  KT+ALK LKK HIV+TRQQEHI  ERNI+    +D+IV+L++TF+D+KF+YML+EVCLGGELW+ LRDR  FD+ T +FY ACV+E L YLH + IVYRDLKPEN LL N G+ K+ DFGFAKK+  GRKTWTFCGTPEYV+PEIILNKGHD  AD W+LGI + EL+ G PPF A DPMK Y +ILKG+DA+E P ++I K A  L+KKLCRDNP ER+G G GGV + +KH W   F+W+GL S T+KPPI+P++++P D +NFD YPP+ ++PPD+ SGWD  F
Sbjct:  158 QRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIE-GETEPRE--IRVLNQGDFFGERALLGEEVRTANIIAQAP-GVEVLTLDRESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 329/627 (52.47%), Postives = 455/627 (72.57%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDG--VNDLPKEILGPSK-------EYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP-KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R K+IA+S E   F + P  L ++ K +  K++I+ ++ +NDF+K L + QI  +V+CM  ++  A   +I+EGE G  ++V+ +G++ VS+EG  L +M+  TV GELAILYNCTRTA+V A+TD +LW +DR  FQ I  R G+ ++ + +NFL  V IF++L E  + K++ V+++ +Y  G YIIRQG KGD FF+I+SG+V+VT++ +  +T  +E  IR + +G++FGE+AL  E++RTANIIA  P GV+ L LDRES+ +LIGDL SL++ Y D   +  + +E   P K       E+  + LK++  +ATLG+GGFGRVELV +  +  KT+ALK LKK HIV+TRQQEHI  ERNI+    +D+IV+L++TF+D+KF+YML+EVCLGGELW+ LRDR  FD+ T +FY ACV+E L YLH + IVYRDLKPEN LL N G+ K+ DFGFAKK+  GRKTWTFCGTPEYV+PEIILNKGHD  AD W+LGI + EL+ G PPF A DPMK Y +ILKG+DA+E P ++I K A  L+KKLCRDNP ER+G G GGV + +KH W   F+W+GL S T+KPPI+P++++P D +NFD YPP+ ++PPD+ SGWD  F
Sbjct:  158 QRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIE-GETEPRE--IRVLNQGDFFGERALLGEEVRTANIIAQAP-GVEVLTLDRESFGKLIGDLESLKKDYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 375/621 (60.39%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E     + +      P ++K  +++ELIK +IL+NDFMKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:  128 QRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 742          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 375/621 (60.39%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E     + +      P ++K  +++ELIK +IL+NDFMKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:  474 QRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 375/621 (60.39%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E     + +      P ++K  +++ELIK +IL+NDFMKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:  474 QRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089304)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 375/621 (60.39%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E     + +      P ++K  +++ELIK +IL+NDFMKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:  474 QRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473363)

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 360/574 (62.72%), Postives = 451/574 (78.57%), Query Frame = 2
Query:  791 MKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            MKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:    1 MKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 568          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 396/623 (63.56%), Postives = 482/623 (77.37%), Query Frame = 2
Query:  656 NERMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            ++R KR AIS E   F     S   LP++ K  ++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++   S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L+E  L K++ VLEETHY++G+YIIRQG +GDTFFIIS GKV VTR++ P+ T     ++R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DRES+  LIG L  +  + Y+D       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   69 HQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGT---PVYLRALGKGDWFGEKALQGEDIRTANVIAAE--AVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYE--AENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 387/600 (64.50%), Postives = 470/600 (78.33%), Query Frame = 2
Query:  716 EVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            E L    K +++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++   S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L+E  L K++ VLEETHY++G+YIIRQG +GDTFFIIS GKV VTR++ P+ T     ++R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DRES+  LIG L  +  + Y+D       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   77 EALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGT---PVYLRALGKGDWFGEKALQGEDIRTANVIAAE--AVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYE--AENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 669          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 387/622 (62.22%), Postives = 465/622 (74.76%), Query Frame = 2
Query:  650 LSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            LSN+  +R+A S  S                   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV +  NS IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  ++  KLWAIDR  FQ+IMMRTGL+K+ E +  LKSV  F+ L E  L K++ VLEETHY +G+YIIRQG +GDTFFIIS GKV +TR++ P    ++  ++R M RG+ FGEKAL+ ED+RTAN+IAA+   V CLV+DR+SY  LIG L  +  +  ED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR  FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRD P+ER+G  K GVK+ QKH W E FNWDGL   T+ PPI+P + S TD SNFD +P + E  PPDD SGWD DF
Sbjct:   72 LSNQSFRRVAKSDRS-------------------KDLIKSAILDNDFMKNLEMSQIQEIVDCMYPVDYDKNSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVRTVSSVKLWAIDRQCFQTIMMRTGLIKHAEYMELLKSVLTFRGLPEEILSKLADVLEETHYEDGNYIIRQGARGDTFFIISKGKVTMTREDCP---GQEPVYLRSMGRGDSFGEKALQGEDIRTANVIAAET--VTCLVIDRDSYKHLIGGLEDVSNKGCEDAEAKAKYE--AENAFFSNLNLSDFNIIDTLGVGGFGRVELVQLKSDEMKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGNFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWDGLRKGTLMPPIIPNVTSSTDTSNFDSFPEDNEDPPPDDNSGWDIDF 667          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 364/600 (60.67%), Postives = 443/600 (73.83%), Query Frame = 2
Query:  716 EVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            E L    K +++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++   S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR S  + +              + S P                  +THY++G+YIIRQG +GDTFFIIS GKV VTR++ P+ T     ++R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DRES+  LIG L  +  + Y+D       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   77 EALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQSLTAFIS-------------IHSSPT----------------PDTHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGT---PVYLRALGKGDWFGEKALQGEDIRTANVIAAE--AVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYE--AENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 640          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: CR925795.1 (protein kinase cGMP-dependent 1b [Source:NCBI gene;Acc:566430])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 284/442 (64.25%), Postives = 347/442 (78.51%), Query Frame = 2
Query: 1190 LEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            L  THY++G+YIIRQG +GDTFFIIS GKV VTR++ P+ T     ++R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DRES+  LIG L  +  + Y+D       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   14 LINTHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGT---PVYLRALGKGDWFGEKALQGEDIRTANVIAAE--AVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYE--AENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 448          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 400/636 (62.89%), Postives = 486/636 (76.42%), Query Frame = 2
Query:  620 EENNKNGDFKLSNERMKRIAISGESGTFISSPEV----LPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            ++ +K     L  +R KR AIS E  T I   E+    LP++ K  ++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  + K++ VLEETHY +GDYIIRQG +GDTFFIIS GKV VTR++ P    E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   58 QQVHKQNPTTLGEQRTKRQAISAEP-TAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSP---GEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 400/636 (62.89%), Postives = 486/636 (76.42%), Query Frame = 2
Query:  620 EENNKNGDFKLSNERMKRIAISGESGTFISSPEV----LPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            ++ +K     L  +R KR AIS E  T I   E+    LP++ K  ++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  + K++ VLEETHY +GDYIIRQG +GDTFFIIS GKV VTR++ P    E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   58 QQVHKQNPTTLGEQRTKRQAISAEP-TAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSP---GEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 392/617 (63.53%), Postives = 474/617 (76.82%), Query Frame = 2
Query:  677 AISGESGTFIS----SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
             IS E  +F S    + +    F K  ++KELIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  + K++ VLEETHY +GDYIIRQG +GDTFFIIS GKV VTR++ P    E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:   64 GISAEPQSFRSYHDLTRQAFKKFTKSERSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSP---GEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 673          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: ptafr (platelet activating factor receptor [Source:Xenbase;Acc:XB-GENE-968925])

