protein arginine methyltransferase 5-like protein

Overview
Nameprotein arginine methyltransferase 5-like protein (AEX33822.1)
Smed IDSMED30014738
Length (bp)2446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein arginine methyltransferase 5-like protein (SMED30014738) t-SNE clustered cells

Violin plots show distribution of expression levels for protein arginine methyltransferase 5-like protein (SMED30014738) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein arginine methyltransferase 5-like protein (SMED30014738) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein arginine methyltransferase 5-like protein (SMED30014738) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014738h1SMcG0022269 SmedASXL_005989SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014738h1SMcG0022269 SmedASXL_005989SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30014738h1SMcG0022269 dd_Smed_v4_8688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Match: PRMT5 (protein arginine methyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:10894])

HSP 1 Score: 479.174 bits (1232), Expect = 3.516e-159
Identity = 267/656 (40.70%), Postives = 373/656 (56.86%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Match: PRMT5 (protein arginine methyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:10894])

HSP 1 Score: 475.322 bits (1222), Expect = 6.083e-158
Identity = 263/636 (41.35%), Postives = 367/636 (57.70%), Query Frame = 3
Query:  114 GFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   20 GFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 620          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Match: PRMT5 (protein arginine methyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:10894])

HSP 1 Score: 444.121 bits (1141), Expect = 2.107e-146
Identity = 236/547 (43.14%), Postives = 323/547 (59.05%), Query Frame = 3
Query:  363 AVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            A L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   60 AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 576          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Match: PRMT5 (protein arginine methyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:10894])

HSP 1 Score: 444.121 bits (1141), Expect = 3.100e-146
Identity = 236/547 (43.14%), Postives = 323/547 (59.05%), Query Frame = 3
Query:  363 AVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            A L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   77 AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 593          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Match: PRMT5 (protein arginine methyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:10894])

HSP 1 Score: 377.096 bits (967), Expect = 3.966e-122
Identity = 190/407 (46.68%), Postives = 257/407 (63.14%), Query Frame = 3
Query:  762 MKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            +++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   89 LEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 466          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Celegans
Match: prmt-5 (Protein arginine N-methyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:P46580])

HSP 1 Score: 256.914 bits (655), Expect = 3.540e-74
Identity = 207/645 (32.09%), Postives = 295/645 (45.74%), Query Frame = 3
Query:  246 VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGD-SISNFMLMLA----LPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFL---KMKIQLVLTGDAKNLHGHLA--YRQYLSWIWTN---KCPMTVYEKHSK--------DMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSAN---------CEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRA--------DIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKK------------------TKYA------SLETPYVVRLLNCHLLAP-VQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWAC----TNPEVTS--IHNPNGRSYSMSL 1973
            VVGKIS WID D+   +F   SE+ LL+EL +  + G   + I L + ++   A +L  ++      F +W+ LP   E    C + +    +     + W  F    G+ S   F + L     LP    +  +++ W +EP+AA    + ++ + + G   +   + +++        ++I L  T D    +  +   Y Q L     N   +    V E  +         + +D LQ PLQPL+++L S  Y+ FE D  KY  Y +A   A+ DL      DG                      ++ + I +LG GRGP+     K+    N          +VK+YIVEKNPNA+  L       W  R V +   DMR   LP  A        DI VSELLGSFGDNELSPECLDG   FLKP  ISIPQ YTSY+ P+ ST +   +  Q  P  S+                    KY       +++  YVV L     LA   + VFTFEHP   +N+SN+R   + F +  +  + GFAG+F   LYK V +SI P  H+P M SWFP V P+   +++     +S  I R  ++  VWYEW      TN E  S  I NPNG SY M +
Sbjct:  123 VVGKISPWIDCDSSDPAFASLSEEHLLKELSYICYLGLQTMAIELTRISSPRTAAILKKWIWTRNSRFTVWVQLPSAIE---KCKDYDAFTIEHVDLWTIWADFRKNCGNFSGVYFQVALTISSELPDELTELKLVDRWKAEPLAAFVIESGLFISGRNGEASIPSAHINLLKHLWTTDALRIVLRATTDTFKYNTSIKSEYSQALRHAVRNVNYRSRPDVGEGSNDSTHYLNVIEYKDVLQAPLQPLSENLDSGVYNTFEQDQIKYDVYGEAVVGALKDL----GADG----------------------RKTVVIYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNPNAIVTLKYMNVRTWKRR-VTIIESDMRS--LPGIAKDRGFEQPDIIVSELLGSFGDNELSPECLDGVTGFLKPTTISIPQKYTSYVKPIMSTHIHQTIKAQSIPYLSRAIPSHGRGEPELDEDEMWIQKYPQGHVRNNMDQIYVVYLSKYIPLAETTKPVFTFEHPN-FMNSSNERSDSIEFVMDRNADLMGFAGYFDLQLYKTVMLSIEPSTHTPGMVSWFPAVIPLRDQLRVGEGDRISLKIDRKVDNTGVWYEWHVEKKKTNGESVSTPIQNPNGESYYMRM 734          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Celegans
Match: prmt-5 (Protein arginine N-methyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:P46580])

HSP 1 Score: 256.914 bits (655), Expect = 3.540e-74
Identity = 207/645 (32.09%), Postives = 295/645 (45.74%), Query Frame = 3
Query:  246 VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGD-SISNFMLMLA----LPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFL---KMKIQLVLTGDAKNLHGHLA--YRQYLSWIWTN---KCPMTVYEKHSK--------DMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSAN---------CEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRA--------DIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKK------------------TKYA------SLETPYVVRLLNCHLLAP-VQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWAC----TNPEVTS--IHNPNGRSYSMSL 1973
            VVGKIS WID D+   +F   SE+ LL+EL +  + G   + I L + ++   A +L  ++      F +W+ LP   E    C + +    +     + W  F    G+ S   F + L     LP    +  +++ W +EP+AA    + ++ + + G   +   + +++        ++I L  T D    +  +   Y Q L     N   +    V E  +         + +D LQ PLQPL+++L S  Y+ FE D  KY  Y +A   A+ DL      DG                      ++ + I +LG GRGP+     K+    N          +VK+YIVEKNPNA+  L       W  R V +   DMR   LP  A        DI VSELLGSFGDNELSPECLDG   FLKP  ISIPQ YTSY+ P+ ST +   +  Q  P  S+                    KY       +++  YVV L     LA   + VFTFEHP   +N+SN+R   + F +  +  + GFAG+F   LYK V +SI P  H+P M SWFP V P+   +++     +S  I R  ++  VWYEW      TN E  S  I NPNG SY M +
Sbjct:  123 VVGKISPWIDCDSSDPAFASLSEEHLLKELSYICYLGLQTMAIELTRISSPRTAAILKKWIWTRNSRFTVWVQLPSAIE---KCKDYDAFTIEHVDLWTIWADFRKNCGNFSGVYFQVALTISSELPDELTELKLVDRWKAEPLAAFVIESGLFISGRNGEASIPSAHINLLKHLWTTDALRIVLRATTDTFKYNTSIKSEYSQALRHAVRNVNYRSRPDVGEGSNDSTHYLNVIEYKDVLQAPLQPLSENLDSGVYNTFEQDQIKYDVYGEAVVGALKDL----GADG----------------------RKTVVIYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNPNAIVTLKYMNVRTWKRR-VTIIESDMRS--LPGIAKDRGFEQPDIIVSELLGSFGDNELSPECLDGVTGFLKPTTISIPQKYTSYVKPIMSTHIHQTIKAQSIPYLSRAIPSHGRGEPELDEDEMWIQKYPQGHVRNNMDQIYVVYLSKYIPLAETTKPVFTFEHPN-FMNSSNERSDSIEFVMDRNADLMGFAGYFDLQLYKTVMLSIEPSTHTPGMVSWFPAVIPLRDQLRVGEGDRISLKIDRKVDNTGVWYEWHVEKKKTNGESVSTPIQNPNGESYYMRM 734          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Celegans
Match: prmt-5 (Protein arginine N-methyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:P46580])

HSP 1 Score: 256.914 bits (655), Expect = 3.540e-74
Identity = 207/645 (32.09%), Postives = 295/645 (45.74%), Query Frame = 3
Query:  246 VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGD-SISNFMLMLA----LPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFL---KMKIQLVLTGDAKNLHGHLA--YRQYLSWIWTN---KCPMTVYEKHSK--------DMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSAN---------CEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRA--------DIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKK------------------TKYA------SLETPYVVRLLNCHLLAP-VQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWAC----TNPEVTS--IHNPNGRSYSMSL 1973
            VVGKIS WID D+   +F   SE+ LL+EL +  + G   + I L + ++   A +L  ++      F +W+ LP   E    C + +    +     + W  F    G+ S   F + L     LP    +  +++ W +EP+AA    + ++ + + G   +   + +++        ++I L  T D    +  +   Y Q L     N   +    V E  +         + +D LQ PLQPL+++L S  Y+ FE D  KY  Y +A   A+ DL      DG                      ++ + I +LG GRGP+     K+    N          +VK+YIVEKNPNA+  L       W  R V +   DMR   LP  A        DI VSELLGSFGDNELSPECLDG   FLKP  ISIPQ YTSY+ P+ ST +   +  Q  P  S+                    KY       +++  YVV L     LA   + VFTFEHP   +N+SN+R   + F +  +  + GFAG+F   LYK V +SI P  H+P M SWFP V P+   +++     +S  I R  ++  VWYEW      TN E  S  I NPNG SY M +
Sbjct:  123 VVGKISPWIDCDSSDPAFASLSEEHLLKELSYICYLGLQTMAIELTRISSPRTAAILKKWIWTRNSRFTVWVQLPSAIE---KCKDYDAFTIEHVDLWTIWADFRKNCGNFSGVYFQVALTISSELPDELTELKLVDRWKAEPLAAFVIESGLFISGRNGEASIPSAHINLLKHLWTTDALRIVLRATTDTFKYNTSIKSEYSQALRHAVRNVNYRSRPDVGEGSNDSTHYLNVIEYKDVLQAPLQPLSENLDSGVYNTFEQDQIKYDVYGEAVVGALKDL----GADG----------------------RKTVVIYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNPNAIVTLKYMNVRTWKRR-VTIIESDMRS--LPGIAKDRGFEQPDIIVSELLGSFGDNELSPECLDGVTGFLKPTTISIPQKYTSYVKPIMSTHIHQTIKAQSIPYLSRAIPSHGRGEPELDEDEMWIQKYPQGHVRNNMDQIYVVYLSKYIPLAETTKPVFTFEHPN-FMNSSNERSDSIEFVMDRNADLMGFAGYFDLQLYKTVMLSIEPSTHTPGMVSWFPAVIPLRDQLRVGEGDRISLKIDRKVDNTGVWYEWHVEKKKTNGESVSTPIQNPNGESYYMRM 734          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Fly
Match: csul (gene:FBgn0015925 transcript:FBtr0089871)

