Pdz domain containing protein

Overview
NamePdz domain containing protein
Smed IDSMED30014747
Length (bp)2112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pdz domain containing protein (SMED30014747) t-SNE clustered cells

Violin plots show distribution of expression levels for Pdz domain containing protein (SMED30014747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pdz domain containing protein (SMED30014747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pdz domain containing protein (SMED30014747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014747SMESG000051965.1 dd_Smed_v4_8867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014747SMESG000051965.1 dd_Smed_v4_8867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014747SMESG000051965.1 dd_Smed_v4_8867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014747SMESG000051965.1 dd_Smed_v4_8867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000051965.1 Contig39000newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000051965.1 Contig39000uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000051965.1 Contig40811newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000051965.1 Contig40811uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000041841.1 Contig4204GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014747SMESG000051965.1 Contig4204GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30014747SMESG000051965.1 dd_Smed_v6_8867_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pdz domain containing protein vs. Ensembl Human
Match: SYNPO2L (synaptopodin 2 like [Source:HGNC Symbol;Acc:HGNC:23532])

HSP 1 Score: 67.3958 bits (163), Expect = 7.097e-11
Identity = 34/77 (44.16%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRF 542
            L+ G PWGFRL+  A+    L +SKIRR S A  A L   DQ+L +NG S   +SHA A++ ID +   L L + R 
Sbjct:   11 LSGGAPWGFRLHGGAEQRKPLQVSKIRRRSQAGRAGLRERDQLLAINGVSCTNLSHASAMSLIDASGNQLVLTVQRL 87          
BLAST of Pdz domain containing protein vs. Ensembl Human
Match: PDLIM5 (PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:17468])

HSP 1 Score: 58.5362 bits (140), Expect = 6.155e-9
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            GP PWGFRL    D N  LTIS ++    A  AN+  GD +L ++G +  GM+H EA N I    G+L++ + R
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQR 83          
BLAST of Pdz domain containing protein vs. Ensembl Human
Match: PDLIM5 (PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:17468])

HSP 1 Score: 58.5362 bits (140), Expect = 6.155e-9
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            GP PWGFRL    D N  LTIS ++    A  AN+  GD +L ++G +  GM+H EA N I    G+L++ + R
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQR 83          
BLAST of Pdz domain containing protein vs. Ensembl Human
Match: PDLIM5 (PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:17468])

HSP 1 Score: 58.151 bits (139), Expect = 6.535e-9
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            GP PWGFRL    D N  LTIS ++    A  AN+  GD +L ++G +  GM+H EA N I    G+L++ + R
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQR 83          
BLAST of Pdz domain containing protein vs. Ensembl Human
Match: PDLIM3 (PDZ and LIM domain 3 [Source:HGNC Symbol;Acc:HGNC:20767])

HSP 1 Score: 54.6842 bits (130), Expect = 2.232e-8
Identity = 34/81 (41.98%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFES 548
            ++  GP PWGFRL    D N  L I++I   S A +ANL  GD IL ++G  T  M+HA+A + I      L L+I R E+
Sbjct:    1 VILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAAAHQLCLKIDRGET 81          
BLAST of Pdz domain containing protein vs. Ensembl Fly
Match: CG1674 (gene:FBgn0039897 transcript:FBtr0300796)

HSP 1 Score: 65.855 bits (159), Expect = 8.899e-11
Identity = 49/194 (25.26%), Postives = 96/194 (49.48%), Query Frame = 3
Query:  780 LIKDFTDSEEPYNYVPK-KKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKW 1358
            L K FT + +    +PK +K +A SAFYS    L+PT+E++V++ARR++ SL+   N++SKG S++  ++KR++K+     E     +  + P K + E     ME  +    P+  +                   N    ++++   ++     +   ++P  C ++  AL     RGA++FA+++ ++  W
Sbjct:  360 LRKIFTPATDAAEILPKNRKLYASSAFYS--PTLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWV---HEGGSQGNDAINPFKENSET-KSTMEVAKLEKIPLKLI------------------MNPNGKVRDY-NSLKDLINVEAGLLSPDNCAELITALQLHQGRGAELFAKRRRKADNW 528          
BLAST of Pdz domain containing protein vs. Ensembl Fly
Match: CG1674 (gene:FBgn0039897 transcript:FBtr0300798)

HSP 1 Score: 65.855 bits (159), Expect = 8.899e-11
Identity = 49/194 (25.26%), Postives = 96/194 (49.48%), Query Frame = 3
Query:  780 LIKDFTDSEEPYNYVPK-KKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKW 1358
            L K FT + +    +PK +K +A SAFYS    L+PT+E++V++ARR++ SL+   N++SKG S++  ++KR++K+     E     +  + P K + E     ME  +    P+  +                   N    ++++   ++     +   ++P  C ++  AL     RGA++FA+++ ++  W
Sbjct:  360 LRKIFTPATDAAEILPKNRKLYASSAFYS--PTLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWV---HEGGSQGNDAINPFKENSET-KSTMEVAKLEKIPLKLI------------------MNPNGKVRDY-NSLKDLINVEAGLLSPDNCAELITALQLHQGRGAELFAKRRRKADNW 528          
BLAST of Pdz domain containing protein vs. Ensembl Fly
Match: CG1674 (gene:FBgn0039897 transcript:FBtr0300797)

HSP 1 Score: 65.855 bits (159), Expect = 8.899e-11
Identity = 49/194 (25.26%), Postives = 96/194 (49.48%), Query Frame = 3
Query:  780 LIKDFTDSEEPYNYVPK-KKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKW 1358
            L K FT + +    +PK +K +A SAFYS    L+PT+E++V++ARR++ SL+   N++SKG S++  ++KR++K+     E     +  + P K + E     ME  +    P+  +                   N    ++++   ++     +   ++P  C ++  AL     RGA++FA+++ ++  W
Sbjct:  360 LRKIFTPATDAAEILPKNRKLYASSAFYS--PTLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWV---HEGGSQGNDAINPFKENSET-KSTMEVAKLEKIPLKLI------------------MNPNGKVRDY-NSLKDLINVEAGLLSPDNCAELITALQLHQGRGAELFAKRRRKADNW 528          
BLAST of Pdz domain containing protein vs. Ensembl Fly
Match: CG1674 (gene:FBgn0039897 transcript:FBtr0300800)

HSP 1 Score: 65.4698 bits (158), Expect = 1.055e-10
Identity = 49/199 (24.62%), Postives = 99/199 (49.75%), Query Frame = 3
Query:  765 IEISKLIKDFTDSEEPYNYVPK-KKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKW 1358
            +++ K+    TD+ E    +PK +K +A SAFYS    L+PT+E++V++ARR++ SL+   N++SKG S++  ++KR++K+     E     +  + P K + E     ME  +    P+  +                   N    ++++   ++     +   ++P  C ++  AL     RGA++FA+++ ++  W
Sbjct:  168 VDLRKIFTPATDAAE---ILPKNRKLYASSAFYSP--TLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWV---HEGGSQGNDAINPFKENSET-KSTMEVAKLEKIPLKLI------------------MNPNGKVRDY-NSLKDLINVEAGLLSPDNCAELITALQLHQGRGAELFAKRRRKADNW 338          
BLAST of Pdz domain containing protein vs. Ensembl Fly
Match: CG1674 (gene:FBgn0039897 transcript:FBtr0308087)