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 311/616 (50.49%), Postives = 421/616 (68.34%), Query Frame = 2
Query:  737 KHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLP--------------KEILGPSKEYKNL-----------ALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            K+   K LI  ++ +N FMK ++  QI+ +V+CM    +     II++GE GS ++V+ DGK  V +E   L  +   T FGELAILYNCTRTA+V AIT  + WA+DR  FQ+IM +T   K+EE L+FLKSVP+ K+L E  L KI+  LE   Y   DYIIR+G +G TFFIIS GKV+VT+     +  ++ Q+I+ +++G++FGEKAL  +D+R+ANI+A     V+CLV+DRE++ + +G    L +  E  V +L               + +   S E   +             ++L ++ TLG+GGFGRVELV++  N    +ALK +KK HIV+ RQQEHI +E+NIL    S FIV+L+ TFKD K++YML+E CLGGELWSILRDR +FDE T KF T CV EA  YLH +G++YRDLKPENLLLD++G+ K+ DFGFAKKI  G+KTWTFCGTPEYVAPE+ILNKGH    D WSLGIL++ELLTG PPFT PD M IYN+IL+GI+ IEF K I+K  ++LI++LCR+NP ER+G  K G+ + +KH W   FNW+GL + ++  P+ P++  PTD S FD YPP+ E+PPD++SGWD+DF
Sbjct:  177 KNTSEKILISDALNKNQFMKRMDHHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKHEEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVTQST---EGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDR-VECLVMDRETFNKTVGTYEELMKCLEGYVANLTLDDERRHAKSPVNERHLRAVSMELNKMKQTLARFPSASPFENLEIVTTLGVGGFGRVELVKV-KNENLVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKLYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPENLLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKNITKRPEDLIRRLCRENPAERLGNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEVSGWDQDF 787          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 296/460 (64.35%), Postives = 359/460 (78.04%), Query Frame = 2
Query: 1136 VPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            VP F+ L E  + K++ VLEETHY +GDYIIRQG +GDTFFIIS GKV VTR++ P    E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P + E  PPDD SGWD DF
Sbjct:    4 VPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSP---GEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 456          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 394/621 (63.45%), Postives = 479/621 (77.13%), Query Frame = 2
Query:  662 RMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
            R KR AIS E   F     S   LP++ K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L +  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G+V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P ++ E PPDD SGWD DF
Sbjct:   73 RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 390/616 (63.31%), Postives = 475/616 (77.11%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLKT---KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K+   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L +  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G+V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P ++ E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 328/691 (47.47%), Postives = 451/691 (65.27%), Query Frame = 2
Query:  539 LNSSQNNQVLCYNCGAKLQLAYIYTDIEENNK-NGDFKLSNERMKRIAISGESGTFISSPEVLPYF-------EKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDL--------PKEILGPSKEYKNLAL------------------KDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            LN  Q+  V+    G+ LQ +     ++ + K +G   L + R  +  +S E  T        P F        K    K+LI  ++ +N F+K L+  QIK +V+CM    +   S +IK+GE G+ ++V+ +G++ V +    L  +   T FGELAILYNCTRTA+V AIT+ K WA+DR  FQ+IM RT   + EE  NFL+SV + K+L E  L KI   LE  +Y  GDYIIR+G +G TFFI++ GKV+VT+  +  D   + Q I+ +Q+GE+FGEKAL  +D+R+ANIIA +   V CLV+DRE++ Q +G    LQ+  E  V  L         K  +   K  K L+L                  ++L +IATLG+GGFGRVELV++  N    +A+K ++K HIV+T+QQEH+ +E+ IL  + S FIV+L+RTFKD K++YML+E CLGGELWSILRDR +FDE T+KF  ACV EA  YLH  GI+YRDLKPENL+LD  G+ K+ DFGFAKKIG G+KTWTFCGTPEYVAPE+ILNKGHD   D WSLGIL++ELLTG PPF+  D M  YN+ILKGI+ ++FP+KI++  ++LI++LCR NP ER+G  K G+ + +KH WL  FNW+GL + ++  P+  +++ P D S FD+YPPE  +PPD++SGWD+DF
Sbjct:   79 LNKLQD--VIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHD---QPQLIKTLQKGEYFGEKALISDDVRSANIIAEE-NDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKV-KNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 313/670 (46.72%), Postives = 439/670 (65.52%), Query Frame = 2
Query:  539 LNSSQNNQVLCYNCGAKLQLAYIYTDIEENNK-NGDFKLSNERMKRIAISGESGTFISSPEVLPYF-------EKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKK-----TYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            LN  Q+  V+    G+ LQ +     ++ + K +G   L + R  +  +S E  T        P F        K    K+LI  ++ +N F+K L+  QIK +V+CM    +   S +IK+GE G+ ++V+ +G++ V +    L  +   T FGELAILYNCTRTA+V AIT+ K WA+DR  FQ+IM RT   + EE  NFL+SV + K+L E  L KI   LE  +Y  GDYIIR+G +G TFFI++ GKV+VT+  +  D   + Q I+ +Q+GE+FGEKAL  +D+R+ANIIA +   V CLV+DRE++ Q +G    LQ+  E  V  L ++     K +   ++    +   L +      E++Q+ + VK       +A+K ++K HIV+T+QQEH+ +E+ IL  + S FIV+L+RTFKD K++YML+E CLGGELWSILRDR +FDE T+KF  ACV EA  YLH  GI+YRDLKPENL+LD  G+ K+ DFGFAKKIG G+KTWTFCGTPEYVAPE+ILNKGHD   D WSLGIL++ELLTG PPF+  D M  YN+ILKGI+ ++FP+KI++  ++LI++LCR NP ER+G  K G+ + +KH WL  FNW+GL + ++  P+  +++ P D S FD+YPPE  +PPD++SGWD+DF
Sbjct:   79 LNKLQD--VIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHD---QPQLIKTLQKGEYFGEKALISDDVRSANIIAEE-NDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRD---DEKRHAKRSMSSWKLSKALSL------EMIQLKEKVKVKNENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 482.641 bits (1241), Expect = 6.818e-163
Identity = 235/381 (61.68%), Postives = 285/381 (74.80%), Query Frame = 2
Query: 1373 LKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
            + +ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCR                     W E FNW+GL   T+ PPI+P + SPTD SNFD +P ++ E PPDD SGWD DF
Sbjct:   27 ISEEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCR---------------------WFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 382          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P00516|KGP1_BOVIN (cGMP-dependent protein kinase 1 OS=Bos taurus OX=9913 GN=PRKG1 PE=1 SV=2)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 393/616 (63.80%), Postives = 474/616 (76.95%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLKT---KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K+   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY NG+YIIRQG +GDTFFIIS GKV VTR++ P   NE   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P +  E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSP---NEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|P0C605|KGP1_MOUSE (cGMP-dependent protein kinase 1 OS=Mus musculus OX=10090 GN=Prkg1 PE=1 SV=1)

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 390/616 (63.31%), Postives = 475/616 (77.11%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLKT---KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K+   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L +  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G+V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P ++ E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q13976|KGP1_HUMAN (cGMP-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PRKG1 PE=1 SV=3)

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 391/616 (63.47%), Postives = 473/616 (76.79%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLKT---KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K+   K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY NG+YIIRQG +GDTFFIIS G V VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P +  E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSP---SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O77676|KGP1_RABIT (cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=PRKG1 PE=1 SV=3)

HSP 1 Score: 790.415 bits (2040), Expect = 0.000e+0
Identity = 389/616 (63.15%), Postives = 471/616 (76.46%), Query Frame = 2
Query:  677 AISGESGTFISSPEVLPYFEKHLK---TKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPET-EMPPDDISGWDRDF 2509
             IS E  T+ S  ++   F K  K   +K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSL YVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  + + KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY N +Y IRQG +GDTFFIIS GKV VTR++ P   +E   F+R + +G+WFGEKAL+ ED+RTAN+IAA+   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SPTD SNFD +P +  E PPDD SGWD DF