HSP 1 Score: 317.775 bits (813), Expect = 6.167e-98
Identity = 185/577 (32.06%), Postives = 294/577 (50.95%), Query Frame = 3
Query:  270 IDLDNELESFRKKSEKAXXXXXXWAS-FQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMID------ETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHS-KDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTN-PEVTSIHNPNGRSYSMSL 1973
            +++D+  +  R+ +++  + ++ WA   Q    +++RL+   N NLA ++     +D+ +   +I +P+ +      E             + N P +WW    ++   S    +++         +  +  W  EPI A+   + ++  N+  + VL  E+Q I+  F+ ++  ++++ +  N      Y  Y++ +  + C     +KH     E+ L+ PLQPL D+L + TY +FE DP KY  Y+ A   A+ D +   +   ++ +                       +M+LG GRGPL  + F AA+    +V++YI+EKNPNA+  L+  + + W ++DV +F+ DMR+   P  ADI VSELLGSFGDNELSPECLDGA   LKPDGISIP   TSYI PL S  L   +    P        Y + +  YV  L N + +   Q++F F HP    N  N R + + FKV +D V+HG  G+F   LYKD+ +SI+P  H+P MFSWFP+ F   +P  ++    +S   WR  ++  VWYEW   N P+    HN  G  Y+M L
Sbjct:   71 VNVDSPNDKLREHAKEVFMRDVAWAEHLQNVGNLMVRLRGPENENLASIVLAKTKDDFPSGNWFIQVPITNPELATFEHRKDATAEEVAEAESNDPWNWWNNLRMVTKHSTKVKVVIELNDADRPSKETVRRWLGEPIEAIIIPSSLFVRNRSNYCVLKKEWQLIVGHFISVRANIIISTNP-NDKALCQYADYVNKLINDNC-----DKHMLNSYENMLEIPLQPLCDNLDTYTYEVFETDPVKYKLYQDAVQAALLDRVSAAEAKTKLTV-----------------------VMLLGGGRGPLARAVFNAAELTKRKVRLYIIEKNPNAIRTLSNMVKTLWADKDVHIFSKDMRDFSPPELADIMVSELLGSFGDNELSPECLDGALKLLKPDGISIPYKSTSYINPLMSAVLHQNVCQLLP-------TYPAFDYGYVSLLKNIYHIDEPQALFEFVHPNRAENIDNTRCKTVSFKVNKDCVLHGIGGYFDTHLYKDICLSINPLTHTPGMFSWFPMFFA-TRPRTLREGQTISIQFWRCVDATKVWYEWQVVNSPDDWEHHNTRGTGYNMRL 610          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Fly
Match: csul (gene:FBgn0015925 transcript:FBtr0089872)

HSP 1 Score: 312.768 bits (800), Expect = 4.434e-96
Identity = 184/573 (32.11%), Postives = 292/573 (50.96%), Query Frame = 3
Query:  270 IDLDNELESFRKKSEKAXXXXXXWAS-FQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEY--SCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHS-KDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTN-PEVTSIHNPNGRSYSMSL 1973
            +++D+  +  R+ +++  + ++ WA   Q    +++RL+   N NLA ++      ++   ++ I  P +   E+            + N P +WW    ++   S    +++         +  +  W  EPI A+   + ++  N+  + VL  E+Q I+  F+ ++  ++++ +  N      Y  Y++ +  + C     +KH     E+ L+ PLQPL D+L + TY +FE DP KY  Y+ A   A+ D +   +   ++ +                       +M+LG GRGPL  + F AA+    +V++YI+EKNPNA+  L+  + + W ++DV +F+ DMR+   P  ADI VSELLGSFGDNELSPECLDGA   LKPDGISIP   TSYI PL S  L   +    P        Y + +  YV  L N + +   Q++F F HP    N  N R + + FKV +D V+HG  G+F   LYKD+ +SI+P  H+P MFSWFP+ F   +P  ++    +S   WR  ++  VWYEW   N P+    HN  G  Y+M L
Sbjct:   71 VNVDSPNDKLREHAKEVFMRDVAWAEHLQNVGNLMVRLRGPENENLASIVLAKTKGNWF-IQVPITNPELATFEHRKDATAEEVAEAESNDPWNWWNNLRMVTKHSTKVKVVIELNDADRPSKETVRRWLGEPIEAIIIPSSLFVRNRSNYCVLKKEWQLIVGHFISVRANIIISTNP-NDKALCQYADYVNKLINDNC-----DKHMLNSYENMLEIPLQPLCDNLDTYTYEVFETDPVKYKLYQDAVQAALLDRVSAAEAKTKLTV-----------------------VMLLGGGRGPLARAVFNAAELTKRKVRLYIIEKNPNAIRTLSNMVKTLWADKDVHIFSKDMRDFSPPELADIMVSELLGSFGDNELSPECLDGALKLLKPDGISIPYKSTSYINPLMSAVLHQNVCQLLP-------TYPAFDYGYVSLLKNIYHIDEPQALFEFVHPNRAENIDNTRCKTVSFKVNKDCVLHGIGGYFDTHLYKDICLSINPLTHTPGMFSWFPMFFA-TRPRTLREGQTISIQFWRCVDATKVWYEWQVVNSPDDWEHHNTRGTGYNMRL 605          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Fly
Match: Art4 (gene:FBgn0037770 transcript:FBtr0082150)

HSP 1 Score: 50.447 bits (119), Expect = 5.817e-6
Identity = 39/139 (28.06%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 1083 SIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFS 1499
            +I+G +  +  ++KI ++ +GAG G L   A +A  +     K+Y +E + N   Y  + + S+     + +  G + E+ LP + D+ +SE +G    NE   E    A+ +LKP G   P     +IAP     L+S
Sbjct:  170 AILGNA--VDFQDKI-VLDVGAGSGILSFFAVQAGAA-----KVYAIEAS-NMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGYMLYNERMLETYLHARKWLKPQGKMYPTHGDLHIAPFSDESLYS 299          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Fly
Match: Art4 (gene:FBgn0037770 transcript:FBtr0333687)

HSP 1 Score: 50.447 bits (119), Expect = 5.817e-6
Identity = 39/139 (28.06%), Postives = 68/139 (48.92%), Query Frame = 3
Query: 1083 SIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFS 1499
            +I+G +  +  ++KI ++ +GAG G L   A +A  +     K+Y +E + N   Y  + + S+     + +  G + E+ LP + D+ +SE +G    NE   E    A+ +LKP G   P     +IAP     L+S
Sbjct:  170 AILGNA--VDFQDKI-VLDVGAGSGILSFFAVQAGAA-----KVYAIEAS-NMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKVDVIISEPMGYMLYNERMLETYLHARKWLKPQGKMYPTHGDLHIAPFSDESLYS 299          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Match: prmt5 (protein arginine methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-585])

HSP 1 Score: 473.011 bits (1216), Expect = 4.183e-157
Identity = 268/654 (40.98%), Postives = 372/654 (56.88%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQK-------DNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHL-AYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  + +       LGF F+   ++    R  +E D ++    S P   QT    ++ G      +VGK+S WI+ D+EL + R+ SE AL++EL + ++ G PA +I L+  +  NLAR+L   +   + +   WI +P++   +       N P K       D    +WW  F  L  D      L + +        +I+ W  EPI A    T I+ TNKKGFPVLS  +Q II R  K++ Q + TG  ++    L +Y QYL ++  N+     YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + + +  V +                       +MVLGAGRGPLV+++ +AA  A  ++++Y VEKNPNAV  L      +W ++ V + + DMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP SYTS++APL S+KL++ +   R  R   K      ETPYVVRL N H LA  Q+ FTF HP  D+N  N+RY+ L F V  + V+HGFAG+F   LYK+VT+SI P+ HSP MFSWFPI+FP+ +PI +     +    WR  N K VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   13 GRDLSCVPEVADTLAAVAKLGFDFLCMPLFHPRFRRENELDPAK----SRPG-AQTRSDLLLCGRDWNTLIVGKLSPWIETDSELTTERRNSEAALVQELNFCAYLGLPAFMIPLRGPHCANLARILLNHIHTGHHSCMFWIRVPLMAPEDTREDLIENEPSKQMDDGSNDEKTWAWWHSFRTLC-DYNKRICLAIEIGADLPSDTLIDKWLGEPIKAAILPTSIFLTNKKGFPVLSKAHQRIIFRLFKLEAQFIFTGQNRHSEKDLRSYLQYLEYLNQNRPAPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAVYRCLLDRVPEEQMETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQAKRKLRVYAVEKNPNAVVTLENWKFEEWGDQ-VTVVSCDMREWTSPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPCSYTSFLAPLSSSKLYNEV---RGCRERDKDPECHFETPYVVRLHNFHQLADPQACFTFVHPTTDMN--NNRYQCLRFPVGCNSVLHGFAGYFEATLYKEVTLSIKPETHSPGMFSWFPILFPLKQPIPLSCGDNVCVRFWRCNNGKKVWYEWAVTEPVCSAIHNPAGRSYTIGL 631          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Match: prmt5 (protein arginine methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-585])

HSP 1 Score: 431.409 bits (1108), Expect = 5.371e-141
Identity = 257/654 (39.30%), Postives = 364/654 (55.66%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSP-----ISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHL-AYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  + +       LGF F+   ++    R  +E D ++    S P   QT    ++ G      +VGK+S WI+ D+EL + R+ SE AL++EL + ++ G PA +I L+  +  NLAR+L   +   + +   WI +P++  ++T    +      Q D+        +WW  F  L  D      L + +        +I+ W  EPI A    T I+ TNKKGFPVLS  +Q II R  K++ Q + TG  ++    L +Y QYL ++  N+     YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + + +  V +                       +MVLGAGRGPLV+++ +AA  A  ++++Y VEKNPNAV  L      +W ++ V + + DMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP SYTS++APL S+KL++ +   R  R   K      ETPYVVRL N H LA  Q+ FTF HP  D+N  N+RY+ L F V  + V+HGFAG+F   LYK+VT+S    + +P  FS     F + +PI +     +    WR  N K VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   13 GRDLSCVPEVADTLAAVAKLGFDFLCMPLFHPRFRRENELDPAK----SRPG-AQTRSDLLLCGRDWNTLIVGKLSPWIETDSELTTERRNSEAALVQELNFCAYLGLPAFMIPLRGPHCANLARILLNHIHTGHHSCMFWIRVPLMAPEDTREDLIENEPSKQMDDGSNDEKTWAWWHSFRTLC-DYNKRICLAIEIGADLPSDTLIDKWLGEPIKAAILPTSIFLTNKKGFPVLSKAHQRIIFRLFKLEAQFIFTGQNRHSEKDLRSYLQYLEYLNQNRPAPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAVYRCLLDRVPEEQMETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQAKRKLRVYAVEKNPNAVVTLENWKFEEWGDQ-VTVVSCDMREWTSPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPCSYTSFLAPLSSSKLYNEV---RGCRERDKDPECHFETPYVVRLHNFHQLADPQACFTFVHPTTDMN--NNRYQCLRFPVGCNSVLHGFAGYFEATLYKEVTLS--NVILTPFFFS-----FLMQQPIPLSCGDNVCVRFWRCNNGKKVWYEWAVTEPVCSAIHNPAGRSYTIGL 624          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Match: carm1l (coactivator-associated arginine methyltransferase 1, like [Source:ZFIN;Acc:ZDB-GENE-090312-219])

HSP 1 Score: 58.5362 bits (140), Expect = 2.089e-8
Identity = 68/279 (24.37%), Postives = 115/279 (41.22%), Query Frame = 3
Query: 1113 LKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLA-------PVQSVFTFE-----HPKPDINASNDRYREL-------VFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPD-MFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSK 1889
             K+K+ + V G G G L   A +A        K+Y VE +  A  Y    + S+  +  + + +G + EV  P + D+ +SE +G    NE   E    A+H+LKP G+  P     ++AP     L  YM       +  ++ + +    Y V L   H  A       P+   F  +       K  IN    +  +L       VFK+ + G+IHG A +F  + +    M+I       + +  W+ +   +  P+  K    LS H+  + N +
Sbjct:  164 FKDKVVLDV-GCGTGILSFFAVQAGAQ-----KVYAVEASTVA-KYAEMLVRSNGLSNKITVLSGRIEEVSCPEKVDVIISEPMGYMLLNERMLESFLHAKHWLKPKGMMFPTQSDIHLAPFTDEHL--YM------EHHARSNFWNQSCFYGVNLSGLHSSAVDEFFKQPIVDTFDMQILMARSVKYTINFLEAKEEDLHRLEIPFVFKLLQSGLIHGLAFWFD-VAFVGSKMTIWLSTSPTEPLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKR 426          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Match: CR352251.1 (coactivator-associated arginine methyltransferase 1, like [Source:NCBI gene;Acc:100003090])

HSP 1 Score: 58.5362 bits (140), Expect = 2.125e-8
Identity = 68/279 (24.37%), Postives = 115/279 (41.22%), Query Frame = 3
Query: 1113 LKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLA-------PVQSVFTFE-----HPKPDINASNDRYREL-------VFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPD-MFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSK 1889
             K+K+ + V G G G L   A +A        K+Y VE +  A  Y    + S+  +  + + +G + EV  P + D+ +SE +G    NE   E    A+H+LKP G+  P     ++AP     L  YM       +  ++ + +    Y V L   H  A       P+   F  +       K  IN    +  +L       VFK+ + G+IHG A +F  + +    M+I       + +  W+ +   +  P+  K    LS H+  + N +
Sbjct:  164 FKDKVVLDV-GCGTGILSFFAVQAGAQ-----KVYAVEASTVA-KYAEMLVRSNGLSNKITVLSGRIEEVSCPEKVDVIISEPMGYMLLNERMLESFLHAKHWLKPKGMMFPTQSDIHLAPFTDEHL--YM------EHHARSNFWNQSCFYGVNLSGLHSSAVDEFFKQPIVDTFDMQILMARSVKYTINFLEAKEEDLHRLEIPFVFKLLQSGLIHGLAFWFD-VAFVGSKMTIWLSTSPTEPLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKR 426          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Match: BX936392.2 (coactivator-associated arginine methyltransferase 1, like [Source:NCBI gene;Acc:100003090])

HSP 1 Score: 58.5362 bits (140), Expect = 2.125e-8
Identity = 68/279 (24.37%), Postives = 115/279 (41.22%), Query Frame = 3
Query: 1113 LKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLA-------PVQSVFTFE-----HPKPDINASNDRYREL-------VFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPD-MFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSK 1889
             K+K+ + V G G G L   A +A        K+Y VE +  A  Y    + S+  +  + + +G + EV  P + D+ +SE +G    NE   E    A+H+LKP G+  P     ++AP     L  YM       +  ++ + +    Y V L   H  A       P+   F  +       K  IN    +  +L       VFK+ + G+IHG A +F  + +    M+I       + +  W+ +   +  P+  K    LS H+  + N +
Sbjct:  164 FKDKVVLDV-GCGTGILSFFAVQAGAQ-----KVYAVEASTVA-KYAEMLVRSNGLSNKITVLSGRIEEVSCPEKVDVIISEPMGYMLLNERMLESFLHAKHWLKPKGMMFPTQSDIHLAPFTDEHL--YM------EHHARSNFWNQSCFYGVNLSGLHSSAVDEFFKQPIVDTFDMQILMARSVKYTINFLEAKEEDLHRLEIPFVFKLLQSGLIHGLAFWFD-VAFVGSKMTIWLSTSPTEPLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKR 426          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Match: PRMT5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100145788])

HSP 1 Score: 464.922 bits (1195), Expect = 1.007e-153
Identity = 263/657 (40.03%), Postives = 374/657 (56.93%), Query Frame = 3
Query:   60 DIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSPIS------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH-----LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            D+  V  + +        GF F+   I+  H R   E           P   QT    +++G      +VGK+S WI  D+++   RK SE AL +EL ++++ G PA LI LK+++N+NL+R+L   +   + +   W+ +P++  ++     +    + Q +   I       WW  F  L  D      L + +     + +II+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R  K+++Q V++G     H H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  + +                       +MVLGAGRGPLV+++ +AA  A  ++K+Y VEKNPNAV  L      +W ++ V + +GDMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP  YTSY+AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+     FTF HP  D    N+RY  L ++V  + V+HGFAG+F  +LYKDVT+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  N K VWYEWA T+P  ++IHNP GRSY++ L
Sbjct:   17 DLGCVTEVADTLGAVAKQGFDFLCMPIF--HPRFKREFFKEPAKSRPGP---QTRSDLLLSGRDWNTLIVGKLSDWIKTDSKVSGIRKTSEAALQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHTGHHSTMFWMRVPLMAPNDLRDDIIENEPLSQSEEDNIDEERTWIWWHNFRSLC-DYNKRVALAIEVGADLPNGHIIDRWLGEPIKAAFLPTSIFLTNKKGFPVLSKVHQRLIFRLFKLEVQFVISG----AHHHSEKDFCSYLQYLEYLSQNRPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQV-----------------------LMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQ-VTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKEDGVSIPSEYTSYLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFLHPNKDAVIDNNRYICLQYRVDLNTVLHGFAGYFDAVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPLREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL 636          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Match: PRMT5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100145788])

HSP 1 Score: 462.611 bits (1189), Expect = 4.961e-153
Identity = 253/605 (41.82%), Postives = 359/605 (59.34%), Query Frame = 3
Query:  216 QTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSPIS------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH-----LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            QT    +++G      +VGK+S WI  D+++   RK SE AL +EL ++++ G PA LI LK+++N+NL+R+L   +   + +   W+ +P++  ++     +    + Q +   I       WW  F  L  D      L + +     + +II+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R  K+++Q V++G     H H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  + +                       +MVLGAGRGPLV+++ +AA  A  ++K+Y VEKNPNAV  L      +W ++ V + +GDMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP  YTSY+AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+     FTF HP  D    N+RY  L ++V  + V+HGFAG+F  +LYKDVT+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  N K VWYEWA T+P  ++IHNP GRSY++ L
Sbjct:   48 QTRSDLLLSGRDWNTLIVGKLSDWIKTDSKVSGIRKTSEAALQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHTGHHSTMFWMRVPLMAPNDLRDDIIENEPLSQSEEDNIDEERTWIWWHNFRSLC-DYNKRVALAIEVGADLPNGHIIDRWLGEPIKAAFLPTSIFLTNKKGFPVLSKVHQRLIFRLFKLEVQFVISG----AHHHSEKDFCSYLQYLEYLSQNRPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQV-----------------------LMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQ-VTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKEDGVSIPSEYTSYLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFLHPNKDAVIDNNRYICLQYRVDLNTVLHGFAGYFDAVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPLREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL 620          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Match: PRMT5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100145788])

