SMED30014774

Overview
NameSMED30014774
Smed IDSMED30014774
Length (bp)1414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014774 (SMED30014774) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014774 (SMED30014774) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014774

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30014774h1SMcG0012329 SmedASXL_023805SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail regionSMED30014774h1SMcG0012329 dd_Smed_v6_36837_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014774 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000361:20760..22173 -7052
Homology
BLAST of SMED30014774 vs. TrEMBL
Match: A0A504Z6H0 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00944 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 7.178e-29
Identity = 90/327 (27.52%), Postives = 156/327 (47.71%), Query Frame = 2
Query:  314 FDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRA--TKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSLCTEIRDNDNKITDRID--FLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCG 1282
            FDKYL+       +  +  +   +   IP +    ++ +R K E EL +G  FIE    P++  I+AL   + LNC T   +  V+       +F  +LE L R+ + ++++SA++     +  + K L P+DF I  +++K   +     G    T+L        + I PL+ +YY   S SR +     N F++  Y DL ++  +  R L RFI+RN LY+ RRY  +   RL   R ES      T  P+I  +A  R ++ +      +    +    ++   +++I +  M+ +W   +K  +I+V+ E  +CH NC CG
Sbjct:   26 FDKYLL-----TKYSESPINKDRKRVEIPIYFGVPMIILREKHENELAQGKSFIEIEPPPKHV-ISALTSRLLLNCFTVEDIEVVLARIKPVVIFHIILELLRRLPEPLVQLSAKSAQVASRILLLKPLHPYDFTITEELYKEILRYHAEQGEESRTRLKRTKHKQDDTIQPLIQKYYNCISASRYKLTKMHNKFNKCIYHDLHTIGPAIQRNLARFIIRNILYLARRYSISYFRRLCQQRSESWSVGRITIQPHIVQYAYTRFAEVVGPVLISQPGVPEYFQDVEKRTMLNILACGMDRMWLLGQKPHDIIVNMEPSYCHANCVCG 346          
BLAST of SMED30014774 vs. TrEMBL
Match: A0A183X5Z9 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS19799 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.280e-28
Identity = 81/308 (26.30%), Postives = 146/308 (47.40%), Query Frame = 2
Query:  395 IPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPG---------RATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLS--LCTEIRDNDNKITDRIDFLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCGI 1285
            IP      ++ +R K E EL  G  FIE    P    +  L ++I+LNC+T       +R      +F  +LE L R+   ++ ++ +T     K    K   P+DF+I   ++    + +   G         RA K  + IV       PL+  YY  E  +++E I   N F +  + D+  + +   R L RFI+RNC++ +RRY  +  SRLR  R ES   T  ++ P+++ +++ R++  +   L  +    +  +      ++++    ++ +W  ++KV  ILV ++  HCH +C CG+
Sbjct:   49 IPICFGVPMITLREKHERELSLGSSFIEEAKPPSKKAVKTLTDKIFLNCETIEDTKAALRGAKAILIFYVILEMLQRLPSPLLPLTFKTAYNCSKIFFLKPAHPYDFMISENLYSEVKRYYDEIGAEDTTSKYRRAKKPKDEIV------HPLIQTYYLQEEPTKLELIKSNNKFIKCIFHDIHLIGNINQRNLIRFIIRNCIHFVRRYNISCVSRLRKQRGESWTMTNISTTPHVNEYSVRRIADLVGPLLMKQPGVPEFFVDVEKHIMVNLLHNDVDRLWLPKQKVHEILVESDIPHCHTDCICGL 350          
BLAST of SMED30014774 vs. TrEMBL
Match: A0A183B7V9 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS15295 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.473e-28
Identity = 93/329 (28.27%), Postives = 155/329 (47.11%), Query Frame = 2
Query:  308 VKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGR--ATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSLCTEIRDNDNKITDRID--FLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCG 1282