Sbjct:   63 GISAEPQTYRSFHDLRQAFRKFTKFERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLAYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENEEYSIRQGARGDTFFIISKGKVNVTREDSP---SEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAE--AVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE--AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDGFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q03043|KGP24_DROME (cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 375/621 (60.39%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E     + +      P ++K  +++ELIK +IL+NDFMKNL+ +QI+ IVDCM PVK+ A ++IIKEG+VGS+VYVMEDG+V VS+EG +L  +    V GELAILYNC RTAT+TAIT+C LWAI+R  FQ+IMMRTGL++  E  +FLKSVPIFKDL E TL KIS VLEETHY  GDYI+RQG +GDTFFIIS GKV+VT K +  DT E E+FIR + +G++FGEKAL+ +DLRTANII     GV CLV+DRE++ QLI +L  ++  Y+D      ++I   ++E++++ L DL VIATLG+GGFGRVELVQ   +  +++ALKQ+KK  IVETRQQ+HIM+E+ I+      FIV+L +TFKD+K+LYMLME CLGGELW+ILRD+  FD++TT+FYTACV+EA  YLHSR I+YRDLKPENLLL+ +G+ K+ DFGFAKK+  GRKTWTFCGTPEYVAPE+ILN+GHD  AD WSLG+LMFELLTG PPFT  DPM+ YNIILKGIDAIEFP+ I+++A NLIKKLCRDNP ER+GY +GG+ E QKH W + F W GL + T++PPI P + S  D +NF D  P     PPDD++GWD+DF
Sbjct:  474 QRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQ--DTQE-EKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKI---NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A267FLY4 (cGMP-dependent protein kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030852g1 PE=3 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 404/617 (65.48%), Postives = 491/617 (79.58%), Query Frame = 2
Query:  662 RMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSK-EGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            R KR+AISGES    ++  V P  EK  +T++LI+R+ILEN FMKNLE +QI  I+D M P+    N++IIK GE+GSLVYVME+G   V+  +G  + E+ + TVFGELAILYNC RTATV A+T+CKLWAIDR +FQSIMM+TGLLK++E + FLKSVP FK+L   TL K++ VLE  HY NG+YIIRQG KG+TF+II+ G V+VT++   D    +  FIR M RG+WFGEKAL +ED+RTANII  DP GVDCLVL+RESY QLIGDL  L R Y D     P      S+E+K L LKDL +IATLG+GGFGRVELV+I ++  +++ALKQLKKHHIVETRQQEHIMNER+IL     DFIV+L+RTFKDRK+LYMLME CLGGELW+ILRD+  FD++TT+FY  CV+EAL YLH +GIVYRDLKPENLLLD  G+CKITDFGFAK+IGFG+KTWTFCGTPEYV PE+ILNKGHD  AD WSLG+LMFELLTG PPFTA DPMK YNIILKGIDA++FP++IS++AQNL+KKLCRDNP ER+G G+GGV E  KH+W E FNW G+ S T+ PPI+P+++S  D SNFDEYP + E PPDD+SGWD+DF
Sbjct:   78 RTKRVAISGESSAEFANSNVKPC-EKSTRTRDLIRRAILENAFMKNLENAQISEIIDYMYPMTHKTNALIIKLGEIGSLVYVMEEGSAEVTNTKGDKINEIGSGTVFGELAILYNCKRTATVKALTNCKLWAIDRQTFQSIMMKTGLLKHKEYMEFLKSVPAFKELPGETLSKLADVLEADHYPNGEYIIRQGAKGNTFYIIAKGNVRVTKR---DSATGESVFIRNMGRGDWFGEKALNEEDVRTANIIVEDPNGVDCLVLNRESYKQLIGDLAILGRKYSDESTAQPSR----SEEFKGLTLKDLFIIATLGVGGFGRVELVRIRNDNSRSFALKQLKKHHIVETRQQEHIMNERSILADANCDFIVKLYRTFKDRKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYIGCVVEALQYLHRKGIVYRDLKPENLLLDTTGYCKITDFGFAKRIGFGKKTWTFCGTPEYVPPEVILNKGHDLTADFWSLGVLMFELLTGTPPFTASDPMKTYNIILKGIDAVDFPRRISRNAQNLVKKLCRDNPTERLGVGRGGVMEVSKHIWFEGFNWAGMNSKTLTPPILPKVSSAVDASNFDEYPADNEHPPDDVSGWDKDF 686          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: V3ZX54 (cGMP-dependent protein kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210612 PE=3 SV=1)

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 408/622 (65.59%), Postives = 498/622 (80.06%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFISSPEVL----PYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            ER KR AIS E   F ++  VL     +  K L +KELI+++IL+NDFMKNLE  QI+ IV+CM PV+F  +SIIIKEG+VGSLVYVMEDGKV V+K+G  L  M    VFGELAILYNCTRTA+V A+  C+LWAIDR  FQSIMMRTGL ++ E+L FL+SVP F  L E TLGKI+ VLEE HY NG+YIIRQG +GD+F+II+ GKV+VT+++     + +E  +R +Q+G++FGE+AL+ ED+RTANIIA DP GVDCL +DRE+Y QLI +L  L+R YED      +E LG   EY  + L DL V++TLG+GGFGRVELVQI ++  K YALK LKKHHIVETRQQEHIMNE+ I+   +  FIVRLHRTF+DRK+LYML+E CLGGELW++LRD+ +FD+NTT+FYTACV+EA +YLHSRGIVYRDLKPENLL+D+ G+ K+ DFGFAKK+G GRKTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF  PDPMK YN+ILKGIDAI+FP+KI+K+AQ LIKKLCRDNP ER+GYG+GG++E QKH W E FNWDGL + ++KPPI+P I SPTD SNFD+YP + +  PPDD+SGWD+DF
Sbjct:   73 ERSKRTAISAEPANF-NTFHVLDSETQFVAKSLSSKELIRQAILDNDFMKNLELGQIREIVECMYPVEFTKDSIIIKEGDVGSLVYVMEDGKVEVTKDGQKLCTMSPGKVFGELAILYNCTRTASVKALQACRLWAIDRPCFQSIMMRTGLQRHSEHLEFLRSVPTFDGLPEETLGKIADVLEEAHYNNGEYIIRQGARGDSFYIIAKGKVRVTKRSS---KSHEEVTMRYLQKGDFFGERALQGEDVRTANIIAHDPDGVDCLTIDREAYSQLISNLDDLKRIYEDD-----EEKLGIDSEYAKIKLSDLHVLSTLGVGGFGRVELVQINNDNSKAYALKILKKHHIVETRQQEHIMNEKRIMSEARCAFIVRLHRTFRDRKYLYMLLESCLGGELWTVLRDKGSFDDNTTRFYTACVVEAFNYLHSRGIVYRDLKPENLLMDSTGYVKLVDFGFAKKVGHGRKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFAGPDPMKTYNLILKGIDAIDFPRKITKNAQILIKKLCRDNPLERLGYGRGGIREIQKHTWFEGFNWDGLRNRSMKPPIIPVIKSPTDTSNFDDYPEDEDGPPPDDLSGWDKDF 685          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A267FPA9 (cGMP-dependent protein kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003256g1 PE=3 SV=1)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 397/623 (63.72%), Postives = 490/623 (78.65%), Query Frame = 2
Query:  659 ERMKRIAISGESG-----TFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSK-EGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E       + +S+ +++P   K   T++LI+R+ILEN FMKNLE +QI  I+D M P+    N++IIK GE+GSLVYVME+G   V+  +G  + E+ + TVFGELAILYNC RTATV A+++CKLWAIDR +FQSIMM+TGLLK++E + FLKSVP FK+L   TL K++ VLE  HY NG+YIIRQG KG+TF+II+ G V+VT++   D    +  FIR M RG+WFGEKAL +ED+RTANII  DP GVDCLVL+RESY QLIGDL  L R Y D     P      S+E+K L LKDL +IATLG+GGFGRVELV+I ++  +++ALKQLKKHHIVETRQQEHIMNER+IL     DFIV+L+RTFKDRK+LYMLME CLGGELW+ILRD+  FD++TT+FY  CV+EAL YLH +GIVYRDLKPENLLLD  G+CKITDFGFAK+IGFG+KTWTFCGTPEYV PE+ILNKGHD  AD WSLG+LMFELLTG PPFTA DPMK YNIILKGIDA++FP++IS++AQNL+KKLCRDNP ER+G G+GGV E  KH+W E FNW G+ S T+ PPI+P+++S  D SNFDEYP + E PPDD+SGWD+DF
Sbjct:   95 KRQRGVGISAEPQNEQLVSQMSTGKIVP---KDAGTRDLIRRAILENAFMKNLENAQISEIIDYMYPMTHKTNALIIKLGEIGSLVYVMEEGSAEVTNTKGDKINEIGSGTVFGELAILYNCKRTATVKALSNCKLWAIDRQTFQSIMMKTGLLKHKEYMEFLKSVPAFKELPGETLSKLADVLEADHYPNGEYIIRQGAKGNTFYIIAKGNVRVTKR---DSATGESVFIRNMGRGDWFGEKALNEEDVRTANIIVEDPNGVDCLVLNRESYKQLIGDLAILGRKYSDESTAQPSR----SEEFKGLTLKDLFIIATLGVGGFGRVELVRIRNDNSRSFALKQLKKHHIVETRQQEHIMNERSILAEANCDFIVKLYRTFKDRKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYIGCVVEALQYLHRKGIVYRDLKPENLLLDTTGYCKITDFGFAKRIGFGKKTWTFCGTPEYVPPEVILNKGHDLTADFWSLGVLMFELLTGTPPFTASDPMKTYNIILKGIDAVDFPRRISRNAQNLVKKLCRDNPTERLGVGRGGVMEVSKHIWFEGFNWAGMNSKTLTPPILPKVSSAVDASNFDEYPADNEHPPDDVSGWDKDF 707          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A267GV06 (cGMP-dependent protein kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011874g1 PE=3 SV=1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 397/623 (63.72%), Postives = 490/623 (78.65%), Query Frame = 2
Query:  659 ERMKRIAISGESG-----TFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSK-EGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +R + + IS E       + +S+ +++P   K   T++LI+R+ILEN FMKNLE +QI  I+D M P+    N++IIK GE+GSLVYVME+G   V+  +G  + E+ + TVFGELAILYNC RTATV A+++CKLWAIDR +FQSIMM+TGLLK++E + FLKSVP FK+L   TL K++ VLE  HY NG+YIIRQG KG+TF+II+ G V+VT++   D    +  FIR M RG+WFGEKAL +ED+RTANII  DP GVDCLVL+RESY QLIGDL  L R Y D     P      S+E+K L LKDL +IATLG+GGFGRVELV+I ++  +++ALKQLKKHHIVETRQQEHIMNER+IL     DFIV+L+RTFKDRK+LYMLME CLGGELW+ILRD+  FD++TT+FY  CV+EAL YLH +GIVYRDLKPENLLLD  G+CKITDFGFAK+IGFG+KTWTFCGTPEYV PE+ILNKGHD  AD WSLG+LMFELLTG PPFTA DPMK YNIILKGIDA++FP++IS++AQNL+KKLCRDNP ER+G G+GGV E  KH+W E FNW G+ S T+ PPI+P+++S  D SNFDEYP + E PPDD+SGWD+DF
Sbjct:   95 KRQRGVGISAEPQNEQLVSQMSTGKIVP---KDAGTRDLIRRAILENAFMKNLENAQISEIIDYMYPMTHKTNALIIKLGEIGSLVYVMEEGSAEVTNTKGDKINEIGSGTVFGELAILYNCKRTATVKALSNCKLWAIDRQTFQSIMMKTGLLKHKEYMEFLKSVPAFKELPGETLSKLADVLEADHYPNGEYIIRQGAKGNTFYIIAKGNVRVTKR---DSATGESVFIRNMGRGDWFGEKALNEEDVRTANIIVEDPNGVDCLVLNRESYKQLIGDLAILGRKYSDESTAQPTR----SEEFKGLTLKDLFIIATLGVGGFGRVELVRIRNDNSRSFALKQLKKHHIVETRQQEHIMNERSILAEANCDFIVKLYRTFKDRKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYIGCVVEALQYLHRKGIVYRDLKPENLLLDTTGYCKITDFGFAKRIGFGKKTWTFCGTPEYVPPEVILNKGHDLTADFWSLGVLMFELLTGTPPFTASDPMKTYNIILKGIDAVDFPRRISRNAQNLVKKLCRDNPTERLGVGRGGVMEVSKHIWFEGFNWAGMNSKTLTPPILPKVSSAVDASNFDEYPADNEHPPDDVSGWDKDF 707          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: K1QUW8 (cGMP-dependent protein kinase OS=Crassostrea gigas OX=29159 GN=CGI_10021856 PE=3 SV=1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 402/625 (64.32%), Postives = 501/625 (80.16%), Query Frame = 2
Query:  653 SNERMKRIAISGESGTFISSPEVLPYFE-----KHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNF-DEYPPETEMPPDDISGWDRDF 2509
            S +R+KR AIS ES    +S ++L  ++     K   +++LI+ +IL+NDFMKNL+  QI+ IVDCM PV +  +S+IIKEG+VGSLVYVME+GKV V+K+G  L  M    VFGELAILYNCTRTA+V A+ +CKLWAIDR  FQSIMMRTGL+++EE+++FL+SVP FK L E  + KI+ VLEE HY NG+YIIRQG +GDTF+II+ GKV+VTR++        EQ IR +Q+GE+FGE+AL+ ED+RTA+I+AADP GV+CLV+DRESY+QLI DL  L+R YED   D  K +    +E+  L L DL ++ATLG+GGFGRVELVQ+ ++  +T+ALK LKKHHIVETRQQEHIMNE+ I+   +SDFIVRL+RTFKDRK+LYML+EVCLGGELW++LRD+ +FD+ TT+FYT CVIEA  YLH++GIVYRDLKPENLLLD+QG+ K+ DFGFAKK+G GRKTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF+  DPMK YNIILKGIDAI+F +KISK+AQNLIKKLCR+ P++R+G+G+GG++E QKH W E FNWDGL   T+KPPI PQ+ S TD SNF D    E + PPDD++GWDRDF