HSP 1 Score: 462.996 bits (1190), Expect = 5.493e-153
Identity = 253/605 (41.82%), Postives = 359/605 (59.34%), Query Frame = 3
Query:  216 QTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSPIS------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH-----LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            QT    +++G      +VGK+S WI  D+++   RK SE AL +EL ++++ G PA LI LK+++N+NL+R+L   +   + +   W+ +P++  ++     +    + Q +   I       WW  F  L  D      L + +     + +II+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R  K+++Q V++G     H H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  + +                       +MVLGAGRGPLV+++ +AA  A  ++K+Y VEKNPNAV  L      +W ++ V + +GDMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP  YTSY+AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+     FTF HP  D    N+RY  L ++V  + V+HGFAG+F  +LYKDVT+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  N K VWYEWA T+P  ++IHNP GRSY++ L
Sbjct:   65 QTRSDLLLSGRDWNTLIVGKLSDWIKTDSKVSGIRKTSEAALQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHTGHHSTMFWMRVPLMAPNDLRDDIIENEPLSQSEEDNIDEERTWIWWHNFRSLC-DYNKRVALAIEVGADLPNGHIIDRWLGEPIKAAFLPTSIFLTNKKGFPVLSKVHQRLIFRLFKLEVQFVISG----AHHHSEKDFCSYLQYLEYLSQNRPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQV-----------------------LMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQ-VTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKEDGVSIPSEYTSYLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFLHPNKDAVIDNNRYICLQYRVDLNTVLHGFAGYFDAVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPLREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Match: PRMT5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100145788])

HSP 1 Score: 462.225 bits (1188), Expect = 7.430e-153
Identity = 250/589 (42.44%), Postives = 353/589 (59.93%), Query Frame = 3
Query:  246 VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSPIS------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH-----LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            +VGK+S WI  D+++   RK SE AL +EL ++++ G PA LI LK+++N+NL+R+L   +   + +   W+ +P++  ++     +    + Q +   I       WW  F  L  D      L + +     + +II+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R  K+++Q V++G     H H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  + +                       +MVLGAGRGPLV+++ +AA  A  ++K+Y VEKNPNAV  L      +W ++ V + +GDMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP  YTSY+AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+     FTF HP  D    N+RY  L ++V  + V+HGFAG+F  +LYKDVT+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  N K VWYEWA T+P  ++IHNP GRSY++ L
Sbjct:   69 IVGKLSDWIKTDSKVSGIRKTSEAALQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHTGHHSTMFWMRVPLMAPNDLRDDIIENEPLSQSEEDNIDEERTWIWWHNFRSLC-DYNKRVALAIEVGADLPNGHIIDRWLGEPIKAAFLPTSIFLTNKKGFPVLSKVHQRLIFRLFKLEVQFVISG----AHHHSEKDFCSYLQYLEYLSQNRPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQV-----------------------LMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQ-VTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKEDGVSIPSEYTSYLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFLHPNKDAVIDNNRYICLQYRVDLNTVLHGFAGYFDAVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPLREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL 625          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Match: PRMT5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100145788])

HSP 1 Score: 427.943 bits (1099), Expect = 2.128e-139
Identity = 238/580 (41.03%), Postives = 339/580 (58.45%), Query Frame = 3
Query:  216 QTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI--DETEYSCVNGNNIPQKDNSPIS------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH-----LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVW 1898
            QT    +++G      +VGK+S WI  D+++   RK SE AL +EL ++++ G PA LI LK+++N+NL+R+L   +   + +   W+ +P++  ++     +    + Q +   I       WW  F  L  D      L + +     + +II+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R  K+++Q V++G     H H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  + +                       +MVLGAGRGPLV+++ +AA  A  ++K+Y VEKNPNAV  L      +W ++ V + +GDMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP  YTSY+AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+     FTF HP  D    N+RY  L ++V  + V+HGFAG+F  +LYKDVT+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  N K VW
Sbjct:   64 QTRSDLLLSGRDWNTLIVGKLSDWIKTDSKVSGIRKTSEAALQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHTGHHSTMFWMRVPLMAPNDLRDDIIENEPLSQSEEDNIDEERTWIWWHNFRSLC-DYNKRVALAIEVGADLPNGHIIDRWLGEPIKAAFLPTSIFLTNKKGFPVLSKVHQRLIFRLFKLEVQFVISG----AHHHSEKDFCSYLQYLEYLSQNRPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQV-----------------------LMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQ-VTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKEDGVSIPSEYTSYLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFLHPNKDAVIDNNRYICLQYRVDLNTVLHGFAGYFDAVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPLREGDTVCVRFWRCNNGKKVW 611          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Mouse
Match: Prmt5 (protein arginine N-methyltransferase 5 [Source:MGI Symbol;Acc:MGI:1351645])

HSP 1 Score: 471.855 bits (1213), Expect = 1.374e-156
Identity = 265/656 (40.40%), Postives = 369/656 (56.25%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS   Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  V +                       +MVLGAGRGPLV+++ +AA  A   +++Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  +  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI FPI +PI +     +    WR  NSK VWYEWA T P  +SIHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Mouse
Match: Prmt5 (protein arginine N-methyltransferase 5 [Source:MGI Symbol;Acc:MGI:1351645])

HSP 1 Score: 150.984 bits (380), Expect = 3.507e-41
Identity = 83/222 (37.39%), Postives = 122/222 (54.95%), Query Frame = 3
Query:  630 NIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNR 1286
            ++I+ W  EPI A    T I+ TNKKGFPVLS           K+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  V +                       +MVLGAGRGPLV+++ +AA  A   +++Y VEKNPNAV  L      +W ++
Sbjct:   13 HVIDRWLGEPIKAAILPTSIFLTNKKGFPVLS-----------KLEVQFIITGT--NHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQ 198          
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Match: sp|Q5R698|ANM5_PONAB (Protein arginine N-methyltransferase 5 OS=Pongo abelii OX=9601 GN=PRMT5 PE=2 SV=3)

HSP 1 Score: 480.715 bits (1236), Expect = 4.400e-159
Identity = 268/656 (40.85%), Postives = 373/656 (56.86%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+E+E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSEVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTQEYSGEEKTWIWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Match: sp|O14744|ANM5_HUMAN (Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4)

HSP 1 Score: 479.174 bits (1232), Expect = 1.688e-158
Identity = 267/656 (40.70%), Postives = 373/656 (56.86%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Match: sp|Q4R5M3|ANM5_MACFA (Protein arginine N-methyltransferase 5 OS=Macaca fascicularis OX=9541 GN=PRMT5 PE=2 SV=3)

HSP 1 Score: 478.019 bits (1229), Expect = 4.167e-158
Identity = 266/656 (40.55%), Postives = 373/656 (56.86%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E+          P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ +   + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKRESIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLGRVPEEEKDTNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Match: sp|A7YW45|ANM5_BOVIN (Protein arginine N-methyltransferase 5 OS=Bos taurus OX=9913 GN=PRMT5 PE=2 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 5.565e-157
Identity = 265/656 (40.40%), Postives = 372/656 (56.71%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS  +Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  + +                       +MVLGAGRGPLV+++ +AA  A+  +K+Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPE LDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  Q  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI+FPI +PI ++    +    WR  NSK VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFTQEPAKSRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTSHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNIQV-----------------------LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPESLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Match: sp|Q8CIG8|ANM5_MOUSE (Protein arginine N-methyltransferase 5 OS=Mus musculus OX=10090 GN=Prmt5 PE=1 SV=3)

HSP 1 Score: 471.47 bits (1212), Expect = 1.400e-155
Identity = 265/656 (40.40%), Postives = 369/656 (56.25%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPIS-------WWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGH---LAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I +        GF F+   ++  H R   E           P   QT    +++G      +VGK+S WI  D+++E  R+ SE A+L+EL + ++ G PA L+ L +++NTNLARVLT  +   + +   W+ +P++   +       N P       S       WW  F  L  D      + L +       ++I+ W  EPI A    T I+ TNKKGFPVLS   Q +I R LK+++Q ++TG   N H      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  V +                       +MVLGAGRGPLV+++ +AA  A   +++Y VEKNPNAV  L      +W ++ V + + DMRE + P +ADI VSELLGSF DNELSPECLDGAQHFLK DG+SIP  YTS++AP+ S+KL++ +   R  R   +   A  E PYVVRL N H L+  +  FTF HP  D    N+RY  L F V+ + V+HGFAG+F  +LY+D+T+SI P+ HSP MFSWFPI FPI +PI +     +    WR  NSK VWYEWA T P  +SIHNP GRSY++ L
Sbjct:   17 GRDLNCVPEIADTLGAVAKQGFDFLCMPVF--HPRFKREFIQEPAKNRPGP---QTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIANAPTTHTEEYSGEEKTWMWWHNFRTLC-DYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLKLEVQFIITG--TNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQ-VTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEV---RACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL 637          
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Match: H2ESD8 (Protein arginine N-methyltransferase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 649/650 (99.85%), Postives = 650/650 (100.00%), Query Frame = 3
Query:   33 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 1982
            MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYK+VTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK
Sbjct:    1 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKNVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 650          
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Match: C1LE95 (Protein arginine N-methyltransferase OS=Schistosoma japonicum OX=6182 GN=Prmt5 PE=2 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 297/661 (44.93%), Postives = 417/661 (63.09%), Query Frame = 3
Query:   33 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNF-LQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDN-------SPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFAS------IVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            M  ++L+G+D+    ++   +  A+S GFSF+  +++   +   +E+ D+ T  L   +F  + N  SI+  +VGK+S+ ID+D+++ S RK   + L++EL WA+  G PAV IR+ +  N NLAR+L  F+  +Y+  +IWI LPM+     S V   N  ++ N       SP  WW   S +  D      ++L LP    D++II+ W+SEP+  L   T ++ TN KG+PVL   +Q IINRF K+ +Q++LTG  ++  G+  Y+QY++W+W ++    +YE+ SK +ED LQ+PLQPL D+L S+TYSIFE+DP+KY AYE A ++A+ D   K K    V  N+ K   S      + G   N +      +MVLGAGRGPLV++   AA+ A C+V++Y VEKNPNA+  L  R+  +W   DV+L  GDMR++  P +ADIFVSELLGSFGDNELSPECLDGAQ  LK DGISIP SYTSY+APLQS ++  Y  T+R    + K  + S+ETPYVVRL NC +L P Q  FTFEHPK ++N SN R     FK+++D VIHG AG+F   LYKDV +S HPD HSP M SWFP+VFP   PI + + + ++ H+WR  +S+ VWYEW  T P  T IHN  G  Y ++L
Sbjct:    1 MVSEALVGLDLVFTSDVSSQYSSAVSSGFSFLCVDLFHP-KLVIEESPDNSTGLLPRSDFAYEKNGKSIMKSLVGKVSTTIDVDSDIMSIRKYGAQTLMKELSWAAHLGLPAVSIRVNRPVNPNLARLLINFIRGEYIPIKIWIVLPMVINFSGSYVVNKNENEESNFDEISFQSPWHWWLNLSTMTADISDALGIVLELPYDLPDESIISRWFSEPVVCLLVHTQLFLTNAKGYPVLPKSHQHIINRFFKLNVQILLTGACRHDKGYAVYQQYIAWLWQSQDAPDLYEEQSKGLEDQLQEPLQPLRDNLSSTTYSIFEMDPFKYQAYETAIYKALCDRSSKCKLSAIVEDNSIKPLQSSMVKDHMEGYIDNGSHDSCQVVMVLGAGRGPLVNATINAAEKAQCKVRIYAVEKNPNALYTLRFRMNYEWRELDVQLIEGDMRDLKTPEKADIFVSELLGSFGDNELSPECLDGAQPMLKDDGISIPCSYTSYVAPLQSLQI--YNETKRSKDLTNKIGF-SMETPYVVRLRNCQILGPPQPAFTFEHPKKELNQSNAREVCCSFKIQQDAVIHGIAGYFEATLYKDVILSTHPDRHSPQMVSWFPLVFPFEYPIHVHSGNHVTLHLWRNVSSRYVWYEWVLTEPRPTKIHNAAGHVYKIAL 657          
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Match: A0A4E0RYV3 (Protein arginine N-methyltransferase OS=Fasciola hepatica OX=6192 GN=D915_007056 PE=3 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 277/661 (41.91%), Postives = 406/661 (61.42%), Query Frame = 3
Query:   33 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPN-----FLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETE--------YSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDG-EVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            M  ++L+G+D+    ++   +  A+S GFSFV  +++  H +    N    T +   P+       Q +  +I   +VGK+S+++D+D EL   R  +E  L ++L W S  G PA+ +RL   ++ NLAR+LTTF+ ++Y   ++WI +PM  ++E         S V   + P+  +SP  WW Q S L  D      ++L +PK+  D+ +I  W SEP+  L   TD++ TN KGFPVL   +Q+++ RF K+ +Q+++TG  ++  G++ Y+QY++W+W N+    VYE  SK +ED LQ+PLQPL D+L S+TYSIFE+D YKY AYE+A ++A+     +    G +  + +T +                  +MVLGAGRGPLV++   A+  A+C V++Y++EKNPNA+  L  R++ +W   DV L  GDMR + +P +ADIFVSELLGSFGDNELSPECLDGAQ  LK DGISIP SYTSY+ P+QS + ++     R P    +T  A  ETPYVVRL NC +L   Q VFTF HPKPD+  SN RY    F +K + ++HG AG+F  +L+ DVT+S HP  HSP M SWFP+  P+ +P  ++A   ++ H+WRV +S  VWYEWA T P  + IHN  G++Y ++L
Sbjct:    1 MGDRALVGLDLSFTSDLVSQYTSALSSGFSFVSFDLF--HPKVFVPNCPELTTRHGIPSTRSDLVFQKDGKNITKCLVGKLSNYLDVDTELRWLRNMNEVTLQKQLHWGSHLGLPALSMRLNGPSSVNLARLLTTFIHDEYTPVKLWIIVPMCIDSEAPESHDTPVSEVTTQSGPEHSDSPWHWWMQLSSLASDITDALGVVLQIPKNLPDEPVIARWLSEPVCCLLLCTDVFLTNSKGFPVLPKSHQEVVRRFFKLNVQVLITGACRHDRGYVTYQQYVTWLWKNQSSPDVYELQSKGLEDQLQEPLQPLRDNLSSTTYSIFEMDGYKYTAYEQAIYKALVHRCTRLGPKGDDAKLESTPACQ---------------VVMVLGAGRGPLVNATLSASKRADCPVRVYVIEKNPNALYTLQDRMSHEWRGLDVHLICGDMRALDVPEKADIFVSELLGSFGDNELSPECLDGAQPHLKDDGISIPCSYTSYLTPIQSLQFYNETKRMRDPTNPSRTLIAQ-ETPYVVRLRNCQILCEPQKVFTFVHPKPDLKESNSRYSICTFPIKNEAIVHGLAGYFEAVLFDDVTLSTHPQRHSPQMVSWFPLAIPLDRPQHVRAGEHVTVHLWRVVDSHHVWYEWALTEPRPSRIHNAAGQAYKIAL 643          
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Match: A0A504YWY1 (Protein arginine N-methyltransferase OS=Fasciola gigantica OX=46835 GN=FGIG_00772 PE=3 SV=1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 277/661 (41.91%), Postives = 404/661 (61.12%), Query Frame = 3
Query:   33 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPN-----FLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETE--------YSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDG-EVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            M  ++L+G+D+    ++   +  A+S GFSFV  +++  H +    N    T +   P+       Q +  +I   +VGK+S ++D+D EL   R  +E  L ++L W S  G PA+ +RL   +  NLAR+LTTF+ ++Y   ++WI +PM  ++E         S V   + P+  +SP  WW Q S L  D      ++L +PK+  D+ +I  W SEP+  L   TD++ TN KGFPVL   +Q+++ RF K+ +Q+++TG  ++  G++ Y+QY++W+W N+    VYE  SK +ED LQ+PLQPL D+L S+TYSIFE+D YKY AYE+A ++A+     +    G +  + +T +                  +MVLGAGRGPLV++   A+  A+C V++Y++EKNPNA+  L  R++ +W   DV L  GDMR + +P +ADIFVSELLGSFGDNELSPECLDGAQ  LK DGISIP SYTSY+ P+QS + ++     R P    +T  A  ETPYVVRL NC +L   Q VFTF HPKPD+  SN RY    F +K + ++HG AG+F  +L+ DVT+S HP  HSP M SWFP+  P+ +P  ++A   ++ H+WRV +S  VWYEWA T P  + IHN  G++Y ++L
Sbjct:    1 MGDRALVGLDLLFTSDLVSQYTSALSSGFSFVSFDLF--HPKVFVPNCPELTTRHGIPSTRSDLVFQKDGKNITKCLVGKLSHYLDVDTELRWLRNMNEVTLQKQLHWGSHLGLPALSMRLNGPSIVNLARLLTTFIHDEYTPVKLWIIVPMCIDSEAPESHDTPVSEVTTQSGPEHSDSPWHWWMQLSSLASDITDALGVVLQIPKNLPDEPVIARWLSEPVCCLLLCTDVFLTNSKGFPVLPKSHQEVVRRFFKLNVQVLITGACRHDRGYVTYQQYVTWLWKNQSSPDVYELQSKGLEDQLQEPLQPLRDNLSSTTYSIFEMDGYKYTAYEQAIYKALVHRCTRSDPKGDDAKLESTPACQ---------------VVMVLGAGRGPLVNATLSASKRADCPVRVYVIEKNPNALYTLQDRMSHEWRGLDVHLICGDMRALDVPEKADIFVSELLGSFGDNELSPECLDGAQPHLKDDGISIPCSYTSYLTPIQSLQFYNETKRMRDPTNPSRTLIAQ-ETPYVVRLRNCQVLCEPQKVFTFVHPKPDLKESNSRYSICTFPIKNEAIVHGLAGYFEAVLFDDVTLSTHPQRHSPQMVSWFPLAIPLDRPQHVRAGEHVTVHLWRVVDSHHVWYEWALTEPRPSRIHNAAGQAYKIAL 643          
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Match: A0A3Q0KT70 (Protein arginine N-methyltransferase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 290/676 (42.90%), Postives = 418/676 (61.83%), Query Frame = 3
Query:   21 LKSTMNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDEN-------DDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNN-IPQKDN-----------SPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINN------TKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            L  +M  ++L+G+D+    ++   +  A+S GFSF+  +++  H ++  E+        D R+D        + N  SI   +VGK+S+ ID+D ++ S R+   + L++EL WA+  G PAV+IR+ +  N NLAR+L  F+  +Y   ++W+  P++       +NG+N + + DN           SP  WW   S +  D      ++L +P    ++++I+ W+SEP+  L   T ++ TN KG+PVL   +Q II+RF K+ +Q+VLTG  +N  G+ AY+QY++W+W ++    +YE+ SK +ED LQ+PLQPL D+L S+TYSIFE+DP+KY AYE A ++A+ D + K  +   V  N+      +      V  S N        +MVLGAGRGPLV++   AA+ A C+V++Y VEKNPNA+  L  RI  +W   DV+L  GDMR +  P +ADIFVSELLGSFGDNELSPECLDGAQ  LK DGISIP SYTSY+APLQS ++  Y  T+R    + +  Y S+ETPYVVRL NC +L+  Q  FTFEHPK D+N SN R     F +++D V+HG AG+F  +LYKDVT+S HPD HSP M SWFP+VFP   PI + +  +++ ++WR  +S+ VWYEW  T P  T IHN  G  Y ++L
Sbjct:    5 LVESMVSEALVGLDLIFTNDVSSQYSSALSSGFSFLCIDLF--HPKSILEDLSITSVGPDPRSDFA-----YEKNGKSITKSLVGKLSTTIDVDADIISIRQSGAQLLMKELSWAAHLGLPAVVIRVNRPTNPNLARLLINFIRGEYTPIKVWLVFPLVIN-----LNGSNKMSKMDNKESTPDELSIYSPWHWWLNLSTMTADITDALGIVLEIPNDLPNESVISRWFSEPVVCLLIDTQLFLTNSKGYPVLPKSHQYIISRFFKLNVQIVLTGACRNDKGYTAYQQYITWLWQSQDAPDLYEEQSKGLEDQLQEPLQPLRDNLSSTTYSIFEMDPFKYQAYETAIYKALCDRLSKYNESNTVTENHLIKPPQSSQTKEHVNASINHNSNTCQVVMVLGAGRGPLVNATINAAERAQCKVRIYAVEKNPNALCTLRSRINHEWQGLDVQLIEGDMRNLKTPEQADIFVSELLGSFGDNELSPECLDGAQPMLKDDGISIPCSYTSYVAPLQSLQI--YNETRRSKDVTNRVGY-SMETPYVVRLRNCQILSSPQPAFTFEHPKKDLNQSNAREVCCSFNIQQDAVVHGIAGYFEAVLYKDVTLSTHPDRHSPQMVSWFPLVFPFEYPIHVHSRDKITLYLWRNVSSRYVWYEWVLTEPRPTKIHNAAGHVYKIAL 665          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Cavefish
Match: prmt5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:103045296])

