RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30014750
Length (bp)1354
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30014750) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30014750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30014750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014750SMESG000063924.1 SmedASXL_004848SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014750SMESG000063924.1 SmedASXL_004848SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30014750SMESG000063924.1 dd_Smed_v4_1760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014750SMESG000063924.1 dd_Smed_v4_1760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014750SMESG000063924.1 dd_Smed_v4_1760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014750SMESG000063924.1 dd_Smed_v4_1760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014750SMESG000063924.1 dd_Smed_v4_1760_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 80.8777 bits (198), Expect = 3.394e-17
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 100          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 80.8777 bits (198), Expect = 3.471e-17
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 100          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 80.8777 bits (198), Expect = 3.471e-17
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 100          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 81.6481 bits (200), Expect = 1.249e-16
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  110 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 201          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: TRA2B (transformer 2 beta homolog [Source:HGNC Symbol;Acc:HGNC:10781])

HSP 1 Score: 76.2554 bits (186), Expect = 1.682e-15
Identity = 36/92 (39.13%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    P+  +G+FGLS  TTE  L ++F KYG I  + +V ++++  SRG++F+ +E++D A +A +   G  +DGR IR+D+S  KR +
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPH 100          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 71.2478 bits (173), Expect = 1.631e-13
Identity = 35/90 (38.89%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  485 RDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            R+  +PS  +G+F LS  TTE  L  +F ++G+IN   LV +R +G SRG+ FI +  I+ A  A  +     +DG +IR+D+S  KR +
Sbjct:   69 RENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGH 158          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 71.2478 bits (173), Expect = 1.631e-13
Identity = 35/90 (38.89%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  485 RDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            R+  +PS  +G+F LS  TTE  L  +F ++G+IN   LV +R +G SRG+ FI +  I+ A  A  +     +DG +IR+D+S  KR +
Sbjct:   69 RENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGH 158          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: cpf-2 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:O45577])

HSP 1 Score: 66.6254 bits (161), Expect = 7.473e-12
Identity = 32/86 (37.21%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  509 TVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNG 766
            +V +  +S   +ED +  IF K G + S+K+V +RETG+ +GY FIE+ DI +A  A++   G  + GR +R+D + G  N +  G
Sbjct:   19 SVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDSAAGGMNMEEFG 104          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: cpf-2 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:O45577])

HSP 1 Score: 66.6254 bits (161), Expect = 7.473e-12
Identity = 32/86 (37.21%), Postives = 52/86 (60.47%), Query Frame = 2
Query:  509 TVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNG 766
            +V +  +S   +ED +  IF K G + S+K+V +RETG+ +GY FIE+ DI +A  A++   G  + GR +R+D + G  N +  G
Sbjct:   19 SVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDSAAGGMNMEEFG 104          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: rbm-3.1 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45712])

HSP 1 Score: 55.8398 bits (133), Expect = 6.634e-10
Identity = 25/67 (37.31%), Postives = 46/67 (68.66%), Query Frame = 2
Query:  536 KTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYS 736
            +TTE+ L   F   G+IN++++V +RETG  RG++FIE+ +  SA +A+++  G   +GR +R++ +
Sbjct:   15 QTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAEFNGRPLRVNLA 81          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089616)

HSP 1 Score: 77.0258 bits (188), Expect = 2.810e-16
Identity = 33/91 (36.26%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            +R++ + S  +G+FGL+  T++  + ++F+KYG I  +++V++ +T  SRG+ FI +E +  A  A   C G  VDGR IR+D+S  +R +
Sbjct:    4 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAH 94          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089615)

HSP 1 Score: 77.411 bits (189), Expect = 6.698e-16
Identity = 33/91 (36.26%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            +R++ + S  +G+FGL+  T++  + ++F+KYG I  +++V++ +T  SRG+ FI +E +  A  A   C G  VDGR IR+D+S  +R +
Sbjct:   51 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAH 141          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089619)

HSP 1 Score: 77.411 bits (189), Expect = 6.698e-16
Identity = 33/91 (36.26%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            +R++ + S  +G+FGL+  T++  + ++F+KYG I  +++V++ +T  SRG+ FI +E +  A  A   C G  VDGR IR+D+S  +R +
Sbjct:   51 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAH 141          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089620)

HSP 1 Score: 77.411 bits (189), Expect = 1.097e-15
Identity = 33/91 (36.26%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            +R++ + S  +G+FGL+  T++  + ++F+KYG I  +++V++ +T  SRG+ FI +E +  A  A   C G  VDGR IR+D+S  +R +
Sbjct:   89 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAH 179          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089621)

HSP 1 Score: 77.411 bits (189), Expect = 1.097e-15
Identity = 33/91 (36.26%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            +R++ + S  +G+FGL+  T++  + ++F+KYG I  +++V++ +T  SRG+ FI +E +  A  A   C G  VDGR IR+D+S  +R +
Sbjct:   89 SREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAH 179          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 80.8777 bits (198), Expect = 3.332e-17
Identity = 36/85 (42.35%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID A +A++   G  +DGR IR+DYS  KR +
Sbjct:  104 PNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 188          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 80.8777 bits (198), Expect = 3.332e-17
Identity = 36/85 (42.35%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID A +A++   G  +DGR IR+DYS  KR +
Sbjct:  104 PNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 188          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 81.6481 bits (200), Expect = 9.557e-17
Identity = 36/85 (42.35%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID A +A++   G  +DGR IR+DYS  KR +
Sbjct:  133 PNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 217          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 81.2629 bits (199), Expect = 1.272e-16
Identity = 36/85 (42.35%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID A +A++   G  +DGR IR+DYS  KR +
Sbjct:  133 PNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPH 217          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: cirbpa (cold inducible RNA binding protein a [Source:ZFIN;Acc:ZDB-GENE-050417-329])

HSP 1 Score: 70.4774 bits (171), Expect = 9.175e-14
Identity = 36/71 (50.70%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            I GLS  TTE +L   F KYG I ++ +  NRET  SRG+ F+ +E+ D A  AL+   GKSVDGR IR+D
Sbjct:    9 IGGLSFDTTEQSLEDAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGMNGKSVDGRTIRVD 79          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: plekhg5 (pleckstrin homology and RhoGEF domain containing G5 [Source:Xenbase;Acc:XB-GENE-6039487])

HSP 1 Score: 79.7221 bits (195), Expect = 4.609e-16
Identity = 36/92 (39.13%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E I+ + +A++   G  +DGR IR+DYS  KR +
Sbjct:  105 GSRANPDPNICIGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIEDSREAMEHANGMELDGRRIRVDYSITKRAH 196          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: rit1 (Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GENE-5777077])

HSP 1 Score: 78.5666 bits (192), Expect = 2.004e-15
Identity = 37/92 (40.22%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    P+  +G+FGLS  TTE  L ++F KYG I+ + +V ++++  SRG+SF+ +E++D A +A +   G  +DGR IR+D+S  KR +
Sbjct:  144 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPH 235          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 67.781 bits (164), Expect = 1.129e-12
Identity = 30/71 (42.25%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GL+ +TTE++L ++F KYG++  + +V +RE+  SRG+ F+ +E+ + A  A+    GKSVDGR+IR+D
Sbjct:   10 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 80          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 67.0106 bits (162), Expect = 2.061e-12
Identity = 30/71 (42.25%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GL+ +TTE++L ++F KYG++  + +V +RE+  SRG+ F+ +E+ + A  A+    GKSVDGR+IR+D
Sbjct:   22 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 92          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 66.6254 bits (161), Expect = 2.263e-12
Identity = 30/71 (42.25%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GL+ +TTE++L ++F KYG++  + +V +RE+  SRG+ F+ +E+ + A  A+    GKSVDGR+IR+D
Sbjct:   22 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 92          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 81.6481 bits (200), Expect = 8.333e-17
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 199          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 81.6481 bits (200), Expect = 8.574e-17
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 199          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Cirbp (cold inducible RNA binding protein [Source:MGI Symbol;Acc:MGI:893588])

HSP 1 Score: 74.7146 bits (182), Expect = 5.430e-16
Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYS 736
            + GLS  T E AL ++F KYG+I+ + +V +RET  SRG+ F+ +E+ID A  A+    GKSVDGR+IR+D +
Sbjct:   10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA 82          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Cirbp (cold inducible RNA binding protein [Source:MGI Symbol;Acc:MGI:893588])

HSP 1 Score: 75.8702 bits (185), Expect = 1.146e-15
Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GLS  T E AL ++F KYG+I+ + +V +RET  SRG+ F+ +E+ID A  A+    GKSVDGR+IR+D
Sbjct:   10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD 80          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Tra2b (transformer 2 beta [Source:MGI Symbol;Acc:MGI:106016])

HSP 1 Score: 76.2554 bits (186), Expect = 1.154e-15
Identity = 36/92 (39.13%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    P+  +G+FGLS  TTE  L ++F KYG I  + +V ++++  SRG++F+ +E++D A +A +   G  +DGR IR+D+S  KR +
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPH 100          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PFR5|TRA2A_MOUSE (Transformer-2 protein homolog alpha OS=Mus musculus OX=10090 GN=Tra2a PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.913e-16
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 199          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13595|TRA2A_HUMAN (Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.998e-16
Identity = 37/92 (40.22%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG ++ + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  110 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAH 201          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|O02008|TRA2_DROVI (Transformer-2 sex-determining protein OS=Drosophila virilis OX=7244 GN=tra2 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.229e-15
Identity = 35/91 (38.46%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  482 TRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
             RD+ + S  +G+FGL+  TT+  + ++F+K+G I  +++V++  T  SRG+ FI +E++  A  A   C G  VDGR IR+DYS  +R +
Sbjct:   97 ARDHPQASRCIGVFGLNTNTTQQKVRELFNKFGPIERIQMVIDAHTHRSRGFCFIYFENLGDARVAKDACTGMEVDGRRIRVDYSITQRAH 187          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P60825|CIRBP_RAT (Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.016e-15
Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GLS  T E AL ++F KYG+I+ + +V +RET  SRG+ F+ +E+ID A  A+    GKSVDGR+IR+D
Sbjct:   10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD 80          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P60824|CIRBP_MOUSE (Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.016e-15
Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            + GLS  T E AL ++F KYG+I+ + +V +RET  SRG+ F+ +E+ID A  A+    GKSVDGR+IR+D
Sbjct:   10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD 80          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A1S6KMI2 (RRM domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 5.009e-98
Identity = 252/252 (100.00%), Postives = 252/252 (100.00%), Query Frame = 2
Query:   44 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPXXXXXXXXXXXXXXXXXXXXXXXXXXHVIAKKSYREDKPSYRDERKPFXXXXXXXXXXXXXXXXXXXXXXXXXXXFKEDRGRNDDRHXXXXXXXXXXXXXXXXXXXXXXXXXGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 799
            MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY
Sbjct:    1 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 252          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A3R7LVI2 (Transformer-2 protein OS=Penaeus vannamei OX=6689 GN=C7M84_017849 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.271e-20
Identity = 43/92 (46.74%), Postives = 65/92 (70.65%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            GTRD  +PS  +G+FGLS  TTE  L+ IFDK+G +  +++V++ +TG+SRG++F+ +E +  A +A  EC G  +DGR IR+DYS  KR +
Sbjct:   73 GTRDNPEPSKCLGVFGLSVHTTERQLYTIFDKFGPLEKVQVVLDSKTGKSRGFAFVYFESLKDASEAKNECSGMEIDGRRIRVDYSITKRPH 164          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: C0IRC8 (Transformer-2 protein OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.348e-20
Identity = 43/92 (46.74%), Postives = 65/92 (70.65%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            GTRD  +PS  +G+FGLS  TTE  L+ IFDK+G +  +++V++ +TG+SRG++F+ +E +  A +A  EC G  +DGR IR+DYS  KR +
Sbjct:   99 GTRDNPEPSKCLGVFGLSVHTTERQLYTIFDKFGPLEKVQVVLDSKTGKSRGFAFVYFESLKDASEAKNECSGMEIDGRRIRVDYSITKRPH 190          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: C0IRC9 (Variant transformer-2 protein OS=Penaeus monodon OX=6687 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.828e-20
Identity = 43/92 (46.74%), Postives = 65/92 (70.65%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            GTRD  +PS  +G+FGLS  TTE  L+ IFDK+G +  +++V++ +TG+SRG++F+ +E +  A +A  EC G  +DGR IR+DYS  KR +
Sbjct:   94 GTRDNPEPSKCLGVFGLSVHTTERQLYTIFDKFGPLEKVQVVLDSKTGKSRGFAFVYFESLKDASEAKNECSGMEIDGRRIRVDYSITKRPH 185          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A3R7QGW1 (Transformer-2c OS=Penaeus vannamei OX=6689 GN=C7M84_014972 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.951e-19
Identity = 43/92 (46.74%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R+   PSN +GIFGLS  TTE  L  +F KYG IN +++V++ +TG SRG++FI ++ +D A +A  +C G  +DGR IR+DYS  +R +
Sbjct:   93 GSREDPSPSNCLGIFGLSLYTTERQLHHLFGKYGHINEVQVVLDAKTGRSRGFAFIYFDHVDDATEAKDQCTGMEIDGRRIRVDYSITERAH 184          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 80.8777 bits (198), Expect = 6.584e-17
Identity = 37/92 (40.22%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:   98 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPH 189          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 79.337 bits (194), Expect = 1.718e-16
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P+  +G+FGLS  TTE  L ++F +YG +  + +V ++ TG SRG++F+ +E ID + +A++   G  +DGR IR+DYS  KR +
Sbjct:  133 PNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPH 217          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000034164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:6544829:6548035:1 gene:ENSAMXG00000039469.1 transcript:ENSAMXT00000034164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.864e-14
Identity = 34/90 (37.78%), Postives = 59/90 (65.56%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKR 748
            G R    P+  +G+FGLS  TTE  L ++F KYG ++S+ +V ++++  SRG++F+ +E+ + + +A +   G  +DGR IR+DYS  +R
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSSVSIVYDQQSRRSRGFAFVYFENREDSREAKERANGMELDGRRIRVDYSITQR 98          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: cirbpa (cold inducible RNA binding protein a [Source:ZFIN;Acc:ZDB-GENE-050417-329])

HSP 1 Score: 70.4774 bits (171), Expect = 4.920e-14
Identity = 36/71 (50.70%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            I GLS  TTE +L + F KYG I ++ +  NRET  SRG+ F+ +E+ D A  AL+   GKSVDGR IR+D
Sbjct:    9 IGGLSFDTTEQSLEEAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGMNGKSVDGRAIRVD 79          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: tra2b (transformer-2 protein homolog alpha-like [Source:NCBI gene;Acc:103029311])

HSP 1 Score: 69.707 bits (169), Expect = 6.998e-13
Identity = 33/92 (35.87%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    P+  +G+FGLS  TTE  L ++F KYG +  + +V ++++  SRG++F+ +E+ + + +A +   G  +DGR IR+D+S  KR +
Sbjct:  109 GNRANPDPTCCLGVFGLSLYTTERDLREVFSKYGPLADVCIVYDQQSRRSRGFAFVYFENREDSQEAKERANGMELDGRRIRVDFSITKRPH 200          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 74.3294 bits (181), Expect = 3.015e-15
Identity = 34/92 (36.96%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G+R    PS  +G+FGLS  T E  L ++F +YG + S+ +V ++++G SRG++F+ +++ + A +A +   G  +DGR IR+D+S  KR +
Sbjct:  103 GSRVNPDPSCCLGVFGLSLHTGEKDLKEVFSRYGPVQSVNVVYDQQSGRSRGFAFVYFDNSEDAKEAKERANGMELDGRYIRVDFSITKRAH 194          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 71.633 bits (174), Expect = 3.410e-14
Identity = 31/92 (33.70%), Postives = 59/92 (64.13%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R   +P+  +G+FGLS  TTE  L ++F +YG +  + +V ++++G  RG++F+  ++++ + +A +   G  +DGR IR+D+S  KR +
Sbjct:   97 GDRGNPEPNTCLGVFGLSLYTTEHDLREVFGRYGPVADVNVVYDQQSGRPRGFAFVYMQNMEDSKEAKERVNGMELDGRNIRVDFSITKRAH 188          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 64.3142 bits (155), Expect = 1.718e-11
Identity = 29/71 (40.85%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            I GLS  T E+AL  IF KYG++  + ++ +RET  SRG++F+ + + D A  A ++  GK +DGR I+++
Sbjct:   11 IGGLSTDTNENALETIFSKYGRVAEVLIMKDRETNRSRGFAFVTFANPDDAKGAERDMNGKPLDGRNIKVE 81          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 61.6178 bits (148), Expect = 1.366e-10
Identity = 32/91 (35.16%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSR 790
            + GL+  TTE AL   F KYG++  + L+ +RET  SRG++F+ + + + A +A ++  GK ++GR +R+D +         G  RY  SR
Sbjct:   11 VGGLNIDTTEKALEATFSKYGRVADVLLMKDRETNLSRGFAFVTFANPEDAKEAERDANGKVLEGRAMRVDQATKPSFESFPGGGRYGFSR 101          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 61.6178 bits (148), Expect = 2.101e-10
Identity = 29/78 (37.18%), Postives = 51/78 (65.38%), Query Frame = 2
Query:  503 SNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYS 736
            SNT+ +  LS +  ED+L  +F+      +++++M+RETG+ RG +F+++  ID A  A+K   G  V+GR IR+++S
Sbjct:  458 SNTLMVRNLSFQADEDSLRSVFENA---EAVRVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVEGRAIRLEFS 532          

HSP 2 Score: 57.7658 bits (138), Expect = 2.830e-9
Identity = 28/89 (31.46%), Postives = 53/89 (59.55%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGK 745
            GT    + S+T+ + GL   T+ED L    D +    + ++V +R++G+S+GY+++++   D A  AL   +G  +DG +I +D++R K
Sbjct:  536 GTPGPSEASSTLFVRGLGEDTSEDTL---MDSFEGATAARIVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDGSQIYVDFARPK 621          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 61.2326 bits (147), Expect = 1.016e-10
Identity = 24/84 (28.57%), Postives = 56/84 (66.67%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRN 751
            PS+T+ +  LS     DA++++F K+G++ S+++  + ET + +G+ ++++ +++ A +AL   +G+ +D R +R+D+S  + N
Sbjct:  265 PSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPN 348          

HSP 2 Score: 48.9062 bits (115), Expect = 9.058e-7
Identity = 28/86 (32.56%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  488 DYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGK 745
            + E+P+ T+ +  LS    ++ L K F+  G +   +++  R T  SRGY ++++E+   A +A++E +GK +DGR I  D S  K
Sbjct:  163 ETEEPA-TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 247          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: IST3 (Component of the U2 snRNP; required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing; diploid mutants have a specific defect in MATa1 pre-mRNA splicing which leads to haploid gene expression in diploids [Source:SGD;Acc:S000001444])

HSP 1 Score: 51.6026 bits (122), Expect = 1.435e-8
Identity = 28/84 (33.33%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  512 VGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYS--RGKRNYQ 757
            + I  L+R+ TE  +  +F +YG    + L  +  TGES+G+++++YED  S I A+    G  + GR +++D++  R KR+ Q
Sbjct:   33 IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQ 116          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 51.9878 bits (123), Expect = 1.072e-7
Identity = 31/100 (31.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query:  497 KPSNTVGIFG--LSRKTTEDALWKIF-DKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRS 787
            K  N   IF   L+   TE  L+++F ++Y   +  K+V ++ TG S+GY F+++ + D    AL E +G  ++GR I++  + G++ +  +G+  Y+RS
Sbjct:  158 KSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHV-SGNNDYNRS 256          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: RIE1 (Putative RNA binding protein; localizes to stress granules induced by glucose deprivation; interacts with Rbg1p in a two-hybrid assay; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003482])

HSP 1 Score: 51.9878 bits (123), Expect = 1.318e-7
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDY 733
            P N + + G+++  +   L  +F KYG I S+KL+ ++  GE  GY FI Y     A   +KE  G++V+G  + ++Y
Sbjct:  194 PGN-IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKELNGRTVNGSTLFINY 270          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 50.447 bits (119), Expect = 3.145e-7
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  488 DYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYE---DIDSAIQALKECRGKSVDGR 715
            D  K S  + I GL+  TTED L + F KYG +  LK++ +  TG SRG+ F+ +E    +D  ++      GK +D +
Sbjct:  153 DLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPK 231          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO44802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS7])

HSP 1 Score: 84.7297 bits (208), Expect = 3.140e-19
Identity = 41/92 (44.57%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G RD   PS  +G+FGLS  TTE  L  +F+KYG + ++++V + +TG SRG+ F+ YED   A  A +   G  +DGR IR+DYS  KR +
Sbjct:   86 GNRDNPSPSRCLGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQTGRSRGFGFVYYEDTKDAEVAKERTTGIELDGRRIRVDYSVTKRAH 177          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO38445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCR4])

HSP 1 Score: 68.9366 bits (167), Expect = 1.752e-12
Identity = 30/83 (36.14%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  488 DYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYS 736
            D   P++++ +  LS  TT D+L   F+     ++ K++ +RE+GESRG+ F++Y+D+++A + L E  G  VDGR++R+D++
Sbjct:  471 DQNPPNSSLIVRNLSYDTTTDSLGAAFEG---CSNAKVIFDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFA 550          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO42298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T6])

HSP 1 Score: 55.0694 bits (131), Expect = 1.206e-8
Identity = 28/79 (35.44%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  509 TVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGK 745
            T+ I  LS++T  + L + F KYG++ + +LV +  TG SRGY+F+E+++   A  A +E     +DG+EI +++  G+
Sbjct:   55 TLFIGRLSKETRAETLVEAFSKYGEVENCRLVRDFVTGFSRGYAFVEFKERWDAKTAYREISKCCIDGQEILVEFEAGR 133          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO45916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA7])

HSP 1 Score: 54.6842 bits (130), Expect = 3.856e-8
Identity = 27/78 (34.62%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECR--GKSVDGREIRM 727
            P + V +  L+R T    L + F  +G+I  L++V + ETG SRG++FI + + +SA +A++ C+     +DGR+I +
Sbjct:   60 PRSKVFVGNLNRDTKPVTLAEYFSVFGEIEGLRIVKDHETGISRGFAFITFTEPESASKAIRWCKHHHPQLDGRQITI 137          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO36859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB5])

HSP 1 Score: 53.5286 bits (127), Expect = 4.581e-8
Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  509 TVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGK 745
            T+ I  ++  T+E  L +  + YG I  + +V N +  + RGY+FIEYE       A K   GK +DGR I +D  RG+
Sbjct:  104 TLFIGRINYDTSESKLRREMEMYGPIKHISMVYNSKASKPRGYAFIEYEHERDMHAAYKHADGKKIDGRRIVVDVERGR 182          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: tra2a (transformer-2 protein homolog alpha [Source:NCBI gene;Acc:101157868])

HSP 1 Score: 86.2705 bits (212), Expect = 1.368e-18
Identity = 38/92 (41.30%), Postives = 63/92 (68.48%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            GTR+   PS  +G+FGL+  TTE  L ++F +YG++  + +V ++ TG SRG++FI +E +  A +A++   G ++DGR+IR+DYS  KR +
Sbjct:  100 GTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPH 191          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: tra2a (transformer 2a [Source:NCBI gene;Acc:100049284])

HSP 1 Score: 73.559 bits (179), Expect = 2.941e-14
Identity = 34/92 (36.96%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    PS  +G+FGLS  TTE  L ++F KYG ++ + +V ++++  SRG++F+ +E+ + + +A ++  G  +DGR IR+D+S  KR +
Sbjct:  106 GNRGNPDPSCCLGVFGLSLYTTERDLREVFSKYGPLSEVNIVYDQQSRRSRGFAFVYFENSEDSKEAKEQANGMELDGRRIRVDFSITKRAH 197          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 70.8626 bits (172), Expect = 4.359e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            I GLS +T ED+L   F KYG I  + ++ ++ETG SRG+ F++Y++++ A  AL    GK++DGR IR+D
Sbjct:    9 IGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNGKTLDGRAIRVD 79          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: cirbpa (cold inducible RNA binding protein [Source:NCBI gene;Acc:101165004])

HSP 1 Score: 70.0922 bits (170), Expect = 6.465e-14
Identity = 32/71 (45.07%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  518 IFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMD 730
            I GLS +T ED+L   F KYG I  + ++ ++ETG SRG+ F++Y++++ A  AL    GK++DGR IR+D
Sbjct:    8 IGGLSFETNEDSLAAAFGKYGTIEKVDVIRDKETGRSRGFGFVKYDNVEDAKDALDAMNGKTLDGRAIRVD 78          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 72.0182 bits (175), Expect = 1.043e-13
Identity = 34/92 (36.96%), Postives = 57/92 (61.96%), Query Frame = 2
Query:  479 GTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            G R    P+  +G+FGLS  TTE  L  +F KYG +  + +V ++++  SRG++F+ +E+   A +A ++  G  +DGR IR+D+S  KR +
Sbjct:  113 GNRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPH 204          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000063924.1 (SMESG000063924.1)

HSP 1 Score: 304.679 bits (779), Expect = 1.350e-101
Identity = 252/252 (100.00%), Postives = 252/252 (100.00%), Query Frame = 2
Query:   44 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPXXXXXXXXXXXXXXXXXXXXXXXXXXHVIAKKSYREDKPSYRDERKPFXXXXXXXXXXXXXXXXXXXXXXXXXXXFKEDRGRNDDRHXXXXXXXXXXXXXXXXXXXXXXXXXGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 799
            MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY
Sbjct:    1 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 252          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000063924.1 (SMESG000063924.1)

HSP 1 Score: 304.679 bits (779), Expect = 1.393e-101
Identity = 252/252 (100.00%), Postives = 252/252 (100.00%), Query Frame = 2
Query:   44 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPXXXXXXXXXXXXXXXXXXXXXXXXXXHVIAKKSYREDKPSYRDERKPFXXXXXXXXXXXXXXXXXXXXXXXXXXXFKEDRGRNDDRHXXXXXXXXXXXXXXXXXXXXXXXXXGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 799
            MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY
Sbjct:    1 MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSRSRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRDSYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDYEKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRDGY 252          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000045560.1 (SMESG000045560.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.058e-23
Identity = 43/83 (51.81%), Postives = 64/83 (77.11%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKR 748
            P   +GIFGLS+KT E+ LW  F+KYGKI++++L+M+R   ES GY+FI+Y++I+ A++A+KE  G  +DG  IR+DYS GK+
Sbjct:  106 PCTCIGIFGLSKKTKEETLWDKFEKYGKIDNVRLIMDRGKRESLGYAFIDYKEIEFAMKAMKEAHGTEIDGNNIRLDYSVGKK 188          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000052838.1 (SMESG000052838.1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.228e-22
Identity = 42/85 (49.41%), Postives = 62/85 (72.94%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            PS  +GIFGLS+KT+E  LWK F  +GKI S+ L++++ T ES G++FI YE++DSA  A+KE  G ++D + +R+DYS  K+ Y
Sbjct:   58 PSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELDSATNAIKETNGMTLDSKVVRVDYSITKKAY 142          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000052829.1 (SMESG000052829.1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.413e-21
Identity = 40/85 (47.06%), Postives = 62/85 (72.94%), Query Frame = 2
Query:  500 PSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSFIEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNY 754
            P   +G+FGL+++T E  LW+ F+K+G+I S+KL+M++   ES GY FI YED+ SA +A+KE  G ++DG+ IR+DYS  K+ +
Sbjct:   75 PCKCIGVFGLNKRTEEKILWETFEKFGRIASVKLIMDKYHQESLGYGFINYEDLGSATRAVKEASGMNLDGKVIRVDYSITKKAH 159          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRA2A3.394e-1740.22transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A3.471e-1740.22transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A3.471e-1740.22transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A1.249e-1640.22transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2B1.682e-1539.13transformer 2 beta homolog [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-81.631e-1338.89SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
rsp-81.631e-1338.89SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
cpf-27.473e-1237.21Cleavage and Polyadenylation Factor [Source:UniPr... [more]
cpf-27.473e-1237.21Cleavage and Polyadenylation Factor [Source:UniPr... [more]
rbm-3.16.634e-1037.31RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra22.810e-1636.26gene:FBgn0003742 transcript:FBtr0089616[more]
tra26.698e-1636.26gene:FBgn0003742 transcript:FBtr0089615[more]
tra26.698e-1636.26gene:FBgn0003742 transcript:FBtr0089619[more]
tra21.097e-1536.26gene:FBgn0003742 transcript:FBtr0089620[more]
tra21.097e-1536.26gene:FBgn0003742 transcript:FBtr0089621[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a3.332e-1742.35transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a3.332e-1742.35transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a9.557e-1742.35transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a1.272e-1642.35transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
cirbpa9.175e-1450.70cold inducible RNA binding protein a [Source:ZFIN;... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg54.609e-1639.13pleckstrin homology and RhoGEF domain containing G... [more]
rit12.004e-1540.22Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GEN... [more]
cirbp1.129e-1242.25cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp2.061e-1242.25cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp2.263e-1242.25cold inducible RNA binding protein [Source:NCBI ge... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tra2a8.333e-1740.22transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Tra2a8.574e-1740.22transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Cirbp5.430e-1647.95cold inducible RNA binding protein [Source:MGI Sym... [more]
Cirbp1.146e-1549.30cold inducible RNA binding protein [Source:MGI Sym... [more]
Tra2b1.154e-1539.13transformer 2 beta [Source:MGI Symbol;Acc:MGI:1060... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PFR5|TRA2A_MOUSE5.913e-1640.22Transformer-2 protein homolog alpha OS=Mus musculu... [more]
sp|Q13595|TRA2A_HUMAN5.998e-1640.22Transformer-2 protein homolog alpha OS=Homo sapien... [more]
sp|O02008|TRA2_DROVI1.229e-1538.46Transformer-2 sex-determining protein OS=Drosophil... [more]
sp|P60825|CIRBP_RAT8.016e-1549.30Cold-inducible RNA-binding protein OS=Rattus norve... [more]
sp|P60824|CIRBP_MOUSE8.016e-1549.30Cold-inducible RNA-binding protein OS=Mus musculus... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI25.009e-98100.00RRM domain-containing protein OS=Schmidtea mediter... [more]
A0A3R7LVI26.271e-2046.74Transformer-2 protein OS=Penaeus vannamei OX=6689 ... [more]