            + FDKYL  L   +D P        E   IP +    ++ +R K E EL +G  FIE    P+N  I AL + + +NC T   +  V+       +F  +LE L RI + +I +SA+      +  + + L P+DF I  ++++   +     G    ++         + I PL+ +YY   S SR +     N F++  Y DL ++ S+  R L RFI+RN LY+ RRY  +   RL   R ES      T+  +I  +A  R++  +      +    +    ++   +++I S  M+ +W   +K  +I+V+ E  +CH NC CG
Sbjct:   24 MDFDKYL--LTAYSDSPINKDRKRIE---IPIYFGVPMIILREKHENELAQGKSFIELEPPPRNV-IEALTDRLLMNCFTVEDIQVVLSRIKPVVIFHIILELLRRIPEPLIPLSAKAAQVASRVLLLEPLHPYDFTISDELYREILRYHAEQGEENTSRFKRNKHKHDDTIQPLIQKYYHCMSISRYKLTKMYNKFNKCIYHDLHTIGSTLQRNLARFIIRNVLYLARRYTISYFRRLCQQRGESWPVGRITTQQHIVQYAYTRLADAVGPVLISQPGTPEYYPDVEKRAMLNILSCGMDRMWLTGQKPPDIIVNMEPSYCHANCVCG 346          
BLAST of SMED30014774 vs. TrEMBL
Match: A0A4E0RIZ5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_001638 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.728e-28
Identity = 89/327 (27.22%), Postives = 156/327 (47.71%), Query Frame = 2
Query:  314 FDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRA--TKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSLCTEIRDNDNKITDRID--FLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCG 1282
            FDKYL+       +  +  +   +   IP +    ++ +R K E EL +G  FIE    P++  I+AL   + LNC T   +  V+       +F  +LE L R+ + ++++SA++     +  + K L P+DF I  ++++   +     G    T+L        + I PL+ +YY   S SR +     N F++  Y DL ++  +  R L RFI+RN LY+ RRY  +   RL   R ES      T  P+I  +A  R ++ +      +    +    ++   +++I +  M+ +W   +K  +I+V+ E  +CH NC CG
Sbjct:   26 FDKYLL-----TKYSESPINKDRKRVEIPIYFGVPMIILREKHENELAQGKSFIEIEPPPKHV-ISALTSRLLLNCFTVEDIEVVLARIKPVVIFHIILELLRRLPEPLVQLSAKSAQVASRILLLKPLHPYDFTITEELYREILRYHAEQGEESRTRLKRTKHKQDDTIQPLIQKYYNCISASRYKLTKMHNKFNKCIYHDLHTIGPAIQRNLARFIIRNILYLARRYSISYFRRLCQQRSESWSVGRITIQPHIVQYAYTRFAEVVGPVLISQPGVPEYFQDVEKRTMLNILACGMDRMWLLGQKPHDIIVNMEPSYCHANCVCG 346          
BLAST of SMED30014774 vs. TrEMBL
Match: A0A4S2LN69 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007344 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.153e-20
Identity = 79/300 (26.33%), Postives = 142/300 (47.33%), Query Frame = 2
Query:  395 IPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRATKLTNRIVLDI--NYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSLCTEIRDNDNKITDRID--FLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCG 1282
            IP F    ++ +R K E EL  G  FIE+ + P    + AL + I LNC + S +  ++       +F A+L+ L R+   ++ +S ++     K  + + L P+ FV+   ++    +     G  T    +   D   + I PL+ +YY      R +   + N F++  Y DL  +     R+L RFILRN +++ RRY     ++LR  R E       T  P+I  ++I RM++ +      +  + +    ++   + +I +  M+ +W   +K  +I+V+ E  +CH NC CG
Sbjct:   51 IPIFFGVPMVILREKHEIELANGRSFIEA-EAPAPQMVKALVDRILLNCISESDIRAILERIKPVVIFYAILDLLRRLPAPLLALSPKSAQITSKVLLLEPLHPYGFVVEEDLYCTILRQHAEQGEDTTSRFKRAKDKANDMIQPLIQKYYSCAEPVRTKITRKFNKFNKCIYHDLHLITDIDQRHLARFILRNMIFLTRRYNICKFNQLRERRGERWPVACITIRPHILEYSITRMAELVGPVVISQPGEPEYYPDLEKRAMFNILASGMDRMWLPNQKPHDIIVNMEPSYCHSNCVCG 349          
BLAST of SMED30014774 vs. Planmine SMEST
Match: SMESG000002441.1 (SMESG000002441.1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 290/290 (100.00%), Postives = 290/290 (100.00%), Query Frame = 2
Query:  128 MVTHTNTNPRSKDSKKQXXXXXXXXXXXXXXXXXXXXXXXIKIKLFPDKFYFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYV 997
            MVTHTNTNPRSKDSKKQLSTLDLGSLLLSTKSESLEEPSEIKIKLFPDKFYFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYV
Sbjct:    1 MVTHTNTNPRSKDSKKQLSTLDLGSLLLSTKSESLEEPSEIKIKLFPDKFYFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFVTPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYV 290          