Sbjct:   76 SRDRIKRTAISAESP---NSSQILATYKTVKVPKSNDSRDLIRSAILDNDFMKNLDMGQIREIVDCMYPVDYTKDSLIIKEGDVGSLVYVMEEGKVEVTKDGQKLCTMGPAKVFGELAILYNCTRTASVKALVNCKLWAIDRPCFQSIMMRTGLMRHEEHMDFLRSVPTFKHLPEELVSKIADVLEEAHYNNGEYIIRQGARGDTFYIIAKGKVKVTRRHSK---TGDEQLIRCLQKGEFFGERALQGEDVRTASIVAADPTGVECLVIDRESYLQLISDLDELKRVYED---DEEKAV--ADQEFMKLKLSDLSIVATLGVGGFGRVELVQVNNDNSRTFALKILKKHHIVETRQQEHIMNEKKIMSESRSDFIVRLYRTFKDRKYLYMLLEVCLGGELWTVLRDKGSFDDATTRFYTGCVIEAFAYLHNKGIVYRDLKPENLLLDSQGYVKLVDFGFAKKVGLGRKTWTFCGTPEYVAPEIILNKGHDISADFWSLGILMFELLTGSPPFSGQDPMKTYNIILKGIDAIDFSRKISKNAQNLIKKLCRETPSDRLGFGRGGIREIQKHKWFEGFNWDGLKKRTLKPPITPQVKSATDTSNFDDYPDEEDDPPPDDVTGWDRDF 689          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 391/627 (62.36%), Postives = 472/627 (75.28%), Query Frame = 2
Query:  650 LSNERMKRI-AISGESGTFIS----SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            L   R +R   IS E   F S    + E L    K  ++KELIK +IL+NDFMKNLE SQI+ I  C           IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F+ L E  L K++ VLEETHY +G+YIIRQG +GDTFFIIS GKV VTR++ P DT     ++R + +G+WFGEKAL+ ED+RTAN+IAAD   V CLV+DR+S+  LIG L  +  + YED       E    +  + NL L D  +I TLG+GGFGRVELVQ+     KT+A+K LKK HIV+TRQQEHI +E++I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP+ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P ++SPTD SNFD +P ++E  PPDD SGWD DF
Sbjct:   52 LMGPRTRRAQGISAEPQPFTSFQQLTSEALRKHAKSDRSKELIKEAILDNDFMKNLELSQIQEIESC-----------IIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTREDSPSDT---PVYLRALGKGDWFGEKALQGEDIRTANVIAAD--AVTCLVIDRDSFKHLIGGLDDVSSKGYEDAGAKAKYE--AENAFFSNLKLADFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKHIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPDVSSPTDTSNFDSFPEDSEDPPPDDNSGWDTDF 660          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 366/624 (58.65%), Postives = 443/624 (70.99%), Query Frame = 2
Query:  656 NERMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANI-IAADPAGVDCLVLDRESYIQLIGDLTSL-QRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
             +R KR AIS E   F     S   LP+  K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV+++ +S IIKEG+VGSLVYVMEDGKV V+KEG  L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E + FLKSVP F  L E  L K+  VLEETHY +GDYIIRQG +GDTFFIIS GKV VTR+   D  +++  ++R + +G+WFGEKAL+   +   N  +      ++C      SY  LIG L  +  +  ED       E    +  + NL L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFI    +TFKD K+LYML E CL      I   R +FD++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G     DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRD P+ER+G  K GVK+ QKH W E FNW+GL   T+ PP  P + S TD SNFD +P + E  PPDD SGWD DF
Sbjct:   69 QQRTKRQAISAEPTAFDIQELSHVTLPFNPKSAQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYSKDSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFHGLPEEILSKLGDVLEETHYEDGDYIIRQGARGDTFFIISKGKVTVTRE---DAASQETVYLRSLGKGDWFGEKALQGNQISCLNTDLITLSTFINCW-----SYKHLIGGLEDVSSKGSEDAEAKAKYE--AENAFFFNLHLSDFNIIDTLGVGGFGRVELVQLKSDEYKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFITV--QTFKDSKYLYMLHEACLEESCGPIPETRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRG-----DFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPSSP-VTSATDTSNFDSFPEDNEDPPPDDNSGWDGDF 674          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 312/651 (47.93%), Postives = 427/651 (65.59%), Query Frame = 2
Query:  650 LSNERMKRIAISGE--SGTFISSPEVLPYFE-----KHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYE-----------------DGVNDLPKEILGPSK---EYKN----LALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            L+  +  +  +S E  S T+ SS     YFE     K    K+L+  ++ +N +++ LE  QIK +V+CM    +     +IK+GE G+ ++V+ DG + V +    L  +   T FGELAILYNCTRTA+V A +  + W +DR  F +IM  T   ++E++ +FL+SV +   L E  L KI   LE  +Y  GDY+IR+G +G+TF+II+ GKV+VT+  K    +E+ Q I  +Q+G++FGEKAL  +D+R+ANIIA D  GV+CLV+DRE++ Q +G    L++  +                  G N  P   L   +     KN    L+  +L +IATLGIGGFGRVELV++  N   T+ALK +KK HIV+ RQ+EHI +ER IL    S FIV+++RTFKD K++YML+E CLGGE+WS+LRDR +F+ENT KF   CV EA  YLH++ I+YRDLKPENL+LD+ G+ K+ DFGFAKK+  G+KTWTFCGTPEYVAPEIILNKGH    D W+LGIL+FELLTG PPFT  D M  Y  ILKG++ ++FPKKISK   +LI+KLC+ NP+ER+G  K G+ + +KH W   F+W GL + T+  P+  ++  PTD S FD YPPE E+PPD+ISGWD DF
Sbjct:  122 LNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTK---DHEEPQVINTLQKGDYFGEKALISDDVRSANIIA-DEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKV-KNENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 310/611 (50.74%), Postives = 421/611 (68.90%), Query Frame = 2
Query:  752 KELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDL-------------PKEILGP-SKEYKNLA-----------LKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            K+LI  +I+ NDF+K LE    + +VDCM    + AN ++I+EGE G+ +YV+ +G + V + G  L +M+  T FGELAILYNC RTATV A+T   +WA+DR +FQSIMMR+   ++EE  +FL+SV + KDL E  L KI   LE  ++  G+YIIR+G +G+TFFII+ G+V VT+     +   +   I+ +  G++FGEKAL  ED+R+ANIIA +     CLV+DR+++ Q++G    LQ    + V  L             P     P + E ++L            L+ L +IATLG+GGFGRVELV++  N    +ALK +KK HIV+TRQQEHI +E+NIL     +FIVRL RTF+D K++YML+EVCLGGELWS+LRD S F+E T +F   CV+EA  YLH  GIVYRDLKPENLLLD +G+ K+TDFGFAK+IG G+KTWTFCGTPEYVAPE+I+NKGHD  ADCWSLGIL+FELL G PPF+  DP+KIY ++L GI+ ++ PK+ISK  ++LI++LC+ NP ER+G  K G+ + +KH W + FNW+GL    +  P+  ++N P D S+FD +PPE E PPD++SGWD+DF
Sbjct:  165 KKLINEAIMNNDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQST---EGYSEPLEIKILGVGDYFGEKALISEDVRSANIIAKE-NDTQCLVVDRDNFNQMVGTYEELQAYLREYVEQLSINDERRIAATQSPLYERSPQAAELRSLHEKAARLSSCSFLQQLQIIATLGMGGFGRVELVKL-KNEDTAFALKCIKKKHIVDTRQQEHIYSEKNILQQTNCNFIVRLFRTFRDEKYVYMLLEVCLGGELWSVLRDMSFFEEATARFCIGCVLEAFDYLHGMGIVYRDLKPENLLLDAEGYVKMTDFGFAKRIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFSGSDPIKIYTMVLHGIEKVDIPKRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQGFNWEGLRRRKLASPLRRELNGPLDHSHFDMFPPELEEPPDELSGWDKDF 770          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 296/627 (47.21%), Postives = 415/627 (66.19%), Query Frame = 2
Query:  650 LSNERMKRIAISGE--SGTFISSPEVLPYFE-----KHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            L+  +  +  +S E  S T+ SS     YFE     K    K+L+  ++ +N +++ LE  QIK +V+CM    +     +IK+GE G+ ++V+ DG + V +    L  +   T FGELAILYNCTRTA+V A +  + W +DR  F +IM  T   ++E++ +FL+SV +   L E  L KI   LE  +Y  GDY+IR+G +G+TF+II+ GKV+VT+  K    +E+ Q I  +Q+G++FGEKAL  +D+R+ANIIA D  GV+CLV+DRE++ Q +G    L++  +  V  L ++      + K  A   L+ + +  +    +V+     +NV  T+ALK +KK HIV+ RQ+EHI +ER IL    S FIV+++RTFKD K++YML+E CLGGE+WS+LRDR +F+ENT KF   CV EA  YLH++ I+YRDLKPENL+LD+ G+ K+ DFGFAKK+  G+KTWTFCGTPEYVAPEIILNKGH    D W+LGIL+FELLTG PPFT  D M  Y  ILKG++ ++FPKKISK   +LI+KLC+ NP+ER+G  K G+ + +KH W   F+W GL + T+  P+  ++  PTD S FD YPPE E+PPD+ISGWD DF
Sbjct:  122 LNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTK---DHEEPQVINTLQKGDYFGEKALISDDVRSANIIA-DEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARD------DKKRNAKWFLIAVCSSQV----KVK----NENV--TFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 728          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 399.823 bits (1026), Expect = 2.546e-132
Identity = 175/309 (56.63%), Postives = 239/309 (77.35%), Query Frame = 2
Query: 1583 VIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            VIATLG+GGFGRV+LV++ D+   T+ALK LKK  +VE+RQQEH+ +E+ IL      FIVR +RTF+D+KF+++LME CLGGELWS+LRD   F E + +F  ACV+EAL YLH+RGI+YRDLKPENLLLD +G+ K+ DFGFAKK+  GRK WTFCGTPEYV PE+I+N+GHD  ADCW+LG+L++ELL G+PPF+  DPMK YN IL G++ + FP ++ K A+++I++LCR NP+ER+G  K GV + +KH W + F+W+ L S+ +  P+  +++ PTD  NFD +P + ++PPD+ SGWD DF
Sbjct:   36 VIATLGVGGFGRVQLVKLKDS-DVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 343          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002201.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 332.798 bits (852), Expect = 1.231e-107
Identity = 154/308 (50.00%), Postives = 211/308 (68.51%), Query Frame = 2
Query: 1586 IATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            IATLG+GGFGRV+LV++ D+   T+ALK LKK  +VE+RQQEH+ +E+ IL      FIVR                                F E + +F  ACV+EAL YLH+RGI+YRDLKPENLLLD +G+ K+ DFGFAKK+  GRK WTFCGTPEYV PE+I+N+GHD  ADCW+LG+L++ELL G+PPF+  DPMK YN IL G++ + FP ++ K A+++I++LCR NP+ER+G  K GV + +KH W + F+W+ L S+ +  P+  +++ PTD  NFD +P + ++PPD+ SGWD DF
Sbjct:    1 IATLGVGGFGRVQLVKLKDS-DVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVR------------------------------GGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 277          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.521 bits (641), Expect = 7.608e-77
Identity = 120/278 (43.17%), Postives = 178/278 (64.03%), Query Frame = 2
Query: 1631 QIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPE 2464
            Q+G +V    +LK  K+  +V+ +Q EH +NE+ IL  +   F+VRL  +FKD   LYM++E   GGE++S LR    F E  ++FY A ++ A  YLHS  ++YRDLKPENLL+D QG+ ++TDFGFAK++  GR TWT CGTPEY+APEIIL+KG++   D W+LG+L++E+  G PPF A  P++IY  I+ G   + FP   S D ++L++ L + +  +R G  K GV + + H W  + +W  +    ++ P +P+   P D SNFD+Y  E