HSP 1 Score: 65.0846 bits (157), Expect = 1.783e-10
Identity = 49/199 (24.62%), Postives = 99/199 (49.75%), Query Frame = 3
Query:  765 IEISKLIKDFTDSEEPYNYVPK-KKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKW 1358
            +++ K+    TD+ E    +PK +K +A SAFYS    L+PT+E++V++ARR++ SL+   N++SKG S++  ++KR++K+     E     +  + P K + E     ME  +    P+  +                   N    ++++   ++     +   ++P  C ++  AL     RGA++FA+++ ++  W
Sbjct:  240 VDLRKIFTPATDAAE---ILPKNRKLYASSAFYSP--TLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRSDKWV---HEGGSQGNDAINPFKENSET-KSTMEVAKLEKIPLKLI------------------MNPNGKVRDY-NSLKDLINVEAGLLSPDNCAELITALQLHQGRGAELFAKRRRKADNW 410          
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Match: synpo2la (synaptopodin 2-like a [Source:ZFIN;Acc:ZDB-GENE-090828-4])

HSP 1 Score: 70.4774 bits (171), Expect = 5.484e-12
Identity = 33/86 (38.37%), Postives = 52/86 (60.47%), Query Frame = 3
Query:  312 FILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR----FESV 551
              L+ G PWGFRL    ++   L ++K+R+ S A  A L  GD+++ +N  S   +SHA+A+N ID+  GTL +++ R    F+SV
Sbjct:    8 ITLSGGAPWGFRLQGGIEHQKPLQVAKVRKRSKACRAGLREGDELMSINENSCGSLSHAQAMNLIDSMPGTLHIRVRRAPAGFQSV 93          
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Match: synpo2la (synaptopodin 2-like a [Source:ZFIN;Acc:ZDB-GENE-090828-4])

HSP 1 Score: 70.0922 bits (170), Expect = 6.739e-12
Identity = 32/84 (38.10%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  312 FILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVST 557
              L+ G PWGFRL    ++   L ++K+R+ S A  A L  GD+++ +N  S   +SHA+A+N ID+  GTL +++ R  S S+
Sbjct:    8 ITLSGGAPWGFRLQGGIEHQKPLQVAKVRKRSKACRAGLREGDELMSINENSCGSLSHAQAMNLIDSMPGTLHIRVRRAMSPSS 91          
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Match: synpo2lb (synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-090828-5])

HSP 1 Score: 69.707 bits (169), Expect = 1.034e-11
Identity = 34/76 (44.74%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            L+ G PWGFRL   A++   L ++K+R+ S A  A L   D++L +N  S   +SHAEA+N ID+  GTL L+I R
Sbjct:   10 LSGGAPWGFRLQGGAEHQKPLQVAKVRKRSKACRAGLRETDELLSINDVSCGSLSHAEAMNLIDSGRGTLHLRIKR 85          
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Match: pdlim1 (PDZ and LIM domain 1 (elfin) [Source:ZFIN;Acc:ZDB-GENE-030131-5227])

HSP 1 Score: 62.3882 bits (150), Expect = 6.438e-10
Identity = 36/83 (43.37%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  306 KRFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFES 548
            +R +L    PWGFRL    D    LTIS++   S A  A+L  GD IL ++G+ST GM+H EA N I      + L I R ES
Sbjct:    3 QRVVLQGPGPWGFRLVGGKDFEQPLTISRVTPGSKAAQADLCMGDMILAIDGESTDGMTHLEAQNKIKACGDEMALSIDRSES 85          
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Match: ldb3b (LIM domain binding 3b [Source:ZFIN;Acc:ZDB-GENE-030131-6032])

HSP 1 Score: 59.6918 bits (143), Expect = 7.578e-10
Identity = 36/74 (48.65%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            GP PWGFRL    D N  LTIS+I   S A S NL+ GD I  ++G ST GM+H EA N I      L L + R
Sbjct:   10 GPAPWGFRLQGGKDFNMSLTISRITPGSKAASGNLNQGDIITAIDGVSTEGMTHLEAQNKIKAATTKLSLTMQR 83          
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Match: fbn1 (fibrillin 1 [Source:Xenbase;Acc:XB-GENE-954190])

HSP 1 Score: 67.781 bits (164), Expect = 4.622e-11
Identity = 70/256 (27.34%), Postives = 109/256 (42.58%), Query Frame = 3
Query:  318 LTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKE---IEEPPVAKDLIIPSSPDVQPIEISKLIKDFTD------------SEEPYN--------YVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTL 1010
            ++ G PWGFRL    ++N  L +SK      + +A L  GD+++ +NG S   + ++E V  I+ ++ TL+L + R E +                        LD +  EK  + PK  S    VE+K+E   +E PPVA    I +    Q  E  +  +D T             S   YN        + P       S   S+ Q     ++E     + +A  LT   N  SKG  +F+++R+RA KYTL
Sbjct:   11 MSGGAPWGFRLQGGKEDNEPLHVSK------SFTAGLCEGDEVISINGTSCTDIPYSEVVALIEKSVDTLELLVKRVELI------------------------LDCSSIEK--EEPKFLSDRGCVESKEEGGQLEAPPVAVSFGITAEESEQGEEDPQAERDHTRPHKHRARHASKFSNNVYNIKILTVITFFPPHLGLRRSESLSEKQ-----VKEAKSKCKSIALLLTEAPNPKSKGVLMFKKRRQRARKYTL 229          
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:Xenbase;Acc:XB-GENE-996184])

HSP 1 Score: 65.4698 bits (158), Expect = 7.080e-11
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 3
Query:  306 KRFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFES 548
            KR ++T  PPWGFRL    D +  LTIS++   S A  A+L  GD ++ ++G++T GM+H EA N I      L L I R ES
Sbjct:    4 KRIVMTAPPPWGFRLIGGKDFDQPLTISRVMPGSKAAVADLCIGDVVISIDGENTDGMTHLEAQNKIKGCEDELILTINRVES 86          
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Match: gsx2 (GS homeobox 2 [Source:Xenbase;Acc:XB-GENE-492505])

HSP 1 Score: 65.855 bits (159), Expect = 2.070e-10
Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 3
Query:  333 PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            PWGFRL    + N  L +SK+R+ S A    L   D+++ +NGK+ AG++HA+A+  ID+  G+L + + R
Sbjct:   16 PWGFRLQGGSEKNLPLIVSKVRKRSKACRGGLRENDELVSINGKACAGLTHAQAMLMIDSIGGSLHIHVRR 86          
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Match: psat1 (phosphoserine aminotransferase 1 [Source:Xenbase;Acc:XB-GENE-1016013])