HSP 2 Score: 94.3597 bits (233), Expect = 4.145e-21
Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 1
Query: 1000 CNEFQITTFAKGITEGNNDNISAIHFWLCNFSNVTIFISLHGNSR 1134
            CNEFQITTFAKGITE NNDNISAIHFWLCNFSNVTIFISLHGNSR
Sbjct:  292 CNEFQITTFAKGITERNNDNISAIHFWLCNFSNVTIFISLHGNSR 336          
BLAST of SMED30014774 vs. Planmine SMEST
Match: SMESG000016347.1 (SMESG000016347.1)

HSP 1 Score: 253.447 bits (646), Expect = 4.058e-80
Identity = 142/348 (40.80%), Postives = 219/348 (62.93%), Query Frame = 2
Query:  254 IKLFPDKFYFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFV---TPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSL-CTEIRDNDNKITDRIDFLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCGI 1285
            I   P   Y++  ++   VKF++YLML+ED ++      + S  LTPIP FIAYL+LAIR KFE+ELK  ICF+E   FP    I  LA+++YLN +TY+ VL+   +  C  +F  LLE L+R E  +++ S+ET  FV K + F+  RP++F+I+ Q+ K+ T  ++   T  R  K    + + +N +  ++  YY  ++ ++IE +   N F++L Y+D R  K++ HRYL RFILRNCLY+IRRYVC   +R+RLLRKES      T +  ++ FAI RM++FL+   TEI   +N + DR+  L ++FSI  E +++RQ+K  +I+++T+  +CH  C CG+
Sbjct:   16 INQLPPILYYQNFKRLPCVKFERYLMLIEDCSENTINDKEKSEALTPIPKFIAYLVLAIRGKFEKELKNRICFLECETFPNQSSIIKLAKQLYLNSETYANVLEATIDCDCLLLFCTLLELLNRFEHKLLQFSSETSEFVAKESFFEACRPNEFIIVDQLTKYLTNIYLKKKTDVRNKKKNENLPI-LNNLGKIVQSYYAIKNYNKIEAVDFHNKFYKLIYRDFRQTKTTMHRYLFRFILRNCLYLIRRYVCVVGNRIRLLRKESWITANQTVIINVNTFAIHRMAKFLACSVTEIMGPNNFLNDRVLLLENVFSIESEALFYRQKKFEDIMINTDPTYCHTGCVCGM 362          
BLAST of SMED30014774 vs. Planmine SMEST
Match: SMESG000023861.1 (SMESG000023861.1)