Sbjct:    2 QVGQHV----SLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEE 271          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 3.800e-58
Identity = 126/344 (36.63%), Postives = 191/344 (55.52%), Query Frame = 2
Query: 1433 CLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALK--DLVVIATLGIGGFGRVELVQ-IGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYM-VQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKK-IGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFD 2449
            C   D   ++QL       Q   E   ND     LGPS    NL  K  D   +  LG G FG+V L +   D +   YA+K +KK  I++ ++++HIM ERN+L   V+  F+V LH +F+    LY +M+   GGEL+  L+ + +F E+  +FY A +  A+ YLHS  IVYRDLKPEN+LLD QG   +TDFG  K+ I     T TFCGTPEY+APE++    +D   D W LG +++E+L G+PPF + +  ++Y  IL     ++     +  A ++++ L   +P++R+G     + E + H++  + NW+ L +  I  P  P ++ P D  NFD
Sbjct:   48 CQNPDVRKFLQLDNPRNQTQGPME---NDADHINLGPSA---NLQAKPSDFDFLTVLGKGSFGKVLLAKHKSDGI--FYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILH--QPLQLRPCTTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 5.901e-57
Identity = 113/305 (37.05%), Postives = 167/305 (54.75%), Query Frame = 2
Query: 1544 SKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHS-RGIVYRDLKPENLLLDNQGFCKITDFGFAKK-IGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDE 2452
            SK    + + +   +  LG G FG+V LV+      + YA+K LKK  IV   +  H + E  +L   +  F+  L  +F+    L  +ME   GGEL+  L     F E+ T+FY A ++ AL YLH+ + +VYRDLK ENL+LD  G  KI DFG  K+ I  G    TFCGTPEY+APE++ +  +    D W LG++M+E++ G  PF   D  K++ +IL  ++ I FP+ +S DA+ L+  L + +P +R+G G    KE  +H +     W  +    + PP  PQ+ S TD   FDE
Sbjct:  139 SKPKSKVTMNNFDYLKLLGKGTFGKVILVR-EKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL--MEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDE 440          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 255.373 bits (651), Expect = 2.630e-77
Identity = 135/318 (42.45%), Postives = 191/318 (60.06%), Query Frame = 2
Query: 1514 NDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPT-DCSNFDEYPPE 2464
            + LP++ L    +Y    L D  ++ TLG G FGRV LV+   N  + YA+K LKK  +V+ +Q EH  +ER +L +V+  F++R+  TF+D + ++M+M+   GGEL+S+LR    F     KFY A VI AL YLH+  I+YRDLKPEN+LLD  G  KITDFGFAK++     TWT CGTP+Y+APE+I  K ++   D WSLG+L++E+L G  PF    PMK Y  IL+G   + +P     D  +L+ KL   +   R+G  + G ++ + H W     W+ LL+  I+ P  P I S   D S FD+YP E
Sbjct:   52 SQLPQKSLVSKGKY---TLHDFQIMRTLGTGSFGRVHLVRSVHN-GRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEV--QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQG--KVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 253.447 bits (646), Expect = 2.603e-76
Identity = 133/301 (44.19%), Postives = 184/301 (61.13%), Query Frame = 2
Query: 1565 ALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPT-DCSNFDEYPPE 2464
            +L D  ++ TLG G FGRV L++   N  + YALK LKKH IV+ +Q EH  +ER +L +V   FI+R+  TF+D + ++M+M+   GGEL+S+LR    F     KFY A V  AL YLHS+ I+YRDLKPEN+LLD  G  KITDFGFAK +     T+T CGTP+Y+APE++  K ++   D WS G+L++E+L G  PF   + MK Y  IL     ++FP     DAQ+L+KKL   + +ER+G  + G ++ + H W     W+ LL+  I+ P  P I     D S FD YP E
Sbjct:   84 SLSDFQILRTLGTGSFGRVHLIRSNHN-GRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNA--ELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 244.588 bits (623), Expect = 4.568e-73
Identity = 127/301 (42.19%), Postives = 184/301 (61.13%), Query Frame = 2
Query: 1565 ALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPT-DCSNFDEYPPE 2464
            +L+D  ++ TLG G FGRV L++   N  + YA+K LKK  +V  +Q EH  +ER +L +V   FI+R+  TF+D + ++M+M+   GGEL+S+LR    F     KFY A V  AL YLHS+ I+YRDLKPEN+LLD  G  KITDFGFAK +     T+T CGTP+Y+APE++  K ++   D WS GIL++E+L G  PF   + MK Y  IL     + FP   ++D ++L+ +L   + ++R+G  + G ++ + H W +   W+ LLS  I+ P  P I     D S FD+YP E
Sbjct:   83 SLQDFQILRTLGTGSFGRVHLIRSRHN-GRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNA--ELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEE 378          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 220.32 bits (560), Expect = 1.349e-61
Identity = 121/305 (39.67%), Postives = 178/305 (58.36%), Query Frame = 2
Query: 1541 PSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAK-KIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDE 2452
            PS+  K L++ D  ++  +G G FG+V  V+  D  +K YALK ++K +IV   +  H + ER +L  V   FIV L  +F+  + LY ++    GGEL+  L+    FD +  +FYTA ++ AL  LH   +VYRDLKPEN+LLD QG   + DFG  K  +    KT TFCGTPEY+APE++L  G+    D W+LG+L++E+LTG+PP+   D  K+Y  IL+  + + FP    +DA++L+  L   +P  R+GY   G  E + H +    +W  LL     PP  P +++  D SNFDE
Sbjct:  336 PSRN-KPLSIDDFDLLKVIGKGSFGKVMQVRKKD-TQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ--EPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY--NGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDE 634          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 202.601 bits (514), Expect = 1.994e-55
Identity = 116/305 (38.03%), Postives = 174/305 (57.05%), Query Frame = 2
Query: 1541 PSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAK-KIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDE 2452
            PSK  K L++ D  ++  +G G FG+V  V+  D  +K YALK L+K +IV   +  H + ER +L  V   FIV L  +F+  + LY+++    GGEL+  L+    F    ++FY A ++ AL  LH   ++YRDLKPEN+LLD QG   + DFG  K  +    KT TFCGTPEY+APEI+L +G+    D W+LGIL++E++TG+PP+   +   +Y  IL+    + FP      A++L+  L   +P+ R+G    G  E + H + +  +W  LL     PP  P + S  D +NFD+
Sbjct:  333 PSKN-KPLSIDDFDLLKVIGKGSFGKVMQVRKKD-TQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ--QPLLFPDGFDPAAKDLLIGLLSRDPSRRLGV--NGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQ 631          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 378/627 (60.29%), Postives = 471/627 (75.12%), Query Frame = 2
Query:  653 SNERMKRIAISGE---SGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQR-TYED---GVN-DLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            S  R +R  IS E   +     S + L    K+ ++KELIK +IL+NDF+KNLE SQ++ +V+CM    F  +  IIKE E GS +YV+E+GK  V+KEG  L  M     FGELAILYNCTRTA+V A T  KLWAIDR +FQ+IMM+TGL++  E++ FL+SV + KDL ES L KI+ V+EET Y  G+YIIRQG +GDTFFII SG V +T++    + +     +R + +G +FGEKALK EDLRTAN IA    GV CLVLDRE+++Q IG+L  +QR  Y+D   GV+      +     E+ N+ L+DL V+ TLGIGGFGRVELVQ+  + K+T+ALK LKKHHIVETRQQ+HIM+E+ I+    S FIVRLH+TFKD+K+LYML+EVCLGGELW+ILRDR +FD++TT+FY  CVIEA  YLHS+GIVYRDLKPENLLLD  G+CK+ DFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHD  AD WSLGILM+ELLTG PPF+  DPMK YNIILKGID I+FP+KI+++A  LIKKLCRDNP ER+GY KGG+K+  KH W + FNWDGL S  +  PI P+I SP D SNFD+YP + ++PPDD++GWD+DF
Sbjct:   40 SRARNQRQGISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRT---NVHSDPVHVRNLSKGAYFGEKALKGEDLRTANCIAG-KGGVTCLVLDREAFVQFIGNLDDIQRDQYDDSQRGVDPQTASHLRAQQDEFANVRLEDLTVVKTLGIGGFGRVELVQVAGD-KRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNFDDYPADDDIPPDDMTGWDKDF 661          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 342/652 (52.45%), Postives = 458/652 (70.25%), Query Frame = 2
Query:  656 NERMKRIAISGESGTFIS----SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSL-QRTYED---GVN---DLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWL------------------ESFNWDGLLSHTIKPPIVP-----QINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            +++ KR A+SGES T       + + L  F K  ++K+LIK +I ENDF+KNLE +Q++ IVDCM    F  N +II+EG+ G+ +Y + DG++ V++E   L EM    VFGELAILYNC RTATVTA+   KLW IDR  FQ IMMRTG+++  E++ FLKSVP+ K+L  + L K++ VLE   Y  GDYIIR+  +GDTF+II+ G  +VT++ +   T  KE  IR++Q+G++FGEKAL  ED RTAN+IA +  GV+CLV+DR  ++ +IG++  L ++ Y D   G     D+P+E    SKE+ +L L+DL V+ATLG GGFGRVELV        TYALK LKK HI++TRQQEH+ +E+ IL    S FI +++RTFKDRK++YML+E CLGGELW+ILRDR  F++ T +F  ACV+E   YLHS+GIVYRDLKPENLLLD +G+ K+ DFGFAKKIG GRKTWTFCGTPEYVAPEIILNKGHD  +D WSLGIL+FELLTG PPF++ DPMK YNIIL+G+D +EFPK+I ++ QNLIK+LC+DNP ER+GY K G+ + +KH ++                  ++  W  L++ T+     P     ++ S TD SNFD Y  + ++PPD++SGWD +F
Sbjct:   17 SKKEKRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIE-GQTGPKE--IRKLQKGDYFGEKALLSEDRRTANVIAEE-NGVECLVVDRTVFMTVIGNMDELREKDYGDEKRGAKRTLDVPEEERKVSKEFADLTLEDLEVVATLGTGGFGRVELV--------TYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPKRIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKYVVPWFPLAGTHRRDPRTSNQTRFW--LMTTTLSFKTSPIYLLIRVESSTDYSNFDVYSKDMDIPPDEMSGWDENF 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 268.47 bits (685), Expect = 2.862e-82
Identity = 139/307 (45.28%), Postives = 193/307 (62.87%), Query Frame = 2
Query: 1547 KEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKI-SKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPE 2464