HSP 1 Score: 63.929 bits (154), Expect = 2.740e-10
Identity = 38/78 (48.72%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            +   GP PWGFRL    D N  LTISKI   S AE ANL+ GD IL++NG++T  M+H  A N I      L L I R
Sbjct:    5 VTLSGPSPWGFRLVGGRDYNTPLTISKINPGSKAELANLYPGDVILEINGENTENMNHLVAQNKIKACTDQLMLSINR 82          
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Match: PDLIM5 (PDZ and LIM domain 5 [Source:NCBI gene;Acc:548530])

HSP 1 Score: 61.6178 bits (148), Expect = 1.939e-9
Identity = 38/91 (41.76%), Postives = 52/91 (57.14%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAET 590
            GP PWGFRL    D N  LTIS++     A  A++  GD +L ++G ST GM+H EA N I    G+L+L + R  S + K   + P+ ET
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISRLSDGGKASQAHIGIGDVVLTIDGISTDGMTHLEAQNKIKACTGSLNLTLQR-ASAAPKANPNPPQTET 99          
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Match: Synpo2l (synaptopodin 2-like [Source:MGI Symbol;Acc:MGI:1916010])

HSP 1 Score: 62.7734 bits (151), Expect = 1.507e-9
Identity = 34/81 (41.98%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  303 EKRFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            E +  L  G PWGFRL    +    L +SKIRR S A  A L   DQ+L +NG S    SHA A+  ID +   L L + R
Sbjct:    6 EVQVTLAGGAPWGFRLQGGTEQRKPLQVSKIRRRSQAGRAGLRERDQLLAINGVSCTNFSHASAMTLIDASGRQLVLTVRR 86          
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Match: Pdlim5 (PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:1927489])

HSP 1 Score: 60.8474 bits (146), Expect = 2.361e-9
Identity = 35/90 (38.89%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE 587
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R  + +     SV K E
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGE 99          
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Match: Pdlim5 (PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:1927489])

HSP 1 Score: 58.9214 bits (141), Expect = 3.954e-9
Identity = 41/127 (32.28%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFE--------SVSTKILTSV-PKAETDILETVKSKMNLDLTRSEKSPDIPKVP 671
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R          SV    +TSV  ++  ++ E  +     D+ +   +P   K+P
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKPTVTSVCSESAQELAEGQRRGSQGDIKQQNGNPGTVKIP 136          
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Match: Pdlim5 (PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:1927489])

HSP 1 Score: 60.8474 bits (146), Expect = 4.360e-9
Identity = 35/90 (38.89%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE 587
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R  + +     SV K E
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGE 99          
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Match: Pdlim5 (PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:1927489])

HSP 1 Score: 58.151 bits (139), Expect = 6.188e-9
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQR 83          
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Match: sp|Q9H987|SYP2L_HUMAN (Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 3.408e-10
Identity = 34/77 (44.16%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRF 542
            L+ G PWGFRL+  A+    L +SKIRR S A  A L   DQ+L +NG S   +SHA A++ ID +   L L + R 
Sbjct:   11 LSGGAPWGFRLHGGAEQRKPLQVSKIRRRSQAGRAGLRERDQLLAINGVSCTNLSHASAMSLIDASGNQLVLTVQRL 87          
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Match: sp|Q9PW72|PDLI4_CHICK (PDZ and LIM domain protein 4 OS=Gallus gallus OX=9031 GN=PDLIM4 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.457e-9
Identity = 38/83 (45.78%), Postives = 48/83 (57.83%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVS 554
            +  +GP PWGFRL    D +  LTIS+I   S A  ANL  GD IL +NG+ST  M+H EA N I   +  L L ++R E  S
Sbjct:    5 VALRGPSPWGFRLVGGKDFSTPLTISRINPGSKAALANLCPGDIILAINGESTEAMTHLEAQNKIKACVEQLLLSVSRAEERS 87          
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Match: sp|Q8CI51|PDLI5_MOUSE (PDZ and LIM domain protein 5 OS=Mus musculus OX=10090 GN=Pdlim5 PE=1 SV=4)