HSP 1 Score: 476.093 bits (1224), Expect = 2.164e-158
Identity = 269/658 (40.88%), Postives = 376/658 (57.14%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMI-----------DETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHL-AYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G DI  V  + +       LGF F+   ++    R   E D ++    +     QT    ++ G      +VGK+S WI+ D+EL + R+ SE AL++EL + ++ G PA +I LK     NLARVL   +   + +   WI +P++           +E      +GNN    +     WW  F  L  D      L + +       N+I+ W  EPI A    T I+ TNKKGFPVLS  +Q II R  K++ Q + TG +++      +Y QYL ++  N+ P   YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + +++  V +                       +MVLGAGRGPLV+++ +AA  A+ ++++Y VEKNPNAV  L      +W ++ V + + DMR+ + P +ADI VSELLGSFGDNELSPECLDGAQHFLK +G+SIP SYTS++APL S+KL++ +   R  R   K      ETPYVVRL N H LA  +  FTF HP  D+N  N+RY+ L F V  + V+HGFAG+F   LYKDVT+SI P+ HSP MFSWFPI+FP+ +PI +    ++S   WR  N K VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   13 GRDISCVPEVADTLAAVAKLGFDFLCMPLFHPRFRREFELDPAKARPGA-----QTRSDLLLCGRDWNTLIVGKLSPWIETDSELTTERRNSEAALVQELNFCAYLGLPAFMIPLKGPQCANLARVLLNHIHTGHHSSMFWIRVPLLAPEDTREDLIENEPSKQIDDGNN----EEKTWGWWHSFRTLC-DYNKRVCLAIEVGADMPSDNVIDKWLGEPIKAAILPTSIFLTNKKGFPVLSKAHQRIIFRLFKLEAQFIFTGMSRHSEKDFRSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAVYKCLLDRVPEEQKETNVQV-----------------------LMVLGAGRGPLVNASLRAAKQADRKLRVYAVEKNPNAVITLENWKFEEWGDQ-VTVVSCDMRDWVAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDNGVSIPCSYTSFLAPLSSSKLYNEV---RSCRERDKDPECHFETPYVVRLHNFHQLADPKPCFTFVHPTTDMN--NNRYQCLRFSVTCNSVLHGFAGYFETTLYKDVTLSIRPETHSPGMFSWFPILFPLKQPIPLTGGDDVSVRFWRCNNGKKVWYEWAVTEPVCSAIHNPAGRSYTIGL 631          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Cavefish
Match: carm1l (histone-arginine methyltransferase CARM1 [Source:NCBI gene;Acc:103023409])

HSP 1 Score: 52.373 bits (124), Expect = 1.615e-6
Identity = 64/272 (23.53%), Postives = 111/272 (40.81%), Query Frame = 3
Query: 1134 MVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLA-------PVQSVFTFE-----HPKPDINASNDRYREL-------VFKVKEDGVIHGFAGFFH-CILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSK 1889
            +VL  G G  + S F     A    ++Y VE +  A  +    + S+  +  + +  G + EV  P + D+ +SE +G    NE   E    ++H+LKP G+  P     ++AP    +L  YM       +  +T +      Y V L   H +A       P+   F  +       K  IN    +  +L       VFK+ + G+IHG A +F    +   +T+ +    H P +  W+ +   +  P+  K    LS  +  + N +
Sbjct:  169 VVLDVGCGTGILSFFAVQAGAK---RVYAVEASSVA-KHAEVLVRSNGMSDRITVLNGKIEEVSCPEKVDVIISEPIGYMLLNERMLESYLHSKHWLKPKGMMFPTFSDIHLAPFTDEQL--YMEHHARSSFWLQTSF------YGVNLSGLHPVAVEEFFRQPIVDTFDMQILMARSVKYTINFLEAKEEDLHRMEIPFVFKLLQSGLIHGLAFWFDVAFVGSRMTVWLSTAPHEP-LSHWYQVRCLLQTPLFAKMGQTLSGQVLLIANKR 427          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Sea Lamprey
Match: prmt5 (protein arginine methyltransferase 5 [Source:ZFIN;Acc:ZDB-GENE-030616-585])

HSP 1 Score: 259.61 bits (662), Expect = 1.987e-81
Identity = 126/234 (53.85%), Postives = 158/234 (67.52%), Query Frame = 3
Query: 1272 DWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            +W +  V + + DMRE L P +ADI VSELLGSFGDNELSPECLDGAQ FL  DGISIP+ YTSYI+P+ S+KL++ +   R  R   K   A  E PYVVRL N H LA  Q  FTF HP  +    N RY+ L F +  D V+HGFAG+F  +LYKDVT+SIHP+ HSP MFSWFPI+FPI  P+ +++   +    WR  N + VWYEWA T+P  + +HNP GRS ++ L
Sbjct:    8 EWGD-SVTVVSCDMREWLAPEKADIIVSELLGSFGDNELSPECLDGAQRFLSEDGISIPREYTSYISPISSSKLYNEV---RACREKDKDPEAHFEMPYVVRLHNYHELAKPQPCFTFVHPNTEPGMDNSRYKALEFPISTDTVLHGFAGYFETVLYKDVTLSIHPETHSPGMFSWFPILFPIKHPMPVRSGDTVCLRFWRCCNQQKVWYEWAITSPMTSVLHNPAGRSSTIGL 237          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004353.1 (pep scaffold:Pmarinus_7.0:GL484935:2792:12146:1 gene:ENSPMAG00000003968.1 transcript:ENSPMAT00000004353.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 2.283e-29
Identity = 77/234 (32.91%), Postives = 122/234 (52.14%), Query Frame = 3
Query:  246 VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMID--------ETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHL-AYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQ 920
            VVGK+S W+  D+E+E  RK SE AL++EL + ++   PAV+I L + +N+NLA +L   +   + +   WI +P++           +    +G+       +  + W  F  L  D      L L L      + +I  W  EPI A+   T  + TNKKGFPVL+  +Q ++ R  K+ +Q +++G + +    L AY QYL  +  ++ P + Y+  SK  EDYLQ PLQ
Sbjct:   10 VVGKLSPWLQPDSEVEYVRKNSEAALIQELNFTAYLSLPAVVIPLTQADNSNLAHILINHIQKGHHSQAFWIRVPLVSAADEVDEVVDDDDGSDGSGGAGGKAATFARWNSFRSLC-DYNKRISLALELSADLPSEEVIQKWLGEPIKAVVLHTSTFLTNKKGFPVLAQAHQLLVFRLFKLDVQFIISGMSCHSDKELRAYIQYLQHLSQHRPPPSNYDIFSKGYEDYLQCPLQ 242          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Yeast
Match: HSL7 (Protein arginine N-methyltransferase; exhibits septin and Hsl1p-dependent localization to the bud neck in budded cells and periodic Hsl1p-dependent phosphorylation; required with Hsl1p, and Elm1p for the mother-bud neck recruitment, phosphorylation, and degradation of Swe1p; interacts directly with Swe1p; relocalizes away from bud neck upon DNA replication stress; human homolog PRMT5 can complement yeast hsl7 mutant [Source:SGD;Acc:S000000337])