            K+ K   L+D  +  TLG G FGRV L +      + YALK +    ++  +Q EH+ NE+NIL  ++  FIV L  T  D+ FLYML+E   GGEL++ LR    F+  T  F+ + ++ A+ YLH   IVYRDLKPEN+LLD  G  K+TDFGFAK++    KTWT CGTPEY+APEII +KGH+   D W+LGIL++E+L G PPF   +P  IY  IL G   +E+PK + +  A++LIKKL   +   R+G  K G ++ + H W +  +W+ +L   +KPPI P+I+ P D  NFD+YP E
Sbjct:    8 KKDKRTTLQDFELSKTLGTGTFGRVLLAR-DRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEV--HDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSG--KVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEE 309          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 228.794 bits (582), Expect = 7.335e-65
Identity = 124/303 (40.92%), Postives = 179/303 (59.08%), Query Frame = 2
Query: 1583 VIATLGIGGFGRVELVQ--IGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDD 2485
            ++  LG G FG+V LV+  IG +    YA+K LKK   ++ R +   M ER+IL  VQ  FIVRL+  F+    +Y++++   GG+L++ L     F E   KFY A +  AL +LH  GI+YRDLKPEN+LLD  G   +TDFG +K+    +KT++FCGT EY+APE++  +GH   AD WS G+LMFE+LTG  PF   D     N+ILK    +  P+ ++ +AQ+L+++L + NP  R+G G  G+++ +KH +  + NW+ L    IKPP  P      D   FD  P  T   P D
Sbjct:   11 LLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKKA-TLKVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKA--KLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFD--PEFTSKTPQD 308          

HSP 2 Score: 97.0561 bits (240), Expect = 8.151e-21
Identity = 58/162 (35.80%), Postives = 89/162 (54.94%), Query Frame = 2
Query: 1760 IVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLL-DNQGF---CKITDFGFAKKIGFGRKT----WTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGI 2221
            IV L   ++  K +Y++ME+  GGEL   +       E         +   + +LH  G+V+RDLKP N++  D+ G     +I DFGFAK++   R T     T C T  +VAPE++  +G+D   D WSLG+L++ +L+G+ PF A  P    ++ILK I
Sbjct:  410 IVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQM---RATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPF-AVGPEDTPSVILKRI 567          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 217.238 bits (552), Expect = 1.785e-62
Identity = 125/314 (39.81%), Postives = 180/314 (57.32%), Query Frame = 2
Query: 1520 LPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQI--GDNVKKTYALKQLKKHHIVETRQQ-EHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRK-TWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFD 2449
            L +E + P  E   +  +   ++  LG GG+G+V LV+   G + +K +A+K LKK  I+ +++   H   ERNIL  V+  FIV L   F+    LY+++E   GGEL+  L     F E+T  FY + +  AL +LH +GIVYRDLKPEN+LLD  G  K+TDFG  K+  F    T TFCGT EY+APEI+   GH    D WSLG LM+++LTG PPF A +  K  + ILKG   +  P  ++ +A++ I+KL + +P  R+G   G     + H +     W+ LL+  ++PP  P I+   D S FD
Sbjct:   48 LSEETVNPKDE--KVGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKG--KLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFD 357          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 392/621 (63.12%), Postives = 478/621 (76.97%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            +R KR AIS E   F     S   LP++ K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E ++FLKSVP F DL+E  L K++ VLEETHYA G+YIIRQG +GDTFFIIS GKV VTR++ P   N +  ++R + +G+WFGEKAL+ ED+RTA++IAA+   V CLV+DR+S+  LIG L  +     D   D   +    +  + +L L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SP D SNFD +P + E  PPDD SGWD DF
Sbjct:   70 QRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLP---NGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAE--AVTCLVIDRDSFKHLIGGLEDVSSKGHDDA-DAKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWDVDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 373/592 (63.01%), Postives = 458/592 (77.36%), Query Frame = 2
Query:  656 NERMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQIN 2422
             +R KR AIS E   F     S   LP++ K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E ++FLKSVP F DL+E  L K++ VLEETHYA G+YIIRQG +GDTFFIIS GKV VTR++ P   N +  ++R + +G+WFGEKAL+ ED+RTA++IAA+   V CLV+DR+S+  LIG L  +     D   D   +    +  + +L L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P ++
Sbjct:   69 QQRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLP---NGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAE--AVTCLVIDRDSFKHLIGGLEDVSSKGHDDA-DAKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 371/594 (62.46%), Postives = 456/594 (76.77%), Query Frame = 2
Query:  647 KLSNERMKRI-AISGESGTFIS-SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQIN 2422
            +L   R +R   IS E  T    S + L  + K   +K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E ++FLKSVP F DL+E  L K++ VLEETHYA G+YIIRQG +GDTFFIIS GKV VTR++ P   N +  ++R + +G+WFGEKAL+ ED+RTA++IAA+   V CLV+DR+S+  LIG L  +     D   D   +    +  + +L L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR +F+++TT+FYTACV+EA  YLHS+GI+YRDLKPENL+LD++G+ K+ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P ++
Sbjct:   51 QLIGPRTRRAQGISAEPQTHQDLSRQALRRYPKSDWSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLP---NGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAE--AVTCLVIDRDSFKHLIGGLEDVSSKGHDDA-DAKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVS 638          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 370/622 (59.49%), Postives = 452/622 (72.67%), Query Frame = 2
Query:  659 ERMKRIAISGESGTFIS---SPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDR-SAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETE-MPPDDISGWDRDF 2509
            +R KR AIS E   F     S   LP++ K  ++K+LIK +IL+NDFMKNLE SQI+ IVDCM PV++  +S IIKEG+VGSLVYVMEDGKV V+KE   L  M    VFGELAILYNCTRTATV  +T+ KLWAIDR  FQ+IMMRTGL+K+ E ++FLKSVP F DL+E  L K++ VLEETHYA G+YIIRQG +GDTFFIIS GKV VTR++ P   N +  ++R + +G+WFGEKAL+ ED+RTA++IAA+   V CLV+DR+S+  LIG L  +     D   D   +    +  + +L L D  +I TLG+GGFGRVELVQ+  +  KT+A+K LKK HIV+TRQQEHI +E+ I+    SDFIVRL+RTFKD K+LYMLME CLGGELW+ILRDR  +F  NT  +   C      ++  +G        +NL+     F ++ DFGFAKKIGFG+KTWTFCGTPEYVAPEIILNKGHD  AD WSLGILMFELLTG PPF+ PDPMK YNIIL+GID IEFPKKI+K+A NLIKKLCRDNP ER+G  K GVK+ QKH W E FNW+GL   T+ PPI+P + SP D SNFD +P + E  PPDD SGWD DF
Sbjct:   70 QRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLP---NGEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAE--AVTCLVIDRDSFKHLIGGLEDVSSKGHDDA-DAKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRHKSFKINTHIWIGRCCF-MFTFICIKGHSCPTPDQKNLI-----FLQV-DFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWDVDF 678          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 301/615 (48.94%), Postives = 419/615 (68.13%), Query Frame = 2
Query:  737 KHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDL----------PKEILGPSKEYKNLA--------------LKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            K+  TK LI  +IL NDF+K LE   ++ +VDCM    ++   ++I+EG+ G+ +YV+ +G + V + G  L EM   T FGELAILYNC RTATV A+    +W ++R +FQ+IMM+T   +++E   FL+SV + K L E  LG+I   LE  ++  G+YIIR+G +G+TFFII+ G+V VT+ +   +   + Q I+ +  G++FGE+AL  ED+R+ANII  +     CLV+DR+++ Q++G    LQ   ++ V +L          P      S E + L+               ++L VIATLG+GGFGRVELV++ D  + T+ALK +KK H+V+TRQQ+HI +E+ IL    S FI+RL RTF+D K++YML+EVCLGGELW++LRD S F+E T +F   CV+EA  YLHS GI+YRDLKPENLLLD  G+ K+ DFGFAK+IG GRKTWTFCGTPEYVAPE+I+NKGHD  ADCWSLGIL+FELLTG PPF+  DP+KIY ++L GID ++FPK+I K   +LI++LC+ NP ER+G  K G+ + +KH W + FNW+GL    +  P+  ++  P D SNFD +PP +E  PD++SGWD+DF
Sbjct:  159 KNSDTKRLINEAILSNDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSS---EGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNE-NDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQSDSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELVKLKDE-ESTFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDADGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTGNPPFSGSDPIKIYTMVLHGIDRVDFPKRIGKRPDDLIRRLCKLNPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKDF 768          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 1598.18 bits (4137), Expect = 0.000e+0
Identity = 791/794 (99.62%), Postives = 791/794 (99.62%), Query Frame = 2
Query:  128 MISTIVSHKEENSSLSTLKIYDWTGPLSALLAGKKSAISQASSFRIMGTLRELQMNLRKKLKELKQRXXXXXXXXXXXXXXXXXXXNLQRQLDKYRSILQSPMQIKPQISSIYNEDFQLFTPNGDVSHDSSISTGEMLNSSQNNQVLCYNCGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            MISTIVSHKEENSSLSTLKIYDWTGPLSALLAGKKSAISQASSFRIMGTLRELQMNLRKKLKELKQRDSLIDELEEELDQKDLLIENLQRQLDKYRSILQSPMQIKPQISSIYNEDFQLFTPNGDVSHDSSISTGEMLNSSQNNQVLCYNCGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDT EKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVND PKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDN KKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF
Sbjct:    1 MISTIVSHKEENSSLSTLKIYDWTGPLSALLAGKKSAISQASSFRIMGTLRELQMNLRKKLKELKQRDSLIDELEEELDQKDLLIENLQRQLDKYRSILQSPMQIKPQISSIYNEDFQLFTPNGDVSHDSSISTGEMLNSSQNNQVLCYNCGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDSPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 794          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 597/641 (93.14%), Postives = 608/641 (94.85%), Query Frame = 2