HSP 1 Score: 60.8474 bits (146), Expect = 3.050e-8
Identity = 35/90 (38.89%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE 587
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R  + +     SV K E
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGE 99          
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Match: sp|Q6GLJ6|PDLI3_XENLA (PDZ and LIM domain protein 3 OS=Xenopus laevis OX=8355 GN=pdlim3 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.394e-8
Identity = 37/81 (45.68%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFES 548
            +L  GP PWGFRL    D N  L IS+I   S +  ANL  GD IL ++G ST  M+HAEA + I      L L+I R E+
Sbjct:    5 VLLPGPAPWGFRLTGGIDFNQPLVISRITPGSKSSVANLCPGDVILAIDGFSTETMTHAEAQDRIKAATDQLCLKIDRAET 85          
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Match: sp|Q62920|PDLI5_RAT (PDZ and LIM domain protein 5 OS=Rattus norvegicus OX=10116 GN=Pdlim5 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 5.532e-8
Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  327 GP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE 587
            GP PWGFRL    D N  LTIS ++    A  A++  GD +L ++G S  GM+H EA N I    G+L++ + R  + +     +V K E
Sbjct:   10 GPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGE 99          
BLAST of Pdz domain containing protein vs. TrEMBL
Match: A0A0X3P739 (Synaptopodin 2-like protein OS=Schistocephalus solidus OX=70667 GN=SYP2L PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.528e-68
Identity = 183/497 (36.82%), Postives = 258/497 (51.91%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEP--YNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKE--DSPVNSRPVEPQKY----DLEH--WPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPT-QPQPVMVSNQGP---WNINSARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPHPPMKETTQLPNNNQWKPVKFNIPQKA 1739
            M +VE   +L  GPPWGFRL       L +S+IR+ SPA++A L   D+I+ +   ST GM   +AV  I+     L L I R E    +++T       D       ++   LT  E               + +   E  P  + LI P+ PDV P+ I +L++ F    EP    + PK+K FA+SAFY DP +LYP++EE++QMA RVA S+  P+N+ S+GAS+FE QR+ A+KY  +  E    P+ +R  EPQ      DLEH  +P+ + PR   P       Y +   + P PPPPPPPP + +S+QEFM+KV+ FPK +HN+I+PQ CFDIA ALHSS SRGA +FAQ+K R+ KWE+   +    PQPV V  Q P     +N         +  A   + V+R + T  +     T++   + + +     RR+S +    P    NP   S P                   W+PVKFNIPQKA
Sbjct:    1 MQAVEHVIVLLNGPPWGFRLQEVYPEGLVVSQIRQLSPADNAGLRENDKIVAIENISTLGMGRLQAVQIINNVNYQLHLIIQRLEKRRKQVMTFF----LDTAAARGQQVQKGLTSKE----------VNLWWQKEPSPEPEPKPEPLIYPNDPDVTPVSIDRLMRQF----EPPQIEHAPKRKAFANSAFYIDPASLYPSLEEQMQMAHRVADSIKDPENRESRGASMFELQRRHADKYVKEGPEPIRDPIENRATEPQASATAEDLEHMEFPR-LPPRNTQPPS----SYPNMAPLIPIPPPPPPPPGQPRSLQEFMDKVKLFPKNQHNQISPQVCFDIATALHSSNSRGANMFAQRKARAYKWEVGQQDSVGTPQPVPVQAQKPKLFSKLNQMHQMTTESSNVATVGLPVMRKTETTRSPRTSLTVKQETVSSWQ----TRRSSGETI-SPAFHTNPPETSKPT------------------WRPVKFNIPQKA 451          
BLAST of Pdz domain containing protein vs. TrEMBL
Match: A0A0X3PYM7 (Synaptopodin 2-like protein OS=Schistocephalus solidus OX=70667 GN=SYP2L PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.682e-66
Identity = 180/493 (36.51%), Postives = 255/493 (51.72%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEP--YNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKE--DSPVNSRPVEPQKYDLEH--WPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPT-QPQPVMVSNQGP---WNINSARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPHPPMKETTQLPNNNQWKPVKFNIPQKA 1739
            M +VE   +L  GPPWGFRL       L +S+IR+ SPA++A L   D+I+ +   ST GM   +AV  I+     L L I R E    +++T       D       ++   LT  E               + +   E  P  + LI P+ PDV P+ I +L++ F    EP    + PK+K FA+SAFY DP +LYP++EE++QMA RVA S+  P+N+ S+GAS+FE QR+ A+KY  +  E    P+ +   E    DLEH  +P+ + PR   P       Y +   + P PPPPPPPP + +S+QEFM+KV+ FPK +HN+I+PQ CFDIA ALHSS SRGA +FAQ+K R+ KWE+   +    PQPV V  Q P     +N         +  A   + V+R + T  +     T++   + + +     RR+S +    P    NP   S P                   W+PVKFNIPQKA
Sbjct:    1 MQAVEHVIVLLNGPPWGFRLQEVYPEGLVVSQIRQLSPADNAGLRENDKIVAIENISTLGMGRLQAVQIINNVNYQLHLIIQRLEKRRKQVMTFF----LDTAAARGQQVQKGLTSKE----------VNLWWQKEPSPEPEPKPEPLIYPNDPDVTPVSIDRLMRQF----EPPQIEHAPKRKAFANSAFYIDPASLYPSLEEQMQMAHRVADSIKDPENRESRGASMFELQRRHADKYVKEGPEPIRDPIENATAE----DLEHMEFPR-LPPRNTQPPS----SYPNMAPLIPIPPPPPPPPGQPRSLQEFMDKVKLFPKNQHNQISPQVCFDIATALHSSNSRGANMFAQRKARAYKWEVGQQDSVGTPQPVPVQAQKPKLFSKLNQMHQMTTESSNVATVGLPVMRKTETTRSPRTSLTVKQETVSSWQ----TRRSSGETI-SPAFHTNPPETSKPT------------------WRPVKFNIPQKA 443          
BLAST of Pdz domain containing protein vs. TrEMBL
Match: A0A068YDJ8 (Pdz domain containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000797800 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 7.712e-60
Identity = 164/511 (32.09%), Postives = 261/511 (51.08%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVP-KKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKE--DSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMVSNQGPWNINSARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPHPP-MKET------------------------TQLPNNNQWKPVKFNIPQKA 1739
            M +VE+   + +GPPWGFRL    NG L +S+IRR SPAE A L   D +L +N  ST G++ + A++ I+T++  LDL + R E    +++T          + V+ +M         S D+        ++  +KE   PP       P+ P V P+ + +L+++F   E P    P KK+ FA+SAFY+     YP++EE+++MARRVA S+ AP N+ S+GA +FE Q++RAEK+  +  E    P+ +   +  +Y +   P    P      P          ++PPPPPPPPPPP + +SIQEF+EK+++FPK  H EI+PQ CFDIA ALH+S SRG  +FA+++ +++ WE+ +                     A P +  +    P++IS +        + +Q+ +  T  Q+  P    +++ N        +  P+ ++   + P PP + +T                        TQ  +  +W+PVKFNIPQKA
Sbjct:    1 MQTVERVIHMQQGPPWGFRLADTFNGSLVVSQIRRQSPAEMAGLRENDVVLAINNYSTRGLNRSYAIDIINTSVYELDLVVQRQERRKPQMMTFFLDTSAARGQMVRQEM--------ASRDL--------DISWRKETAPPPPEPRRTKPADPSVTPVSLDRLLREF---EAPKATPPIKKRTFANSAFYTGTNVYYPSVEEQIEMARRVAKSIEAPVNQGSRGARMFEAQQQRAEKFVKEGPEPIPDPLENATAQQLEYMIPPAPPPQPPPAAPSFPTL------TSTIPPPPPPPPPPPGQPRSIQEFIEKMRRFPKNTHTEISPQVCFDIATALHTSGSRGGAMFAKRRAKAQNWEVES------------------TGVAVPVLEPKQADRPKLISKL-------EQQHQHQVYRTQQQSTSPPSSQKQSRN-------SLTGPVRMNEMSSRPQPPNLGQTQPSSQWSGTSANSSAGASTSTSPATQSVSRPKWRPVKFNIPQKA 454          
BLAST of Pdz domain containing protein vs. TrEMBL
Match: A0A068W818 (Pdz domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000797800 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 8.236e-60
Identity = 167/492 (33.94%), Postives = 262/492 (53.25%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKM---NLDLT-RSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVP-KKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKED--SPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMVSNQGPWNINSARPSIPT--QNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPHPPMKETTQLPNNNQWKPVKFNIPQKA 1739
            M + E+   + +GPPWGFRL    NG L +S+IRR SPAE A L   D +L +N  ST G + + A++ I+T++  LDL + R E    +++T          + V+ +M   +LD++ R E +P  P                EP      I P+ P V P+ + +L+++F   E P    P KK+ FA+SAFY+     YP++EE+++MARRVA S+ AP N+ S+GA +FE Q++RAEKY  +  E    P+ +   +  +Y +   P    P      P          ++PPPPPPPPPPP + +SIQEF+EK+++FPK  H EI+PQ CFDIAAALH+S SRG  +FA+++ +++ WE+ +   T   PV+   Q      + RP + +  + +   +V    + S++  +   Q+    TG+          ++ N G  +     +  + ++    P       TQ  +  +W+PVKFNIPQKA
Sbjct:    1 MQTFERVIHMQQGPPWGFRLADTFNGSLVVSQIRRQSPAEMAGLRENDVVLAINNYSTRGFNRSYAIDIINTSVYELDLVVQRQERRKPQMMTFFLDTSAARGQMVRQEMASRDLDISWRKETAPQPP----------------EP----RRIKPADPSVTPVSLDRLLREF---EAPKATPPIKKRTFANSAFYTGTNVYYPSVEEQIEMARRVAKSIEAPVNQGSRGARMFEAQQQRAEKYVKEGPEPIPDPLENATAQQLEYMIPPAPPPPPPPAAPSFPTL------TSTIPPPPPPPPPPPGQPRSIQEFIEKMRRFPKNTHTEISPQVCFDIAAALHTSGSRGGAMFAKRRAKAQNWEVESTGVT--VPVLEPKQ------ADRPKLISKLEQQHQHQVYRTQQQSTSPPSSQKQSRNSLTGLVRMNEMSSRPQSPNLGQTQASSQWSGTSANSSAGAPTSTSSPATQSVSRPKWRPVKFNIPQKA 455          
BLAST of Pdz domain containing protein vs. TrEMBL
Match: W6V1R2 (Synaptopodin 2-like protein OS=Echinococcus granulosus OX=6210 GN=EGR_00156 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 9.385e-59
Identity = 141/373 (37.80%), Postives = 217/373 (58.18%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKM---NLDLT-RSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVP-KKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKED--SPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQP 1388
            M + E+   + +GPPWGFRL    NG L +S+IRR SPAE A L   D +L +N  ST G + + A++ I+T++  LDL + R E    +++T          + V+ +M   +LD++ R+E +P                   +PP  +  I P+ P V P+ + +L+++F   E P    P KK+ FA+SAFY+     YP++EE+++MARRVA S+ AP N+ S+GA +FE Q++RAEKY  +  E    P+ +   +  +Y +   P    P      P      +   ++PPPPPPPPPPP + +SIQEF+EK+++FPK  H EI+PQ CFDIAAALH+S SRG  +FA+++ +++ WE+ +   T P
Sbjct:    1 MQTFERVIHMQQGPPWGFRLVDTFNGSLVVSQIRRQSPAEMAGLRENDVVLAINNYSTRGFNRSYAIDVINTSVYELDLVVQRQERRKPQMMTFFLDTSAARGQMVRQEMASRDLDISWRNETAP-------------------QPPEPRR-IKPADPSVTPVSLDRLLREF---EAPKATPPIKKRTFANSAFYTGTNVYYPSVEEQIEMARRVAKSIEAPVNQGSRGARMFEAQQQRAEKYVKEGPEPIPDPLENATAQQLEYMIPPAPPPPPPPAAPSFP------TLTSTIPPPPPPPPPPPGQPRSIQEFIEKMRRFPKNTHTEISPQVCFDIAAALHTSGSRGGAMFAKRRAKAQSWEVESTGVTVP 344          
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Match: synpo2lb (synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-090828-5])

HSP 1 Score: 72.4034 bits (176), Expect = 9.021e-13
Identity = 73/249 (29.32%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNL-------DLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISK----LIKDFTDSE---EPYNYVP-KKKQFADSAFYSDPQNLYPTMEEKVQMARRVATS--LTAPDNKSSKGASIFERQRKRAEKYT 1007
            L+ G PWGFRL   A+    L ++K+R+ S A  A L   D+++ +N      +SH+EA+N ID+  G L L+I R E V             D+   VK  ++L       +L RSE   D         E  TK       +A  L    +P  + + + K      K+ +++E   E  +  P  + +  +  F + P   + +    + + RR + S  L+A    S KGA +FE+QRKRAEK+T
Sbjct:   10 LSGGAPWGFRLQGGAEQQKPLQVAKVRKRSKACRAGLREADELMSINDVCCGELSHSEAMNLIDSGRGILQLRIKRSEPV------------YDVPLNVKKNISLNVSFSSTELHRSESVQD-----KQVKEARTKCRT----IASLLTDAPNPHSKGVLMFKKRRQRAKNLSNTEGETEDESLFPGSESELDEDCFSAAPDPTWDSGYLDI-LDRRTSGSPGLSA---TSGKGAQLFEQQRKRAEKHT 233          
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Match: synpo2lb (synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-090828-5])

HSP 1 Score: 72.4034 bits (176), Expect = 9.089e-13
Identity = 73/249 (29.32%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNL-------DLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISK----LIKDFTDSE---EPYNYVP-KKKQFADSAFYSDPQNLYPTMEEKVQMARRVATS--LTAPDNKSSKGASIFERQRKRAEKYT 1007
            L+ G PWGFRL   A+    L ++K+R+ S A  A L   D+++ +N      +SH+EA+N ID+  G L L+I R E V             D+   VK  ++L       +L RSE   D         E  TK       +A  L    +P  + + + K      K+ +++E   E  +  P  + +  +  F + P   + +    + + RR + S  L+A    S KGA +FE+QRKRAEK+T
Sbjct:   10 LSGGAPWGFRLQGGAEQQKPLQVAKVRKRSKACRAGLREADELMSINDVCCGELSHSEAMNLIDSGRGILQLRIKRSEPV------------YDVPLNVKKNISLNVSFSSTELHRSESVQD-----KQVKEARTKCRT----IASLLTDAPNPHSKGVLMFKKRRQRAKNLSNTEGETEDESLFPGSESELDEDCFSAAPDPTWDSGYLDI-LDRRTSGSPGLSA---TSGKGAQLFEQQRKRAEKHT 233          
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Match: synpo2lb (synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-090828-5])

HSP 1 Score: 69.707 bits (169), Expect = 7.327e-12
Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVP 578
            L+ G PWGFRL   A+    L ++K+R+ S A  A L   D+++ +N      +SH+EA+N ID+  G L L+I R E +S  ++ S P
Sbjct:   10 LSGGAPWGFRLQGGAEQQKPLQVAKVRKRSKACRAGLREADELMSINDVCCGELSHSEAMNLIDSGRGILQLRIKRSEPLSCVLVRSPP 98          
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Match: synpo2lb (synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-090828-5])

HSP 1 Score: 67.0106 bits (162), Expect = 5.221e-11
Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  318 LTKGPPWGFRLY--ADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSV 575
            L+ G PWGFRL   A+    L ++K+R+ S A  A L   D+++ +N      +SH+EA+N ID+  G L L+I R E V    L ++
Sbjct:   10 LSGGAPWGFRLQGGAEQQKPLQVAKVRKRSKACRAGLREADELMSINDVCCGELSHSEAMNLIDSGRGILQLRIKRSEPVYESALRAL 97          
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Match: synpo2la (synaptopodin 2 like [Source:NCBI gene;Acc:103044083])