HSP 1 Score: 221.09 bits (562), Expect = 1.683e-61
Identity = 190/632 (30.06%), Postives = 299/632 (47.31%), Query Frame = 3
Query:  249 VGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNL---ARVLTTFMSNDYL----TFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSI--SNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKM---------KIQLVLTGDAKNLH----GHLAYRQYLSWIW--------TNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADS--ANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMR--EVLLPT----RADIFVSELLGSFGDNELSPECLDGAQHFLKP-DGISIPQSYTSYIAPLQSTKLFSYMS-TQRPPRYSKKTKYASLETPYVV-RLLNCHLLAPVQSVFTFEHP---KPDINASNDRYRELV------FKVKEDGVIHGFAGFFHCILYKDVTMSIHPD--------------------------MHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRV--GNSKAVWYEWA 1910
            +G +SSW++L++   + R    K LL E ++A F G    LI    ++ +NL    +++   + N  +       I I LP+ +               D+ P++ W  ++ +        +  + LALP++     ++N W +EP++ L   + I+ +N+  +PVL    Q++I +F K+         ++ ++L G  K  +    G  AY +Y++++         +N     + ++ S+ M      PL+P +D+L +STY  FE D  KY  YE A  +A+ DL                        +P  + K  + I+V GAGRGPLVD  FK       + +V +  +EKNP A  YL +R    W+NR V+L   DM   ++  P+    + D+ +SELLGSFG NELSPECL   + +    D I IP+SY+SYIAP+ S   +  +S T R           SLE P++V R+  C L + V  V+ FEHP   K  +   +D   E        FK+K  G IHGF GFF   LY ++ +S  P+                           H+P+M SW PI+FP+ +PI    DSELS  + R+     + VWYEW+
Sbjct:  102 IGLLSSWLELESRDPNVRDLGLKVLLNECKYARFVGINK-LILAPPRDLSNLQLYGQMIYRLLQNRIVFAAPALTISISLPLYE---------------DSDPLATWELWNTVRKQCEYHPSLTISLALPRTRTPSYVLNRWLAEPVSCLLVSSSIFASNQYDYPVLHKFNQNLILKFQKVNGDSQILGNELCVILHGMEKYANNVKGGESAYLEYINYLLKKGDKVLNSNSNHQFLLQEDSRIMP-----PLKPHSDNLLNSTYLTFEKDLVKYDLYESAILEALQDL------------------------APRASAKRPLVILVAGAGRGPLVDRTFKIISMLFMDSKVSIIAIEKNPQAYLYLQKRNFDCWDNR-VKLIKEDMTKWQINEPSEKRIQIDLCISELLGSFGCNELSPECLWSIEKYHSHNDTIFIPRSYSSYIAPISSPLFYQKLSQTNR-----------SLEAPWIVHRVPYCILSSRVNEVWRFEHPMAQKDTVQDEDDFTVEFSQSSLNEFKIKHRGEIHGFIGFFSANLYNNIFLSTLPNDSTVRLKFSEETLMNTRREENLIKKCDHTPNMTSWSPIIFPLKQPISFIDDSELSVLMSRIHSDTEQKVWYEWS 676          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Nematostella
Match: EDO41620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Y9])

HSP 1 Score: 413.69 bits (1062), Expect = 2.163e-135
Identity = 250/643 (38.88%), Postives = 340/643 (52.88%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANI-YTSHERNTDENDDSRTDKLSAPNF-LQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNL-HGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+ S+ ++      A   GF F+ A I +  ++R   E    R+   +  +  L + D S +  +VGKIS WI++ +  E  RK SEKAL++E+ +A   G P+V++ L   N  NLA  L T +                                       +++  IL           L +P        +  W  EPI A    TD++ TN+KGFPVL   +Q  + +  K+ +QL+L+G  K+   G   Y QYL  ++  + P+    + +K  EDYLQ PLQPL+D+L S TY IFE DP KYA Y+KA ++A+ D + +  +D  V +                       IMV+GAGRGPLV ++  AA++A   V++Y VEKNPNAV  L    T +W ++ V + + DMRE   P +ADI VSELLGSFGDNELSPECLDGAQ+FLK  GISIP  YTSY++PL S KL   +S     +   K   A  ETPYVVRL N   LA  Q  FTF HP       N R+  L F VK   ++HGF G+F   LY +  +SIHPD HSP MFSWFP  FPI  P+ ++    ++ H+WR    K VWYEW+ + P    IHNP GRSY + L
Sbjct:   10 GRDLTSIPDLVVALGSASQSGFDFICAPICHPRYKREFLEEIPDRSKSFTRADLVLSSQDWSSL--IVGKISPWINVGSLNEVVRKNSEKALMQEVNYAIHLGLPSVMLELGNYNIINLAHYLITLIK--------------------------------------YKKKEIL----------ALEIPAELPPDVELERWIGEPIKACILPTDVFLTNRKGFPVLPKSHQAFLKQLFKLNVQLILSGCCKHKGKGVQFYYQYLEHLYQTQAPLDPLGRFAKGYEDYLQCPLQPLSDNLESQTYEIFERDPVKYAEYQKAIYEALIDRVPEASKDAIVTV-----------------------IMVVGAGRGPLVRASLTAAENAGRRVRLYAVEKNPNAVVTLETLKTEEWGDK-VTVVSSDMREWDAPEKADILVSELLGSFGDNELSPECLDGAQNFLKDGGISIPCDYTSYLSPLCSPKLHQEVSQGS--KTDSKGPQAPFETPYVVRLHNIFELAKPQPCFTFYHPNRG-KIDNSRFISLEFSVKASAMLHGFGGYFDATLYGNTKISIHPDTHSPGMFSWFPFYFPIQDPLYVEGGKTIALHMWRKCTGKKVWYEWSVSRPAPVPIHNPGGRSYVIGL 575          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Nematostella
Match: EDO32564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUQ4])

HSP 1 Score: 83.5741 bits (205), Expect = 3.250e-17
Identity = 92/358 (25.70%), Postives = 139/358 (38.83%), Query Frame = 3
Query:  915 LQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVE-----LFAGDMREVLLPT-------RADIFVSELLGSFGDNELSPECLDGAQH-FLKP-DGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHP-DMHSPDMFSWFPIVFPIIKPIQI--KADSELSF----HIWRVGNSK------AVWYEW 1907
            L PL   +    Y + E D  KY  Y  A   A++ ++  R         NT+S  S+V              +VLG G G L+     A         ++++E NP+AV +L R+   D   + V      +F  D+    LP          DI  SELLG FGD+E  PE      + FL P  GI IPQS+++Y+ P+ S     ++   +           SL    ++R                         S+  Y            IHG  GFF  +L+ D+ +     ++H  + F W    FP +KPI +  K   +L F     + RV + +       +WYEW
Sbjct:   32 LSPLEPFIKLEEYFMLERDRGKYLLYMAAIDSAVHQILASRP--------NTRS--SVV------------KCLVLGPGLGRLIAFCLDACKQQGANAVVHVLEANPSAVEFL-RKQFGDLLGKTVYIYDPFIFHPDLSVKDLPEPFHALYRSFDIITSELLGCFGDDEFLPELTASLYNLFLHPTKGIPIPQSWSTYVVPITSALTVDHLKNHK----------KSLSAGTLMR-----------------------KQSSKIY------------IHGMLGFFTAVLFPDIIIDTRSTNIHQRNCFHWESFFFPFLKPISLDSKGTKKLLFSLKRKLERVRDREDKLIKLKLWYEW 321          
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Medaka
Match: prmt5 (protein arginine methyltransferase 5 [Source:NCBI gene;Acc:100144380])

HSP 1 Score: 483.026 bits (1242), Expect = 7.798e-161
Identity = 274/657 (41.70%), Postives = 379/657 (57.69%), Query Frame = 3
Query:   54 GVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIING------VVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPM----------IDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHL-AYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSL 1973
            G D+  V  I         LGF F+   ++  H R   E +       S P   QT    ++ G      +VGK+S WI  D+E+E+ R+ SE+AL +EL ++++ G P  +I L   +N NLAR+L + +   + T   WI +P+          I+   +SC +  ++   D    +WW  F  L  D      L + +        +I+ W  EPI A    T ++ TNKKGFPVLS  +Q +I R  K++ Q + TG +++      +Y QYL ++  N+     YE  +K  EDYLQ PLQPL D+L S TY +FE DP KY+ Y++A ++ + D + + ++D  V +                       +MVLGAGRGPLV+++ +AA  A+ ++K+Y VEKNPNAV  L      +W +R V + + DMRE   P +ADI VSELLGSFGDNELSPECLDGAQHFLK DG+SIP SYTS++APL S+KL++ +   R  R   K+     ETPYVVRL N H LA  +  FTF HPK D+N  N+RY+ L F V  + V+HGFAG+F   LYKDVT+SI P+ HSP MFSWFPI+FP+ +PI I  D E++   WR  N K VWYEWA T P  ++IHNP GRSY++ L
Sbjct:   33 GRDMNCVPEIAATLAAVAKLGFDFLCMPLF--HPRFAREFELEPAK--SRPG-AQTRSDLLLCGRDWGTLIVGKLSPWICADSEIETERRNSEEALTQELNFSAYLGLPVFMIPLTGPHNANLARLLLSHIHTGHHTSNFWIRVPLMAAEDTREDLIENEPFSCPDETSV---DEKTWNWWNTFRTLC-DYNKRICLAIDIGADMPSDAVIDKWMGEPIKAAILPTSLFLTNKKGFPVLSKAHQRVIFRLFKLEAQFIFTGTSRHTEKDFRSYLQYLEYLNQNRPAPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAVYKCLLDRVPEEQKDTNVQV-----------------------LMVLGAGRGPLVNASLRAASQADRKLKVYAVEKNPNAVITLENWRFEEWGDR-VTVVSSDMREWEAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPCSYTSFLAPLSSSKLYNEV---RGCRERDKSPECHFETPYVVRLHNFHELADPKPCFTFTHPKKDMN--NNRYQCLRFSVGCNSVLHGFAGYFETTLYKDVTLSIKPETHSPGMFSWFPILFPLKQPISIARDDEIAVRFWRCNNGKKVWYEWAVTEPTCSAIHNPAGRSYTIGL 651          
BLAST of protein arginine methyltransferase 5-like protein vs. Planmine SMEST
Match: SMESG000023057.1 (SMESG000023057.1)