Query:  587 KLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            K Q  +  T  + N ++G    +  R++ + IS E  T   +     +F+K  KTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDT EKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVND PKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDN KKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF
Sbjct:   42 KYQSVFSATQKQNNVQSGPHN-NQTRVRGLGISAEPQTAKIANFQPSFFQKDSKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDSPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 681          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000005347.1 (SMESG000005347.1)

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 402/646 (62.23%), Postives = 496/646 (76.78%), Query Frame = 2
Query:  575 NCGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEV-LPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            N GAKL ++   +   ++NK         R KR AISGES  ++++  + +   EK  K+KELI+ +I +ND+MK+L+ SQI  IV+CM PV +   S II+EGE+GS+VY +EDG V V+K G  +REM   TVFGELAILYNCTRTA+V A T+CKLWAIDR  FQSIMM+TGL K E+ + FLKSVP F+D+   TLGKI+GVL E HY+ GDYIIR+G KG TF+II  G+V+VT+K    D   +E FIR + RG WFGEKAL+DED+RTA+IIA  P+GVDCLVLDRESY  LIGD+ +  + Y D       +    + ++  LAL+DL VI TLG+GGFGRVELV+IG++ ++T+ALK LKK+HIVET QQEH+MNER+IL  V S+FIV+L++TFKDR++LYMLMEVCLGGE+W+ILR++ +FD+ TTKFYTA VI AL YLH +GIV+RDLKPEN LLD +G+CK+TDFGFAKKIGF RKTWTFCGTPEYVAPEIILNKGHD   D WSLGILM+EL TG PPFT+ DPMK YNIILKGI  I+F  KISK AQ+LIKKLCR+NP+ER+GYGK GV E QKH W E FNW+GLLS   KPPI+PQ+ S  D SNFD Y P+ E P +DISGWD+DF
Sbjct:  230 NFGAKLSVSVAKSTKTDSNK--------MRAKRNAISGESAKYLTTNGITMKRVEKPSKSKELIRSAIYDNDYMKHLDPSQITEIVECMSPVTYHEGSWIIQEGEIGSIVYALEDGLVEVTKSGAIIREMGPGTVFGELAILYNCTRTASVRATTECKLWAIDRQCFQSIMMKTGLRKQEDYIRFLKSVPTFQDMNMETLGKIAGVLGENHYSQGDYIIREGEKGATFYIIEKGRVKVTKKTSKSD---EEVFIRHLDRGSWFGEKALRDEDVRTASIIAESPSGVDCLVLDRESYNLLIGDIVNFDKQYPD-----EDKARRRASKFPELALRDLCVITTLGVGGFGRVELVRIGNDDRRTFALKVLKKYHIVETHQQEHVMNERDILMEVDSEFIVKLYKTFKDRRYLYMLMEVCLGGEVWTILREKVSFDDATTKFYTASVILALEYLHRKGIVFRDLKPENCLLDEKGYCKLTDFGFAKKIGFARKTWTFCGTPEYVAPEIILNKGHDFAVDIWSLGILMYELFTGTPPFTSSDPMKTYNIILKGIQTIDFSSKISKHAQSLIKKLCRENPSERLGYGKLGVAEAQKHAWFEGFNWEGLLSKKTKPPIIPQVKSAVDVSNFDLYSPDEETPAEDISGWDKDF 859          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000007783.1 (SMESG000007783.1)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 310/630 (49.21%), Postives = 419/630 (66.51%), Query Frame = 2
Query:  662 RMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAAD-PAGVDCLVLDRESYIQLIGDLTSLQRTYEDGVNDLPKEILGPSKEYKNLA-----------LKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDA--IEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            R KR+ ISGES       + L  F K  + K++I+++I+ N  +  L+ SQ+  I++CM       N  +I+EGE G  +YV ++G+  V K+   + +M N+  FGELA+LYNC RTA+V A+  C LW +DR  FQ+IMM+TGL + ++   FL+SV +F+ L E  L KI  ++E   Y++G  IIRQG + D+FFII +G V+VT+K   D+       +R+M  GE+FGEKAL +E  RTANI A   P  V CL   R+++ +LIG+L  LQ    D   D  +  +  S   +N A           L D  ++ATLG GGFGRVELV    +  K+YALK +KK +IV+T+QQ+H+M+E+ IL   +S +I RL+ TF D K++Y+L EVCLGGELW+ILRDR  FD+  T F  ACV+EAL YLHSRGIVYRDLKPENLL+ N G+ K+ DFGFAKKIG G +TWTFCGTPEYVAPEIILNK HD   D WS+GIL +ELL G PPF A DPMKIYN+ LKGI+   I    KI+  A +LI++LCR  P ER+G GK G++E + H + + F+W+G+ S T+K P  P+IN P D SNFD++  E+++PPD+ SGWD+DF
Sbjct:   98 RSKRLGISGESSNH-QRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCYVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKINGDEIE-----VREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLY--RQAFSELIGELNVLQAKEYD---DESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITSFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPIDTSNFDKFTNESDIPPDENSGWDKDF 716          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008788.1 (SMESG000008788.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 305/632 (48.26%), Postives = 415/632 (65.66%), Query Frame = 2
Query:  662 RMKRIAISGESGTFISSPEVLPYFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYEDG-------------VNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEF--PKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 2509
            R K+  +SGES    ++ +++ Y +K    K L++ SIL+N  + NL   Q+  +++ M   +      +I EGE G  +YV E G   V K    L  +     FGELA+LYNC RTA+V A+TD KLW +DR  FQ+IMMRTG+ + EE L FLKSVP+ K L E  L K+  +LE   +  G+ IIRQG   D FFII SG V+VT++      + +EQ IR +  GE+FGEKAL   + RTAN+ A + +  D L L R+ +++LIGDL  L+ + YED               ND   E L       N+ LKDL ++ TLG+GGFGRVELV++  + + TYALK +KK+HIV+T+QQ+H+++E+ IL   +S FI RL+ TFKD KF+YMLMEVCLGGELW+ LRD+  FD+  TKF   CV+EA  YLHSRGI+YRDLKPENLL+   G+ K+ DFGFAK+IG G++TWTFCGTPEYV+PEIILNK HD  +D WS+GIL +ELLTG PPFT  DPMKIY +ILKGI+A +    ++I+  A + I+ LC+ N  ER+G G GG++E + H + + F+W+ +    +  P  P++ S TD SNFD++  E E+PPD+ SGWD +F
Sbjct:  245 RSKKQGVSGESNKDQTNLKLIKY-KKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQR-----YDGEEQVIRTLTMGEYFGEKALLSAETRTANVYA-NSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKL------VNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEEF 863          
The following BLAST results are available for this feature:
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG10.000e+063.61protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG10.000e+063.47protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG20.000e+047.76protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+047.76protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+047.01protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-40.000e+052.47cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+052.47cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+052.47cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+052.47cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+052.47cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
for0.000e+060.39gene:FBgn0000721 transcript:FBtr0446099[more]
for0.000e+060.39gene:FBgn0000721 transcript:FBtr0089310[more]
for0.000e+060.39gene:FBgn0000721 transcript:FBtr0089312[more]
for0.000e+060.39gene:FBgn0000721 transcript:FBtr0089304[more]
for0.000e+062.72gene:FBgn0000721 transcript:FBtr0473363[more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+063.56protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1b0.000e+064.50protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a0.000e+062.22protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg1b0.000e+060.67protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
CR925795.10.000e+064.25protein kinase cGMP-dependent 1b [Source:NCBI gene... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk40.000e+062.89calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+062.89calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+063.53calcium/calmodulin-dependent protein kinase IV [So... [more]
ptafr0.000e+050.49platelet activating factor receptor [Source:Xenbas... [more]
camk40.000e+064.35calcium/calmodulin-dependent protein kinase IV [So... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkg10.000e+063.45protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg10.000e+063.31protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+047.47protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg20.000e+046.72protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg16.818e-16361.68protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P00516|KGP1_BOVIN0.000e+063.80cGMP-dependent protein kinase 1 OS=Bos taurus OX=9... [more]
sp|P0C605|KGP1_MOUSE0.000e+063.31cGMP-dependent protein kinase 1 OS=Mus musculus OX... [more]
sp|Q13976|KGP1_HUMAN0.000e+063.47cGMP-dependent protein kinase 1 OS=Homo sapiens OX... [more]
sp|O77676|KGP1_RABIT0.000e+063.15cGMP-dependent protein kinase 1 OS=Oryctolagus cun... [more]
sp|Q03043|KGP24_DROME0.000e+060.39cGMP-dependent protein kinase, isozyme 2 forms cD4... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FLY40.000e+065.48cGMP-dependent protein kinase OS=Macrostomum ligna... [more]
V3ZX540.000e+065.59cGMP-dependent protein kinase OS=Lottia gigantea O... [more]
A0A267FPA90.000e+063.72cGMP-dependent protein kinase OS=Macrostomum ligna... [more]
A0A267GV060.000e+063.72cGMP-dependent protein kinase OS=Macrostomum ligna... [more]
K1QUW80.000e+064.32cGMP-dependent protein kinase OS=Crassostrea gigas... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+062.36protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a0.000e+058.65protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg20.000e+047.93protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
ENSAMXT00000002114.20.000e+050.74cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg20.000e+047.21protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002200.12.546e-13256.63pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000002201.11.231e-10750.00pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 ... [more]
ENSPMAT00000001814.17.608e-7743.17pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000006766.13.800e-5836.63pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000008480.15.901e-5737.05pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK22.630e-7742.45cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK32.603e-7644.19cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK14.568e-7342.19cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK11.349e-6139.67S/T protein kinase; phosphorylates, downregulates ... [more]
YPK21.994e-5538.03Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384070.000e+060.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383990.000e+052.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352282.862e-8245.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318957.335e-6540.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.785e-6239.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg10.000e+063.12protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg10.000e+063.01protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg10.000e+062.46protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg10.000e+059.49protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
ENSORLT00000001302.20.000e+048.94cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016927.10.000e+099.62SMESG000016927.1[more]
SMESG000016927.10.000e+093.14SMESG000016927.1[more]
SMESG000005347.10.000e+062.23SMESG000005347.1[more]
SMESG000007783.10.000e+049.21SMESG000007783.1[more]
SMESG000008788.10.000e+048.26SMESG000008788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014787 ID=SMED30014787|Name=cGMP-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2801bp
CACCAATCATATCGCGCTAAATATTGTAAATACAGATTACGGAAGATTAT
ATCAGGATTTCAGCAAAATATTTTTACCATATTTGAAATTATTATTTCAA
AATCTTTGATATTTCGTCATTTGTTGTATGATTTCAACAATTGTGTCCCA
TAAAGAAGAAAACAGTTCTTTGAGCACTTTAAAAATCTACGACTGGACAG
GTCCATTGTCAGCTCTGTTAGCTGGGAAAAAATCCGCAATATCTCAAGCA
TCATCGTTCAGAATTATGGGAACTCTAAGGGAACTACAAATGAACCTGAG
AAAGAAATTGAAAGAATTAAAACAACGAGATTCATTGATTGATGAGCTGG
AAGAGGAATTGGATCAGAAAGATTTGTTAATTGAAAATCTTCAAAGACAA
TTGGATAAGTATCGGTCAATTTTACAGTCTCCGATGCAAATTAAGCCACA
AATCTCTTCGATTTATAATGAAGACTTCCAGTTATTCACACCGAACGGAG
ACGTCTCACACGATTCTTCAATATCTACGGGAGAAATGTTGAATAGCTCA
CAAAACAATCAGGTCTTATGCTATAATTGCGGTGCAAAATTGCAGCTTGC
CTACATTTATACCGATATCGAAGAAAACAATAAAAATGGCGATTTTAAAT
TGAGCAATGAACGAATGAAAAGGATCGCCATTTCCGGAGAATCAGGAACT
TTCATTTCATCACCTGAAGTTTTACCATATTTTGAGAAACATTTAAAAAC
AAAAGAGCTTATCAAACGGTCCATTTTAGAAAATGATTTCATGAAAAATC
TGGAACAAAGTCAAATAAAGATGATTGTTGACTGCATGAGACCGGTGAAA
TTCGCAGCAAACAGTATCATTATTAAGGAAGGGGAAGTAGGATCTTTAGT
TTACGTAATGGAAGATGGGAAGGTCAGTGTATCGAAAGAAGGCCACCATT
TACGGGAAATGAAAAATGAGACTGTGTTTGGAGAATTAGCTATTCTTTAC
AATTGCACTCGAACTGCAACGGTTACAGCCATTACTGATTGCAAATTGTG
GGCAATCGATCGGCACAGTTTTCAATCAATAATGATGAGGACTGGACTTT
TAAAATATGAAGAAAATTTAAATTTTTTAAAAAGTGTTCCAATTTTCAAA
GATCTGGAAGAAAGTACTCTAGGAAAAATTTCAGGAGTTCTTGAAGAGAC
CCATTACGCCAATGGAGACTACATAATTCGTCAAGGAACAAAAGGAGACA
CATTTTTTATAATATCATCGGGTAAGGTTCAGGTTACTAGGAAAAATAAG
CCCGATGATACAAACGAAAAAGAACAATTTATTCGACAAATGCAGCGTGG
AGAATGGTTTGGTGAAAAAGCTTTAAAAGATGAAGATTTACGAACTGCCA
ACATTATTGCTGCTGATCCAGCGGGAGTCGACTGCTTGGTTTTGGACAGA
GAATCCTACATTCAACTTATTGGAGATTTAACAAGTCTCCAGCGGACGTA
TGAGGATGGAGTTAACGATTTGCCAAAGGAAATTTTGGGACCTTCAAAAG
AATATAAGAATTTAGCTTTGAAGGATTTGGTCGTGATAGCTACTTTAGGA
ATCGGCGGATTTGGACGAGTAGAACTGGTCCAAATAGGAGATAACGTCAA
AAAGACTTATGCCCTGAAACAGCTCAAAAAACATCACATTGTGGAAACCC
GACAACAGGAGCATATTATGAATGAAAGGAACATTTTATATATGGTTCAA
TCAGATTTTATAGTAAGACTGCATAGAACATTCAAAGACAGAAAATTTCT
ATATATGTTGATGGAAGTTTGCTTAGGCGGTGAATTATGGTCAATTTTAA
GAGACCGAAGCGCATTCGATGAAAATACAACAAAGTTTTATACAGCATGT
GTTATAGAAGCTCTCCACTATTTACATTCAAGAGGAATCGTTTACAGAGA
TCTTAAACCAGAGAATCTCTTATTAGATAACCAAGGATTTTGTAAAATTA
CGGATTTTGGATTCGCTAAAAAAATCGGTTTCGGAAGGAAAACGTGGACA
TTTTGCGGAACACCGGAATACGTTGCTCCAGAAATTATTCTCAATAAAGG
TCATGATACTTATGCCGACTGTTGGTCTTTAGGGATATTAATGTTTGAAT
TGCTCACAGGAATGCCTCCTTTCACGGCACCGGATCCGATGAAAATTTAC
AACATAATTCTCAAAGGAATTGATGCCATTGAATTTCCAAAGAAAATCTC
TAAAGACGCCCAAAACCTAATCAAAAAGCTTTGCAGGGATAATCCAAATG
AAAGAGTGGGTTATGGAAAGGGTGGAGTTAAAGAGTGCCAAAAACATTTA
TGGTTAGAGTCTTTCAACTGGGATGGATTACTGTCTCACACAATCAAGCC
TCCAATAGTGCCCCAAATAAACTCACCAACTGACTGTAGTAATTTTGATG
AATACCCTCCAGAAACCGAAATGCCTCCAGATGATATTAGTGGTTGGGAT
CGGGACTTTTGATGTAGTCCATTGACGAGTATTCCAATCATTGAAATGTC
TTTGAAAGTGAACTTAGAGATCAGTTGTAGTGGAACTCTTCTTGTAAAAA
TCTAATTGCTTTCTCTTATATTGATTTATAAAAAAAACATTTTTTATGTT
AAATTTTATTTTTATTTTTGTCTTCGAATCTTATCATTTGAATGAGTGAA
TAAAATTATAAATATCTAAACTCCTTAAATGGCCATATATTTGTTTTAAT
TCTATCATGTGAGACGGATAAAATGGTGAGTGTTAATGGTCTTGTTAGGA
A
back to top

protein sequence of SMED30014787-orf-1

>SMED30014787-orf-1 ID=SMED30014787-orf-1|Name=SMED30014787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=795bp
MISTIVSHKEENSSLSTLKIYDWTGPLSALLAGKKSAISQASSFRIMGTL
RELQMNLRKKLKELKQRDSLIDELEEELDQKDLLIENLQRQLDKYRSILQ
SPMQIKPQISSIYNEDFQLFTPNGDVSHDSSISTGEMLNSSQNNQVLCYN
CGAKLQLAYIYTDIEENNKNGDFKLSNERMKRIAISGESGTFISSPEVLP
YFEKHLKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIK
EGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVT
AITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGK
ISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTNEKEQ
FIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGD
LTSLQRTYEDGVNDLPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVEL
VQIGDNVKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHR
TFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLH
SRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVA
PEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDA
IEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDG
LLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035014STKc_cGK
IPR018490cNMP-bd-like
IPR011009Kinase-like_dom_sf
IPR002374cGMP_dep_kinase
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004692cGMP-dependent protein kinase activity
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030553cGMP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 47..98
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 569..763
e-value: 6.9E-109
score: 365.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 482..775
e-value: 6.9E-109
score: 365.3
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 48..101
e-value: 5.7E-19
score: 69.6
NoneNo IPR availablePANTHERPTHR24353:SF68coord: 47..111
coord: 171..794
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 47..111
coord: 171..794
NoneNo IPR availableCDDcd12086DD_cGKI-betacoord: 50..101
e-value: 6.12896E-15
score: 67.3672
IPR002374cGMP-dependent kinasePRINTSPR00104CGMPKINASEcoord: 434..443
score: 70.0
coord: 444..458
score: 32.12
coord: 380..389
score: 67.27
coord: 345..359
score: 66.67
coord: 419..428
score: 81.82
IPR002374cGMP-dependent kinasePIRSFPIRSF000559cGMP-dep_kinasecoord: 32..794
e-value: 0.0
score: 1019.8
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 744..794
e-value: 2.0E-10
score: 50.7
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 744..794
score: 12.438
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 484..743
e-value: 9.0E-85
score: 297.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 486..743
e-value: 4.1E-69
score: 232.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 484..743
score: 46.463
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 339..466
e-value: 3.0E-18
score: 76.6
coord: 221..334
e-value: 3.6E-26
score: 103.0
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 240..321
e-value: 8.1E-18
score: 64.3
coord: 358..448
e-value: 6.4E-16
score: 58.2
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 221..336
score: 33.921
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 339..465
score: 30.216
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 339..456
e-value: 4.36343E-25
score: 98.5521
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 221..328
e-value: 2.13457E-27
score: 105.101
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 338..470
e-value: 6.3E-37
score: 128.1
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 198..337
e-value: 2.4E-49
score: 168.5
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 604..616
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 248..264
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 284..301
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 411..428
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 366..382
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 490..514
IPR035014cGMP-dependent protein kinase, catalytic domainCDDcd05572STKc_cGKcoord: 490..750
e-value: 1.77491E-164
score: 474.406
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 328..454
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 199..321
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 472..784