HSP 1 Score: 65.4698 bits (158), Expect = 1.737e-10
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  318 LTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR----FESV 551
            L+ G PWGFRL    ++   L ++K+R+ S A  A L  GD+++ +N      +SHA+A+N ID+  G L +++ R    F+SV
Sbjct:   10 LSGGAPWGFRLQGGVEHQRPLQVAKVRKRSKACRAGLREGDELVSINDTYCGNLSHAQAMNLIDSIPGALRIRVKRTPAGFQSV 93          
BLAST of Pdz domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002484.1 (pep scaffold:Pmarinus_7.0:GL476548:370238:411117:1 gene:ENSPMAG00000002245.1 transcript:ENSPMAT00000002484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.430e-9
Identity = 36/81 (44.44%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  306 KRFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFID-TTIGTLDLQITR 539
            ++ ILT   PWGFRL    D +  LTIS++   S A SANL  GD IL + G++   M+HAEA   I   +  TL L+I R
Sbjct:    3 QQVILTGPAPWGFRLVGGRDLDQPLTISRVTPGSVASSANLSPGDVILAIEGENAEEMTHAEAQERIKACSTATLTLKIDR 83          
BLAST of Pdz domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.366e-8
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE 587
            +   GP PWGFRL    D N  LTIS+I   S A  A +  GD +L+++G  T  M+H EA   I  ++G L L + R   +  ++ T  P A+
Sbjct:    6 VTLHGPAPWGFRLQGGKDFNMPLTISRISPGSKAAQATVVPGDVVLQIDGTPTDSMTHLEAQTKIKNSVGNLRLTLQR-SKLQGRVTTGAPHAD 98          
BLAST of Pdz domain containing protein vs. Ensembl Nematostella
Match: EDO47763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY1])

HSP 1 Score: 49.6766 bits (117), Expect = 7.572e-8
Identity = 31/85 (36.47%), Postives = 40/85 (47.06%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            M   E   +L  G PWGFRL    D   + T+S++     A +  L   DQIL +NG     M+H EA   I  T   L LQ+ R
Sbjct:    1 MAGQEFALVLDGGGPWGFRLKGGKDFGQIPTVSQLTPGGKAITNGLRVEDQILSINGMGCEDMTHMEAQESIKRTGNALRLQVRR 85          
BLAST of Pdz domain containing protein vs. Ensembl Nematostella
Match: EDO30217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1F1])

HSP 1 Score: 45.4394 bits (106), Expect = 2.834e-6
Identity = 26/79 (32.91%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  309 RFILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            + +L+ G PWGFRL    D    L I+K+ + S AE A +     +  +N      MSH +A+N I  T   L+L + +
Sbjct:    8 QVVLSGGAPWGFRLQGGKDFRAPLKIAKVEQGSKAERAGIRPNLYVRSINNDPCETMSHGDALNNIKRTGTNLNLLLCK 86          
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Match: synpo2la (synaptopodin 2-like protein [Source:NCBI gene;Acc:101156036])

HSP 1 Score: 67.0106 bits (162), Expect = 4.390e-11
Identity = 35/93 (37.63%), Postives = 56/93 (60.22%), Query Frame = 3
Query:  312 FILTKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKA 584
              L+ G PWGFRL    ++   L ++K+R+ S A  A L   D+++ +N +    +SHA+A+N ID++ G LD+++ R E  + K L SV KA
Sbjct:    9 ITLSGGAPWGFRLQGGVEHQKPLQVAKVRKRSKACRAGLREADELVSINDQPCGLLSHAQAMNLIDSSPGILDIRVKRSE--AQKKLFSVLKA 99          
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101158216])

HSP 1 Score: 63.5438 bits (153), Expect = 2.358e-10
Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  327 GP-PWGFRLYADNNGV--LTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVS 554
            GP PWGFRL    +    LTIS++     A SA +  GD IL +NG ST  M+H EA N I    GTL L + R  +VS
Sbjct:   11 GPAPWGFRLQGGKDFCMPLTISRLTEGGKAASARMSIGDVILSINGISTESMNHLEAQNKIKACTGTLSLTLQRVSAVS 89          
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101158216])

HSP 1 Score: 63.1586 bits (152), Expect = 4.157e-10
Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  327 GP-PWGFRLYADNNGV--LTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVS 554
            GP PWGFRL    +    LTIS++     A SA +  GD IL +NG ST  M+H EA N I    GTL L + R  +VS
Sbjct:   11 GPAPWGFRLQGGKDFCMPLTISRLTEGGKAASARMSIGDVILSINGISTESMNHLEAQNKIKACTGTLSLTLQRVSAVS 89          
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Match: pdlim5b (PDZ and LIM domain protein 5 [Source:NCBI gene;Acc:101158216])

HSP 1 Score: 63.5438 bits (153), Expect = 4.531e-10
Identity = 36/79 (45.57%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  327 GP-PWGFRLYADNNGV--LTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVS 554
            GP PWGFRL    +    LTIS++     A SA +  GD IL +NG ST  M+H EA N I    GTL L + R  +VS
Sbjct:   11 GPAPWGFRLQGGKDFCMPLTISRLTEGGKAASARMSIGDVILSINGISTESMNHLEAQNKIKACTGTLSLTLQRVSAVS 89          
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Match: pdlim4 (PDZ and LIM domain 4 [Source:NCBI gene;Acc:101166681])

HSP 1 Score: 60.4622 bits (145), Expect = 1.996e-9
Identity = 35/79 (44.30%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  315 ILTKGP-PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRF 542
            +  KGP PWGFRL    D +  LT+S++   S A   +L  GD IL +NG ST  M+H EA N I T    L L I+R+
Sbjct:    5 VTLKGPSPWGFRLVGGRDFSTPLTVSRVTPGSKAAQGDLCPGDTILTINGDSTEHMTHMEAQNRIKTCTQQLTLSISRY 83          
BLAST of Pdz domain containing protein vs. Planmine SMEST
Match: SMESG000051965.1 (SMESG000051965.1)

HSP 1 Score: 945.266 bits (2442), Expect = 0.000e+0
Identity = 479/483 (99.17%), Postives = 480/483 (99.38%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMVSNQGPWNINSARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPHPPMKETTQLPNNNQWKPVKFNIPQKA 1739
            MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAE DILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQ VPPPPPPPPPPPNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMVSNQGPWNI+SARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVP PPMKETTQLPNNNQWKPVKFNIPQKA
Sbjct:    1 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAEIDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQCVPPPPPPPPPPPNETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMVSNQGPWNIDSARPSIPTQNKSAPRVISVIRNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITISTPKNVPQPPMKETTQLPNNNQWKPVKFNIPQKA 483          
BLAST of Pdz domain containing protein vs. Planmine SMEST
Match: SMESG000012918.1 (SMESG000012918.1)