HSP 1 Score: 251.521 bits (641), Expect = 1.901e-79
Identity = 141/348 (40.52%), Postives = 218/348 (62.64%), Query Frame = 2
Query:  254 IKLFPDKFYFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILAIRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRNETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILGQIHKFTTQCFV---TPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEIIQRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLLRKESPKETTTTSVPYISGFAIFRMSQFLSL-CTEIRDNDNKITDRIDFLMSIFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCGI 1285
            I   P   Y++  ++   VKF++YLML+ED ++      + S  LTPIP FIAYL+LAIR KFE+ELK  ICF+E    P    I  LA+++YLN +TY+ VL+   +  C  +F  LLE L+R E  +++ S+ET  FV K + F+  RP++F+I+ Q+ K+ T  ++   T  R  K    + + +N +  ++  YY  ++ ++IE +   N F++L Y+D R  K++ HRYL RFILRNCLY+IRRYVC   +R+RLLRKES      T +  ++ FAI RM++FL+   TEI   +N + DR+  L ++FSI  E +++RQ+K  +I+++T+  +CH  C CG+
Sbjct:   16 INQLPPILYYQNFKRLPCVKFERYLMLIEDCSENTINDKEKSKALTPIPKFIAYLVLAIRGKFEKELKNRICFLECETLPNQSSIIKLAKQLYLNSETYANVLEATIDCDCLLLFCTLLELLNRFEHKLLQFSSETSEFVAKESFFEACRPNEFIIVDQLTKYLTNIYLKKKTDVRNKKKNENLPI-LNNLGKIVQSYYAIKNYNKIEAVDFHNKFYKLIYRDFRQTKTTMHRYLFRFILRNCLYLIRRYVCVVGNRIRLLRKESWITANQTVIINVNTFAIHRMAKFLACSVTEIMGPNNFLNDRVLLLENVFSIESEALFYRQKKFEDIMINTDPTYCHTGCVCGM 362          
The following BLAST results are available for this feature:
BLAST of SMED30014774 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z6H07.178e-2927.52Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A183X5Z91.280e-2826.30Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A183B7V91.473e-2828.27Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4E0RIZ51.728e-2827.22Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4S2LN691.153e-2026.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30014774 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014774 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000002441.14.145e-21100.00SMESG000002441.1[more]
SMESG000016347.14.058e-8040.80SMESG000016347.1[more]
SMESG000023861.11.901e-7940.52SMESG000023861.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014774 ID=SMED30014774|Name=SMED30014774|organism=Schmidtea mediterranea sexual|type=transcript|length=1414bp
AAATAAAATTTAATAATTAAATCGAAATATTGCAATTAAATTTCTTTCAA
TTCAAAATATATTATATTCATTGACATAAATTTACAGACAATAAGCAGAG
ACTCTTAGAATTTTGTGGAATTCAACGATGGTCACTCATACTAATACAAA
TCCCAGATCTAAGGATTCGAAAAAGCAGCTAAGCACATTAGATCTTGGCA
GTTTGCTGTTGTCAACAAAAAGTGAAAGTCTAGAGGAACCGTCAGAAATT
AAAATAAAATTATTTCCAGATAAATTTTATTTCAAACAAATGAGAAAAGA
AAAACATGTCAAATTCGACAAGTATTTAATGTTGCTTGAAGATCGAAATG
ATTTTCCAACCGCTCTTACGGATAATTCTTTTGAATTGACTCCGATTCCG
AACTTTATTGCTTATTTGATATTGGCAATCAGAGCGAAATTTGAAGAAGA
ACTTAAAAAAGGAATTTGTTTCATAGAAAGCAATGATTTCCCTCAGAACT
TTGAAATAACGGCATTGGCGGAAGAAATATATCTTAACTGTGACACTTAC
TCAGGCGTGTTAGACGTGGTTCGAAATGAAACTTGCCAAAAGATGTTTCT
AGCATTGTTGGAATTTCTCCATCGAATAGAACAATGCATCATCAGAATTT
CGGCGGAAACAATGAATTTCGTTAAAAAATCCGCTATATTTAAATTTCTA
CGACCTCACGATTTTGTTATATTAGGTCAGATACACAAATTCACGACCCA
GTGCTTTGTAACTCCAGGTCGAGCAACTAAGCTTACCAATAGAATTGTTC
TAGACATTAACTACATAGACCCCCTATTAATAAGGTACTATTTCGATGAA
TCAAAGTCAAGAATAGAAGAAATTATTCAACGAAACAATTTCCATCAACT
ATTTTATCAGGATTTAAGGTCGCTGAAATCATCAACACATCGCTATCTTT
GTAGGTTCATTTTGCGCAATTGTCTTTACATGATTCGGCGTTACGTTTGT
GCAACGAGTTCCAGATTACGACTTTTGCGAAAGGAATCACCGAAGGAAAC
AACGACAACATCAGTGCCATACATTTCTGGCTTTGCAATTTTTCGAATGT
CACAATTTTTATCTCTTTGCACGGAAATTCGAGATAATGACAATAAAATA
ACTGATAGAATTGACTTCCTGATGAGTATATTCTCAATTCATATGGAAAA
TATCTGGTTCCGACAACGGAAGGTCTCCAACATTCTAGTGTCAACGGAAG
AGGAACATTGCCATGAAAATTGTCCTTGTGGTATTTAAAGAAAAATTTAT
CGACATAAATCTTTTAGTTTTCAATTCAAAATTTGTGCATATTGTATTGA
TTAAGTGTGAATAAAACAATAAATTCATAATTTAAATTTATTAAATTTTT
TTCGTGTTCACCCG
back to top

protein sequence of SMED30014774-orf-1

>SMED30014774-orf-1 ID=SMED30014774-orf-1|Name=SMED30014774-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=387bp
MVTHTNTNPRSKDSKKQLSTLDLGSLLLSTKSESLEEPSEIKIKLFPDKF
YFKQMRKEKHVKFDKYLMLLEDRNDFPTALTDNSFELTPIPNFIAYLILA
IRAKFEEELKKGICFIESNDFPQNFEITALAEEIYLNCDTYSGVLDVVRN
ETCQKMFLALLEFLHRIEQCIIRISAETMNFVKKSAIFKFLRPHDFVILG
QIHKFTTQCFVTPGRATKLTNRIVLDINYIDPLLIRYYFDESKSRIEEII
QRNNFHQLFYQDLRSLKSSTHRYLCRFILRNCLYMIRRYVCATSSRLRLL
RKESPKETTTTSVPYISGFAIFRMSQFLSLCTEIRDNDNKITDRIDFLMS
IFSIHMENIWFRQRKVSNILVSTEEEHCHENCPCGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000331Rap_GAP_dom
Vocabulary: biological process
TermDefinition
GO:0051056regulation of small GTPase mediated signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity