SMED30014770

Overview
NameSMED30014770
Smed IDSMED30014770
Length (bp)1684
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014770 (SMED30014770) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014770 (SMED30014770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014770 (SMED30014770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014770 (SMED30014770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014770h1SMcG0005730 SmedASXL_014024SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30014770h1SMcG0005730 dd_Smed_v4_5831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014770 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009558:17215..19615 +7877
Homology
BLAST of SMED30014770 vs. TrEMBL
Match: A0A4D9AM76 (H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Salvia splendens OX=180675 GN=NAF1 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.649e-6
Identity = 69/228 (30.26%), Postives = 95/228 (41.67%), Query Frame = 3
Query:  636 VDKETELEYLLPVDLEQKLSNIVISVNAALEI------VGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKS-ESIAASFRGGESL-FCAPGV-----QNAYFTAGGDLIDTHNENDSDVA----FSDDDKEEAYRRAVLGQQPATARKKKPNRKRKTAAANRNGSFHQNNRQINPFRAVVNFQPFANQQRPVPYWQAPVNQ 1268
            +  + ELE L PV           SVN  LE       VGTV+  I G Q I     + DP+ + + + +  ++  +GIID IFG  K P Y+    S E +    + G  + F A         N  +  G    D  NEND +++    FSDD+KE  YRR ++  +   A   KPN KRK     +N     NN       +     P    QR  P    P NQ
Sbjct:  280 IKSKNELEDLPPVP----------SVNVTLEPHHETLPVGTVLSMI-GAQVIVEGVEKHDPLNEGSILWITESRSPMGIIDEIFGPVKNPFYIVRYNSEEEVPTGIQQGTLISFVAEFADHVLNNNNLYQKG---YDASNENDEELSEDGEFSDDEKEAEYRR-MMKMKKRGANDYKPNNKRKEKRQQKNQRRSWNNN-----NSTAQTPPGGEDQRFAPRVGTPSNQ 487          
BLAST of SMED30014770 vs. TrEMBL
Match: A0A445E085 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A03g015378 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 8.167e-6
Identity = 51/178 (28.65%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  636 VDKETELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSES-IAASFRGGESLFCAPGVQNAYFTAGGDL----IDTHNENDSDVA----FSDDDKEEAYRR----AVLGQQPATARKKKPNRKR 1130
            +  + ELE L PV       N+ +  +  +  VG V+ ++ G + I     + DP+ + + + +  +++ +G+ID IFG  K P Y+    SE+ +    +GG S+   P   N Y     DL     D    ND +++    FSDD+KE  YRR    A  G       K K N+K+
Sbjct:  168 IKSKNELEDLPPV----PPINVTLEPSHQMRPVGVVMSKL-GAKVIVEGVEKHDPLSEGSILWITESRKPLGLIDEIFGPVKNPYYVVRYNSENEVPTEVQGGTSISFVPEFAN-YVLNNKDLYKKGYDASGANDEELSDELEFSDDEKEAEYRRMQRMAKRGPNDQNPSKSKHNKKK 339          
BLAST of SMED30014770 vs. TrEMBL
Match: A0A2K3ML83 (H/ACA ribonucleoprotein complex subunit (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g047641 PE=3 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 9.300e-6
Identity = 48/168 (28.57%), Postives = 81/168 (48.21%), Query Frame = 3
Query:  696 NIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSES-IAASFRGGESLF-CAPGVQNA------YFTAGGDLIDTHNENDSD-VAFSDDDKEEAYR-------RAVLGQQPATARKKKPNRKRKTAAANR 1151
            ++ +  +  +  VG V+  + G Q I     + +P+ + + + L  +++ +G++D IFG  K P Y+    SES + A  +GG +L  C P   +        +  G D    ++E  SD V FSDD+KE  YR       R V  Q P    K+K N+K+ +   +R
Sbjct:    9 DVTLEPHHKMLPVGVVMSTL-GAQVIVEGVEKHEPLNEGSILWLTESRKPLGLVDEIFGPVKNPYYIVRYNSESEVPAGIQGGTTLVSCVPEYADRVLNNKDLYRKGYDASGANDEELSDEVEFSDDEKEAEYRKMQKMTKRGVNDQNPD---KRKNNKKKFSPRDHR 172          
BLAST of SMED30014770 vs. Planmine SMEST
Match: SMESG000072181.1 (SMESG000072181.1)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 454/471 (96.39%), Postives = 456/471 (96.82%), Query Frame = 3
Query:   51 MDELLDEFIKSEETYYLNKTNAXXXXXXXXXXXXXXXXXXXXXXXXRDFEGEIKDEYEIRDFDLEELENICGSNLYNSTIDSMINDDGELRENFIKSSYFEDCLLENYDNREINLNEIDEEDLLRIKNEIKDCYEMQKHRNHIXXXXXXXXXXXXXXXXXIAEVELSKPGGILNSLLASKKKKISHKETTRKGRIVDKETELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSESIAASFRGGESLFCAPGVQNAYFTAGGDLIDTHNENDSDVAFSDDDKEEAYRRAVLGQQPATARKKKPNRKRKTAAANRNGSFHQNNRQINPFRAVVNFQPFANQQRPVPYWQAPVNQXXXXXXXXXXXXHFQPIQMSSGQYXXXXXXXXXXXXXXXXXXXXXQCTSFEQFQQLYFGPGKQRR 1463
            MDELLDEFIKSEETYYLNKTN+NETNINEDESESDEEG             EIKDEYEIRDFDLEELENICGSNLYNSTIDSMINDDGELRENFIKSSYFEDCLLENYDNREINLNEIDEEDLLRIKNEIKDCYEMQKHRNHIES+SESSESDDDDDLDSIAEVELSKPGGILNSLLASKKKKISHKETTRKGRIVDKETELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSESIAASF GGESLFCAPGVQNAYFTAGGDLIDTHNENDSDVAFSDDDKEEAYRRAVLGQQPATARKKKPNRKRKTAAANRNGSFHQNNRQINPFRAVVNFQPFANQQRPVPYWQAPVNQMMMSMPPPLPT HFQPIQMSSGQYSQPASQSFFNFPPPPIINSANQCTSFEQFQQLYFGPGKQRR
Sbjct:    1 MDELLDEFIKSEETYYLNKTNSNETNINEDESESDEEG-------------EIKDEYEIRDFDLEELENICGSNLYNSTIDSMINDDGELRENFIKSSYFEDCLLENYDNREINLNEIDEEDLLRIKNEIKDCYEMQKHRNHIESDSESSESDDDDDLDSIAEVELSKPGGILNSLLASKKKKISHKETTRKGRIVDKETELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSESIAASFHGGESLFCAPGVQNAYFTAGGDLIDTHNENDSDVAFSDDDKEEAYRRAVLGQQPATARKKKPNRKRKTAAANRNGSFHQNNRQINPFRAVVNFQPFANQQRPVPYWQAPVNQMMMSMPPPLPTQHFQPIQMSSGQYSQPASQSFFNFPPPPIINSANQCTSFEQFQQLYFGPGKQRR 458          
BLAST of SMED30014770 vs. Planmine SMEST
Match: SMESG000039423.1 (SMESG000039423.1)

HSP 1 Score: 499.975 bits (1286), Expect = 6.940e-175
Identity = 262/313 (83.71%), Postives = 286/313 (91.37%), Query Frame = 3
Query:  207 IKDEYEIRDFDLEELENICGSNLYNSTIDSMINDDGELRENFIKSSYFEDCLLENYDNREINLNEIDEEDLLRIKNEIKDCYEMQKHRNHIXXXXXXXXXXXXXXXXXIAEVELSKPGGILNSLLASKKKKISHKETTRKGRIVDKETELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSESIAASFRGGESLFCAPGVQNAYFTAGGDLIDTHNENDSDVAFSDDDKEEAYRRAVLGQQPATARKKKPNRKRKTAAA 1145
            IKDEYE+RDFDLEELENIC S+LY+ST+ SMINDDGEL+ENFI+SSYF+DCLL N DN+EINLN+IDE+DLLRIKN+IKDCYEMQKHRNHIES+SES ESDDD D   I+E +LSKPGGILNSLLASK    SHKETTRKGRI DK++ELEYLLPV  EQKLSNIVISVNAALEI+GTVIQRIDGTQTITIKAARSDPIVDLNSIVLD +KRMIGII+NIFGTKKEPLYL VCKSESIAASF+ GESLFCAPGVQNAYFTA GD+IDTHNENDSDVAFSDD+KEEAY+R VLGQQPATARKKK NRK +   A
Sbjct:   80 IKDEYEMRDFDLEELENICDSDLYSSTVGSMINDDGELKENFIESSYFDDCLLGNNDNKEINLNDIDEDDLLRIKNQIKDCYEMQKHRNHIESDSESEESDDDLDS--ISEADLSKPGGILNSLLASKN---SHKETTRKGRIFDKKSELEYLLPVGFEQKLSNIVISVNAALEILGTVIQRIDGTQTITIKAARSDPIVDLNSIVLDRDKRMIGIINNIFGTKKEPLYLVVCKSESIAASFQSGESLFCAPGVQNAYFTASGDMIDTHNENDSDVAFSDDEKEEAYQRVVLGQQPATARKKKHNRKTENRFA 387          
The following BLAST results are available for this feature:
BLAST of SMED30014770 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A4D9AM761.649e-630.26H/ACA ribonucleoprotein complex non-core subunit N... [more]
A0A445E0858.167e-628.65Uncharacterized protein OS=Arachis hypogaea OX=381... [more]
A0A2K3ML839.300e-628.57H/ACA ribonucleoprotein complex subunit (Fragment)... [more]
back to top
BLAST of SMED30014770 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014770 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072181.10.000e+096.39SMESG000072181.1[more]
SMESG000039423.16.940e-17583.71SMESG000039423.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014770 ID=SMED30014770|Name=SMED30014770|organism=Schmidtea mediterranea sexual|type=transcript|length=1684bp
GTGTTTGGTTTTAAAACTCTTACTTTTCAATTTTTCAATTTTAAATTAAC
ATGGATGAGCTATTAGATGAATTTATCAAAAGTGAAGAAACCTACTATCT
AAACAAAACTAACGCGAATGAAACTAATATAAATGAAGATGAAAGCGAAT
CAGACGAAGAAGGTGAAATCAAAGATGAATATGAAATTAGAGATTTTGAA
GGTGAAATCAAAGATGAATATGAAATTAGAGATTTTGATTTAGAAGAATT
AGAAAACATTTGCGGCTCTAATTTGTACAACAGTACGATAGATAGTATGA
TTAATGATGATGGGGAATTAAGGGAAAATTTCATAAAAAGTAGTTATTTT
GAAGACTGCCTACTTGAAAACTATGATAACAGAGAAATAAATCTGAATGA
AATTGACGAAGAGGATTTATTGCGAATAAAAAACGAAATAAAAGATTGCT
ATGAGATGCAAAAACATAGAAATCATATTGAATCCAATTCAGAATCTTCG
GAAAGTGATGATGACGATGATTTGGATTCGATCGCAGAAGTTGAATTGTC
GAAACCCGGAGGAATATTAAACAGCTTATTGGCCAGCAAGAAGAAAAAGA
TCTCACATAAAGAAACCACAAGAAAAGGAAGAATCGTCGATAAAGAAACG
GAACTGGAATACCTGCTGCCGGTGGATCTCGAGCAGAAACTGAGCAACAT
TGTCATCTCGGTGAACGCGGCGCTGGAAATCGTTGGCACAGTCATTCAAC
GGATCGACGGAACACAAACTATCACGATCAAGGCAGCCAGATCCGATCCG
ATTGTCGATTTGAACTCGATCGTGTTGGACAGTAACAAACGCATGATCGG
AATTATCGATAACATATTCGGCACCAAGAAGGAACCGCTTTATCTGGCTG
TGTGCAAATCAGAATCGATTGCTGCCTCGTTCCGTGGCGGAGAGTCACTG
TTCTGTGCTCCCGGAGTCCAAAATGCCTATTTCACTGCCGGCGGCGATCT
GATCGATACCCACAATGAGAATGATAGTGATGTTGCATTCAGTGATGACG
ATAAGGAGGAGGCGTATCGACGCGCCGTACTCGGCCAGCAACCCGCTACT
GCCAGGAAGAAAAAACCGAATAGGAAACGGAAAACCGCAGCGGCCAATCG
CAATGGATCATTTCATCAAAATAATAGGCAAATCAATCCATTCCGTGCAG
TGGTCAATTTCCAGCCGTTTGCCAATCAGCAACGGCCGGTTCCCTATTGG
CAGGCACCAGTCAATCAGATGATGATGTCGATGCCGCCGCCGCTGCCAAC
ACCACATTTCCAACCAATACAAATGAGTAGTGGACAATATTCTCAACCGG
CTAGCCAATCATTCTTCAATTTCCCTCCGCCACCAATCATAAATTCCGCT
AATCAATGCACGTCATTCGAACAATTCCAACAGCTCTATTTTGGACCCGG
TAAACAACGACGATGACTGTCAATTGTTTCCAAAAAATAATAATAGATTT
ATGTGGTCTTTGCTTTTTGATCTGTGTCTCATTTGATGTTTGTTGGATCC
GTTGCGCATTCCATTCGGCCTTTTGTACATTTTTAGAACCGGTTCACAGC
ATTTTATTTATATATTGCAATGAAATCAGTCGTTTCTGTTATCATTGATT
TCCGCGCCTCTTATAACCAGCATTTGATGAAATA
back to top

protein sequence of SMED30014770-orf-1

>SMED30014770-orf-1 ID=SMED30014770-orf-1|Name=SMED30014770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MDELLDEFIKSEETYYLNKTNANETNINEDESESDEEGEIKDEYEIRDFE
GEIKDEYEIRDFDLEELENICGSNLYNSTIDSMINDDGELRENFIKSSYF
EDCLLENYDNREINLNEIDEEDLLRIKNEIKDCYEMQKHRNHIESNSESS
ESDDDDDLDSIAEVELSKPGGILNSLLASKKKKISHKETTRKGRIVDKET
ELEYLLPVDLEQKLSNIVISVNAALEIVGTVIQRIDGTQTITIKAARSDP
IVDLNSIVLDSNKRMIGIIDNIFGTKKEPLYLAVCKSESIAASFRGGESL
FCAPGVQNAYFTAGGDLIDTHNENDSDVAFSDDDKEEAYRRAVLGQQPAT
ARKKKPNRKRKTAAANRNGSFHQNNRQINPFRAVVNFQPFANQQRPVPYW
QAPVNQMMMSMPPPLPTPHFQPIQMSSGQYSQPASQSFFNFPPPPIINSA
NQCTSFEQFQQLYFGPGKQRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038664Gar1/Naf1_Cbf5-bd_sf
IPR040309Naf1
IPR007504H/ACA_rnp_Gar1/Naf1
IPR009000Transl_B-barrel_sf
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0000493box H/ACA snoRNP assembly
GO:0042254ribosome biogenesis
GO:0001522pseudouridine synthesis
Vocabulary: cellular component
TermDefinition
GO:0005732small nucleolar ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038664H/ACA RNP complex subunit Gar1/Naf1, Cbf5-binding domainGENE3DG3DSA:2.40.10.230coord: 204..290
e-value: 5.0E-8
score: 34.7
IPR007504H/ACA ribonucleoprotein complex, subunit Gar1/Naf1PFAMPF04410Gar1coord: 203..329
e-value: 9.2E-16
score: 58.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 330..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 20..39
NoneNo IPR availablePANTHERPTHR31633:SF1H/ACA RIBONUCLEOPROTEIN COMPLEX NON-CORE SUBUNIT NAF1coord: 22..448
IPR040309H/ACA ribonucleoprotein complex non-core subunit Naf1PANTHERPTHR31633FAMILY NOT NAMEDcoord: 22..448
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 213..288