HSP 1 Score: 222.246 bits (565), Expect = 1.898e-65
Identity = 144/380 (37.89%), Postives = 207/380 (54.47%), Query Frame = 3
Query:  291 MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAETDILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLIIPSSPDVQPIEISKLIKDFTDSEEPYNYVPKKKQFADSAFYSDPQNLYPTMEEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNSRPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVXXXXXXXXXXXNET---------KSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKKNRSKKWELSTPEPTQPQPVMV 1403
            MP ++K  IL  GPPWGFR+Y D N  L + +IR+ SPA++A L  GD IL +N  S   +SH++A+  ID T   L L + R ES+  K +T +    T +     SK+ L+LTR                        EP     L  P+SPD+ P+ ISKL+K++     P N   K+K+FA+S F++DP   YPT+EEK++MA+ +A SLTAP N  SKGA+IFERQR+R EKY +K   D        EP+K  L+   Q    R   P  +      +   V  P  P      E          K+++E++E+++K+P  KH+ I P+ CF IA+ALH    RG+ IF + + RSKKWE+S+ E  +  PV++
Sbjct:    1 MPFIQKEIILRDGPPWGFRIYEDENRGLIVHRIRQWSPAQTAKLKEGDVILAINRFSARYLSHSDAIELIDVTFKELLLLVGRHESMCNKNVTFIEHQGT-VQNNAVSKIFLNLTR------------------------EP-----LTTPASPDLVPVPISKLMKEYDIPPRPEN-AAKRKRFANSEFFNDPNTYYPTLEEKIEMAKNLAESLTAPVNCKSKGANIFERQRQRIEKY-VKEGPDP-------EPEKELLQIILQDGSVRTLDPPEIEPPPPLNSPPVGFPGLPTDINKKEIRLPPPPGAPKTLKEYLERIKKYPTVKHDAIGPEKCFTIASALHYGHDRGSNIFQKIRIRSKKWEISS-ETIKESPVVI 340          
BLAST of Pdz domain containing protein vs. Planmine SMEST
Match: SMESG000064215.1 (SMESG000064215.1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.012e-8
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  321 TKGPPWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            ++G PWGFR+    D +  L++ K++  SP++S  L SGD I+K+NG +T  + H+EA+  I  +   L L I R
Sbjct:   82 SEGEPWGFRIQGGHDYHLQLSVKKVKSGSPSDSK-LQSGDAIIKINGFATHNLCHSEAIELIKCSSKKLSLIIAR 155          
BLAST of Pdz domain containing protein vs. Planmine SMEST
Match: SMESG000029617.1 (SMESG000029617.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.786e-7
Identity = 30/71 (42.25%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  333 PWGFRLYA--DNNGVLTISKIRRHSPAESANLHSGDQILKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITR 539
            PWGFR+    D N  L IS+I   S A+++ L  GD+I K+N   T  + H EA   I  +  TL+L+ITR
Sbjct:   16 PWGFRIQGGRDFNRPLIISRITCDSVADNSGLKCGDRITKINNFDTGFICHNEAQQVIIESGNTLNLEITR 86          
The following BLAST results are available for this feature:
BLAST of Pdz domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNPO2L7.097e-1144.16synaptopodin 2 like [Source:HGNC Symbol;Acc:HGNC:2... [more]
PDLIM56.155e-941.89PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM56.155e-941.89PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM56.535e-941.89PDZ and LIM domain 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
PDLIM32.232e-841.98PDZ and LIM domain 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pdz domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16748.899e-1125.26gene:FBgn0039897 transcript:FBtr0300796[more]
CG16748.899e-1125.26gene:FBgn0039897 transcript:FBtr0300798[more]
CG16748.899e-1125.26gene:FBgn0039897 transcript:FBtr0300797[more]
CG16741.055e-1024.62gene:FBgn0039897 transcript:FBtr0300800[more]
CG16741.783e-1024.62gene:FBgn0039897 transcript:FBtr0308087[more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
synpo2la5.484e-1238.37synaptopodin 2-like a [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2la6.739e-1238.10synaptopodin 2-like a [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2lb1.034e-1144.74synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-09... [more]
pdlim16.438e-1043.37PDZ and LIM domain 1 (elfin) [Source:ZFIN;Acc:ZDB-... [more]
ldb3b7.578e-1048.65LIM domain binding 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbn14.622e-1127.34fibrillin 1 [Source:Xenbase;Acc:XB-GENE-954190][more]
entpd87.080e-1143.37ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
gsx22.070e-1039.44GS homeobox 2 [Source:Xenbase;Acc:XB-GENE-492505][more]
psat12.740e-1048.72phosphoserine aminotransferase 1 [Source:Xenbase;A... [more]
PDLIM51.939e-941.76PDZ and LIM domain 5 [Source:NCBI gene;Acc:548530][more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Synpo2l1.507e-941.98synaptopodin 2-like [Source:MGI Symbol;Acc:MGI:191... [more]
Pdlim52.361e-938.89PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:19... [more]
Pdlim53.954e-932.28PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:19... [more]
Pdlim54.360e-938.89PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:19... [more]
Pdlim56.188e-941.89PDZ and LIM domain 5 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Pdz domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H987|SYP2L_HUMAN3.408e-1044.16Synaptopodin 2-like protein OS=Homo sapiens OX=960... [more]
sp|Q9PW72|PDLI4_CHICK2.457e-945.78PDZ and LIM domain protein 4 OS=Gallus gallus OX=9... [more]
sp|Q8CI51|PDLI5_MOUSE3.050e-838.89PDZ and LIM domain protein 5 OS=Mus musculus OX=10... [more]
sp|Q6GLJ6|PDLI3_XENLA4.394e-845.68PDZ and LIM domain protein 3 OS=Xenopus laevis OX=... [more]
sp|Q62920|PDLI5_RAT5.532e-837.78PDZ and LIM domain protein 5 OS=Rattus norvegicus ... [more]
back to top
BLAST of Pdz domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P7392.528e-6836.82Synaptopodin 2-like protein OS=Schistocephalus sol... [more]
A0A0X3PYM73.682e-6636.51Synaptopodin 2-like protein OS=Schistocephalus sol... [more]
A0A068YDJ87.712e-6032.09Pdz domain containing protein OS=Echinococcus mult... [more]
A0A068W8188.236e-6033.94Pdz domain containing protein OS=Echinococcus gran... [more]
W6V1R29.385e-5937.80Synaptopodin 2-like protein OS=Echinococcus granul... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
synpo2lb9.021e-1329.32synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2lb9.089e-1329.32synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2lb7.327e-1238.20synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2lb5.221e-1137.50synaptopodin 2-like b [Source:ZFIN;Acc:ZDB-GENE-09... [more]
synpo2la1.737e-1036.90synaptopodin 2 like [Source:NCBI gene;Acc:10304408... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002484.13.430e-944.44pep scaffold:Pmarinus_7.0:GL476548:370238:411117:1... [more]
ENSPMAT00000007081.11.366e-837.23pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pdz domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO477637.572e-836.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302172.834e-632.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pdz domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
synpo2la4.390e-1137.63synaptopodin 2-like protein [Source:NCBI gene;Acc:... [more]
pdlim5b2.358e-1045.57PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b4.157e-1045.57PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim5b4.531e-1045.57PDZ and LIM domain protein 5 [Source:NCBI gene;Acc... [more]
pdlim41.996e-944.30PDZ and LIM domain 4 [Source:NCBI gene;Acc:1011666... [more]
back to top
BLAST of Pdz domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051965.10.000e+099.17SMESG000051965.1[more]
SMESG000012918.11.898e-6537.89SMESG000012918.1[more]
SMESG000064215.11.012e-838.67SMESG000064215.1[more]
SMESG000029617.14.786e-742.25SMESG000029617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014747 ID=SMED30014747|Name=Pdz domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2112bp
TTGAGATGTGCAGAATTATTGATTTTGTAAATTTTTTTTAATTGGAAACA
CAGAACAGTGCAAACGACATGCCGAATTTTTGTCCTTCGATGGGATATGC
AGAATTACAATATAAACAAATGAAAAAGAGAATCACATCAATTTTAGTTA
ATTTCGAATTTCGAAAATCTATTGATTATATTTTCCGTTAATGTTCAAAT
CTTAAAAAGAAAATTGATTTGTGATATTTTATTTTTTATTTCCTGAAATT
TCTGCACTTGTTCTCTATCTCAACGTCCGAATAAACGTAAATGCCTAGTG
TGGAGAAACGATTCATACTGACCAAAGGGCCTCCATGGGGATTTAGACTC
TATGCGGATAATAATGGAGTCTTGACCATATCTAAAATTCGTCGACACAG
TCCAGCTGAAAGTGCAAATTTACACTCGGGTGATCAGATATTGAAATTAA
ATGGGAAATCCACGGCTGGAATGAGCCACGCAGAAGCTGTCAATTTCATC
GACACGACCATTGGAACACTTGATCTCCAGATCACCCGATTTGAATCCGT
TTCAACTAAGATTCTGACTAGTGTACCGAAAGCTGAGACAGATATCTTAG
AAACTGTAAAGAGTAAAATGAATCTTGATCTAACTCGAAGTGAAAAATCA
CCAGATATACCAAAGGTTCCTTCGTGTACTCCTGAAGTGGAGACTAAAAA
AGAAATCGAAGAACCACCAGTTGCAAAGGATTTAATAATCCCATCCTCTC
CAGATGTTCAACCGATAGAAATTAGTAAGCTCATCAAAGATTTTACAGAT
TCTGAAGAACCATACAATTACGTACCGAAAAAAAAACAATTTGCCGATTC
AGCCTTTTACAGTGATCCCCAAAATCTCTATCCGACCATGGAGGAAAAGG
TTCAAATGGCACGAAGAGTAGCAACAAGTTTAACAGCTCCAGATAACAAA
AGTTCAAAGGGTGCCAGTATTTTTGAAAGGCAGAGAAAACGAGCTGAAAA
ATATACGCTGAAAAACAAAGAAGATAGTCCAGTAAATTCTCGGCCAGTTG
AACCCCAGAAGTATGATCTAGAGCACTGGCCTCAAGTAATGGAACCCAGA
GAAAAATCTCCTTCGCCTATGTATAGACTTGGATATTCTTCGAAACAATC
CGTACCTCCTCCTCCTCCTCCGCCACCACCTCCTCCAAATGAAACAAAAT
CAATACAAGAATTTATGGAAAAAGTCCAAAAGTTCCCTAAAACTAAACAC
AATGAAATCACGCCTCAAACTTGTTTTGATATTGCTGCAGCATTGCACTC
AAGCACTAGTAGAGGAGCACAAATATTTGCGCAGAAAAAGAATCGGTCAA
AGAAATGGGAATTGTCAACACCTGAACCTACTCAACCGCAGCCAGTAATG
GTTTCCAATCAAGGACCTTGGAACATTAACAGTGCTCGACCTTCTATTCC
TACTCAGAATAAGTCAGCACCAAGAGTTATTTCTGTAATTCGAAACAGTT
CTACAATTGTTAATAAAGGCAATCAAAACACAATTCAAAGTACTGGAATT
CAAAATAGAAAACCAACTCACGTGATTCGTCGCAATAGCAATCAAGGTTA
TCAAGAGCCCATTAAAATAAATAATCCAATCACAATATCAACTCCGAAAA
ATGTGCCACATCCACCAATGAAAGAAACGACGCAACTACCAAATAACAAC
CAATGGAAACCCGTTAAGTTCAATATTCCCCAGAAAGCATGATAAATTTA
TTATTTTATTATTAACATTATTTTTATATACATCTACGGCGATCTTCTCT
AATTTCATATTTTTGTTTCGTTGAAGAAGCTTCGGTGTAAAATAGTTTTT
AATGCACTTCTGGGCTCTGCCCGTTCTTTGACAATTTGGAATTAGAATTT
GTTGAAATTGATGCGTTTTGCTACTCATTTAAAATGATATTTTTTCAAGA
TTTGATAAGATTTGTTGATGAAAAATGGCTTATTTTTGGAGAATTAGTTT
CAATAGTTAGATGGCTTCTAAATGATTCTATTCTGTGTTATATTGTATTT
TTATTTCTGGCTTTCTATTCTAATACGATGCATCATTTCGCTGTTTGTAC
AATCTATCAAAC
back to top