C0IRC89.348e-2046.74Transformer-2 protein OS=Penaeus monodon OX=6687 P... [more]
C0IRC99.828e-2046.74Variant transformer-2 protein OS=Penaeus monodon O... [more]
A0A3R7QGW11.951e-1946.74Transformer-2c OS=Penaeus vannamei OX=6689 GN=C7M8... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a6.584e-1740.22transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a1.718e-1641.18transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
ENSAMXT00000034164.11.864e-1437.78pep primary_assembly:Astyanax_mexicanus-2.0:12:654... [more]
cirbpa4.920e-1450.70cold inducible RNA binding protein a [Source:ZFIN;... [more]
tra2b6.998e-1335.87transformer-2 protein homolog alpha-like [Source:N... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a3.015e-1536.96transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b3.410e-1433.70transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
rbmx1.718e-1140.85RNA binding motif protein X-linked [Source:NCBI ge... [more]
rbmx1.366e-1035.16RNA binding motif protein X-linked [Source:NCBI ge... [more]
ncl2.101e-1037.18nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NSR11.016e-1028.57Nucleolar protein that binds nuclear localization ... [more]
IST31.435e-833.33Component of the U2 snRNP; required for the first ... [more]
NAM81.072e-731.00RNA binding protein, component of the U1 snRNP pro... [more]
RIE11.318e-733.33Putative RNA binding protein; localizes to stress ... [more]
HRP13.145e-735.44Subunit of cleavage factor I; cleavage factor I is... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448023.140e-1944.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384451.752e-1236.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422981.206e-835.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459163.856e-834.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368594.581e-836.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a1.368e-1841.30transformer-2 protein homolog alpha [Source:NCBI g... [more]
tra2a2.941e-1436.96transformer 2a [Source:NCBI gene;Acc:100049284][more]
cirbpa4.359e-1445.07cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbpa6.465e-1445.07cold inducible RNA binding protein [Source:NCBI ge... [more]
tra2b1.043e-1336.96transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063924.11.350e-101100.00SMESG000063924.1[more]
SMESG000063924.11.393e-101100.00SMESG000063924.1[more]
SMESG000045560.11.058e-2351.81SMESG000045560.1[more]
SMESG000052838.14.228e-2249.41SMESG000052838.1[more]
SMESG000052829.13.413e-2147.06SMESG000052829.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014750 ID=SMED30014750|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1354bp
AACTATCATATTTAATTTTTATACAGTAAATTAAAATTTTATAATGTCAG
GTAGAAATGAATCTAAGGTAAGTAGGAATTCTTCCTCACCTAATAAGTCA
AATGGCGAATATTGGTCATCAAAATCTAAATCTCGTTCGCCAAAAATTGA
TAAAAAGGCATCTAAAAGAAGATCCATTTCGAAGGATAGTAGATCAAGAT
CAATTTCTAGAAATCGTAAACATGTTATTGCCAAGAAATCCTATAGAGAA
GATAAACCATCATATAGAGATGAAAGAAAACCTTTTCGGGAAGAAAGACG
CTCTGCTAGAGATGATCGCGATTCTTATAGAAATGACCGTGATTCATATA
GGAATGATCGTAGATCTTTTAAGGAGGATAGAGGAAGAAATGATGATCGA
CATTCCAACAGATATGAAAGATCTGGTAGACGTAATCGTTCAAGATCAAG
ATCTCCTGAATTTAGTAGATATAGTAGAGGCACACGAGATTATGAAAAGC
CTTCGAATACTGTTGGGATTTTTGGTTTATCAAGAAAGACTACGGAAGAT
GCTTTATGGAAAATTTTTGATAAATATGGTAAAATTAATAGTCTGAAATT
GGTAATGAACAGAGAAACTGGAGAATCACGTGGTTACTCATTTATTGAAT
ATGAAGACATCGATTCTGCAATTCAAGCATTAAAGGAATGTCGAGGTAAA
AGTGTTGACGGTAGAGAAATTCGAATGGATTATAGCCGAGGAAAGCGAAA
TTATCAGAATAATGGCGATGAAAGATATTCCCGAAGTCGTGACGGATATC
AATCAAGAAAGAGGCAATCAAGATCGAGAAGCAAAAGTCGTTCGAATTAT
TCAGGTAAAGCATCAATTATTTGAATATTGATATAAAGTTGAACTGAAGC
CTCAGAATTTAAAGAAATTGAGATGTTTATTGTTTTTATTAGTGGGAAGC
CATTGATGTTTCAGTTGAAGCGATTTTATTAAAATAACGAGATAGAGCCT
GGGTTGATTAAAAGAATGAACAGATTTATTCGAAAGAAAGTTCGTTGAGA
TAAAGTTTCTAATCAAATGATGAGATAATTCTGTTCAAGAGAGTTGCCAT
GGTTGATTAATATTATAGATAGATTAACAGTGTGCATATTTTTGTTTTCG
TTATTTTGGGAAATGTAACACAAAATAAATTTTTAGTTTTATGTTCCGCA
TGGAAAATTTACCTTTAATAATAATTTTTTCTACGTTCGAGTTAAAATAA
ATATTATAAACATTAAGGGATTCTTTTATTCGTATTTTCCATATTTTATG
TATACCGATTCCCCGAAAAATATTAATATCTTTGTCAATCTTGTTAGCAA
TCAC
back to top

protein sequence of SMED30014750-orf-1

>SMED30014750-orf-1 ID=SMED30014750-orf-1|Name=SMED30014750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MSGRNESKVSRNSSSPNKSNGEYWSSKSKSRSPKIDKKASKRRSISKDSR
SRSISRNRKHVIAKKSYREDKPSYRDERKPFREERRSARDDRDSYRNDRD
SYRNDRRSFKEDRGRNDDRHSNRYERSGRRNRSRSRSPEFSRYSRGTRDY
EKPSNTVGIFGLSRKTTEDALWKIFDKYGKINSLKLVMNRETGESRGYSF
IEYEDIDSAIQALKECRGKSVDGREIRMDYSRGKRNYQNNGDERYSRSRD
GYQSRKRQSRSRSKSRSNYSGKASII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..105
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..257
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..149
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 63..125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..151
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 29..52
NoneNo IPR availablePANTHERPTHR13952U1 SMALL NUCLEAR RIBONUCLEOPROTEIN 70 KDcoord: 152..264
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 156..229
e-value: 4.1E-21
score: 86.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 159..227
e-value: 1.3E-18
score: 66.6
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 155..233
score: 17.95
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 144..270
e-value: 7.3E-27
score: 96.0
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 150..260