protein sequence of SMED30014747-orf-1

>SMED30014747-orf-1 ID=SMED30014747-orf-1|Name=SMED30014747-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MPSVEKRFILTKGPPWGFRLYADNNGVLTISKIRRHSPAESANLHSGDQI
LKLNGKSTAGMSHAEAVNFIDTTIGTLDLQITRFESVSTKILTSVPKAET
DILETVKSKMNLDLTRSEKSPDIPKVPSCTPEVETKKEIEEPPVAKDLII
PSSPDVQPIEISKLIKDFTDSEEPYNYVPKKKQFADSAFYSDPQNLYPTM
EEKVQMARRVATSLTAPDNKSSKGASIFERQRKRAEKYTLKNKEDSPVNS
RPVEPQKYDLEHWPQVMEPREKSPSPMYRLGYSSKQSVPPPPPPPPPPPN
ETKSIQEFMEKVQKFPKTKHNEITPQTCFDIAAALHSSTSRGAQIFAQKK
NRSKKWELSTPEPTQPQPVMVSNQGPWNINSARPSIPTQNKSAPRVISVI
RNSSTIVNKGNQNTIQSTGIQNRKPTHVIRRNSNQGYQEPIKINNPITIS
TPKNVPHPPMKETTQLPNNNQWKPVKFNIPQKA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0098641cadherin binding involved in cell-cell adhesion
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0061001regulation of dendritic spine morphogenesis
GO:0098609cell-cell adhesion
GO:0051963regulation of synapse assembly
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005913cell-cell adherens junction
GO:0014069postsynaptic density
GO:0015629actin cytoskeleton
GO:0016020membrane
GO:0030018Z disc
GO:0030054cell junction
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 14..85
e-value: 4.7E-13
score: 59.4
IPR001478PDZ domainPFAMPF00595PDZcoord: 14..81
e-value: 1.4E-11
score: 44.5
IPR001478PDZ domainPROSITEPS50106PDZcoord: 11..85
score: 14.998
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 3..98
e-value: 2.8E-19
score: 70.7
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 5..83
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..268
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 236..300
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 212..231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 116..135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 286..300
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 450..472
NoneNo IPR availablePANTHERPTHR24217FAMILY NOT NAMEDcoord: 9..124
NoneNo IPR availablePANTHERPTHR24217:SF10SYNAPTOPODIN 2-LIKE PROTEINcoord: 9..124
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 5..81
e-value: 1.84974E-16
score: 72.2142