HSP 1 Score: 1337.01 bits (3459), Expect = 0.000e+0
Identity = 649/650 (99.85%), Postives = 650/650 (100.00%), Query Frame = 3
Query:   33 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 1982
            MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYK+VTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK
Sbjct:    1 MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKNVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 650          
BLAST of protein arginine methyltransferase 5-like protein vs. Planmine SMEST
Match: SMESG000023057.1 (SMESG000023057.1)

HSP 1 Score: 1332.39 bits (3447), Expect = 0.000e+0
Identity = 647/648 (99.85%), Postives = 648/648 (100.00%), Query Frame = 3
Query:   39 MKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKAXXXXXXWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 1982
            MKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYK+VTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK
Sbjct:    1 MKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDSRTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEELEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDETEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQNIINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVLTGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLADHLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFASIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKNPNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDNELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYSKKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVFKVKEDGVIHGFAGFFHCILYKNVTMSIHPDMHSPDMFSWFPIVFPIIKPIQIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK 648          
The following BLAST results are available for this feature:
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRMT53.516e-15940.70protein arginine methyltransferase 5 [Source:HGNC ... [more]
PRMT56.083e-15841.35protein arginine methyltransferase 5 [Source:HGNC ... [more]
PRMT52.107e-14643.14protein arginine methyltransferase 5 [Source:HGNC ... [more]
PRMT53.100e-14643.14protein arginine methyltransferase 5 [Source:HGNC ... [more]
PRMT53.966e-12246.68protein arginine methyltransferase 5 [Source:HGNC ... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prmt-53.540e-7432.09Protein arginine N-methyltransferase 5 [Source:Un... [more]
prmt-53.540e-7432.09Protein arginine N-methyltransferase 5 [Source:Un... [more]
prmt-53.540e-7432.09Protein arginine N-methyltransferase 5 [Source:Un... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
csul6.167e-9832.06gene:FBgn0015925 transcript:FBtr0089871[more]
csul4.434e-9632.11gene:FBgn0015925 transcript:FBtr0089872[more]
Art45.817e-628.06gene:FBgn0037770 transcript:FBtr0082150[more]
Art45.817e-628.06gene:FBgn0037770 transcript:FBtr0333687[more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prmt54.183e-15740.98protein arginine methyltransferase 5 [Source:ZFIN;... [more]
prmt55.371e-14139.30protein arginine methyltransferase 5 [Source:ZFIN;... [more]
carm1l2.089e-824.37coactivator-associated arginine methyltransferase ... [more]
CR352251.12.125e-824.37coactivator-associated arginine methyltransferase ... [more]
BX936392.22.125e-824.37coactivator-associated arginine methyltransferase ... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRMT51.007e-15340.03protein arginine methyltransferase 5 [Source:NCBI ... [more]
PRMT54.961e-15341.82protein arginine methyltransferase 5 [Source:NCBI ... [more]
PRMT55.493e-15341.82protein arginine methyltransferase 5 [Source:NCBI ... [more]
PRMT57.430e-15342.44protein arginine methyltransferase 5 [Source:NCBI ... [more]
PRMT52.128e-13941.03protein arginine methyltransferase 5 [Source:NCBI ... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Prmt51.374e-15640.40protein arginine N-methyltransferase 5 [Source:MGI... [more]
Prmt53.507e-4137.39protein arginine N-methyltransferase 5 [Source:MGI... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R698|ANM5_PONAB4.400e-15940.85Protein arginine N-methyltransferase 5 OS=Pongo ab... [more]
sp|O14744|ANM5_HUMAN1.688e-15840.70Protein arginine N-methyltransferase 5 OS=Homo sap... [more]
sp|Q4R5M3|ANM5_MACFA4.167e-15840.55Protein arginine N-methyltransferase 5 OS=Macaca f... [more]
sp|A7YW45|ANM5_BOVIN5.565e-15740.40Protein arginine N-methyltransferase 5 OS=Bos taur... [more]
sp|Q8CIG8|ANM5_MOUSE1.400e-15540.40Protein arginine N-methyltransferase 5 OS=Mus musc... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2ESD80.000e+099.85Protein arginine N-methyltransferase OS=Schmidtea ... [more]
C1LE950.000e+044.93Protein arginine N-methyltransferase OS=Schistosom... [more]
A0A4E0RYV30.000e+041.91Protein arginine N-methyltransferase OS=Fasciola h... [more]
A0A504YWY10.000e+041.91Protein arginine N-methyltransferase OS=Fasciola g... [more]
A0A3Q0KT700.000e+042.90Protein arginine N-methyltransferase OS=Schistosom... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prmt52.164e-15840.88protein arginine methyltransferase 5 [Source:NCBI ... [more]
carm1l1.615e-623.53histone-arginine methyltransferase CARM1 [Source:N... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prmt51.987e-8153.85protein arginine methyltransferase 5 [Source:ZFIN;... [more]
ENSPMAT00000004353.12.283e-2932.91pep scaffold:Pmarinus_7.0:GL484935:2792:12146:1 ge... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HSL71.683e-6130.06Protein arginine N-methyltransferase; exhibits sep... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416202.163e-13538.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325643.250e-1725.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prmt57.798e-16141.70protein arginine methyltransferase 5 [Source:NCBI ... [more]
back to top
BLAST of protein arginine methyltransferase 5-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023057.10.000e+099.85SMESG000023057.1[more]
SMESG000023057.10.000e+099.85SMESG000023057.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014738
GenBankAEX33822.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014738 ID=SMED30014738|Name=protein arginine methyltransferase 5-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2446bp
GTTTTAAATAATACTTAAATTTAAAAAGCACGATGAACATGAAATCATTA
TTGGGAGTCGATATTCAATCCGTTAAGAACATAGAAGAAGATCATAGATG
GGCAATTTCTTTGGGCTTTAGTTTTGTCTTTGCTAACATATATACTAGTC
ATGAAAGAAATACAGATGAAAATGATGATTCTCGAACAGATAAGTTATCA
GCACCCAACTTTTTGCAAACAAATGATTCTTCAATTATTAACGGAGTTGT
TGGTAAAATTTCCTCTTGGATTGATCTAGATAATGAATTGGAAAGTTTTC
GAAAGAAATCGGAAAAGGCTTTACTCGAAGAGCTTGAATGGGCCTCATTT
CAAGGTTTTCCAGCTGTTCTTATTCGCCTGAAAAAGAAAAACAATACAAA
TTTAGCAAGGGTTTTAACTACTTTCATGTCAAACGACTATCTCACATTCA
GAATATGGATTGGTCTCCCAATGATTGATGAAACTGAATATTCGTGTGTA
AATGGGAATAATATTCCTCAAAAAGACAACTCACCGATATCGTGGTGGCG
ACAATTTTCTATATTATTAGGGGATTCTATTTCCAATTTTATGTTGATGT
TAGCTTTGCCCAAGTCTCCAGTCGATCAGAATATAATCAATCATTGGTAT
TCTGAGCCTATTGCCGCTTTAGAAACGAGAACAGATATTTATTTTACAAA
CAAAAAAGGATTTCCTGTTTTATCAGTAGAATACCAAGATATTATTAATC
GATTTCTCAAAATGAAGATTCAATTGGTTTTAACAGGAGATGCGAAAAAT
CTCCACGGCCATCTTGCATATCGACAGTATTTAAGTTGGATTTGGACGAA
CAAGTGTCCAATGACAGTTTATGAGAAACACAGCAAAGATATGGAGGATT
ATCTCCAGGATCCCTTGCAACCACTGGCTGATCATTTACCGAGTTCAACT
TATAGTATTTTTGAATTAGATCCATACAAATACGCAGCATATGAAAAAGC
CACATTTCAAGCGATTAACGATCTCATAGAGAAACGGAAACAAGACGGAG
AAGTGAATATTAATAATACGAAATCATTTGCCAGTATTGTCGGTGGTTCT
CCCAATTTAACATTGAAAGAAAAGATAACGATAATGGTACTCGGAGCCGG
AAGAGGCCCATTGGTTGATTCGGCATTCAAAGCGGCTGACAGTGCAAATT
GTGAAGTGAAAATGTATATTGTGGAAAAGAATCCCAACGCTGTATCGTAT
TTAACGAGAAGAATCACGAGTGATTGGAACAACAGAGATGTGGAATTATT
CGCCGGTGATATGCGAGAAGTGTTGCTGCCTACAAGAGCGGATATTTTCG
TCAGTGAACTTTTAGGGTCTTTTGGAGACAACGAGCTGAGTCCTGAATGT
CTTGACGGAGCGCAACATTTCCTTAAACCCGACGGAATCTCGATTCCACA
GAGTTACACATCATATATTGCACCTTTGCAATCGACTAAACTATTCTCCT
ATATGAGCACGCAACGCCCACCCAGATATTCCAAAAAAACGAAATATGCT
TCACTTGAAACTCCTTACGTCGTTCGTCTGTTAAACTGTCACTTGTTGGC
TCCTGTCCAGTCGGTATTCACATTTGAACACCCTAAACCCGATATCAATG
CGTCTAATGATCGATATCGGGAATTGGTGTTCAAAGTCAAAGAGGATGGG
GTAATCCACGGCTTTGCCGGGTTCTTTCATTGCATTCTCTACAAGGACGT
TACAATGAGCATTCATCCCGATATGCATTCACCAGATATGTTCTCATGGT
TTCCGATTGTGTTCCCCATCATTAAACCCATCCAAATAAAAGCGGATTCT
GAACTCAGTTTCCACATCTGGAGAGTTGGAAACAGCAAAGCCGTCTGGTA
TGAGTGGGCTTGTACGAATCCTGAGGTTACGTCGATTCATAACCCGAATG
GCCGCTCTTATTCCATGTCCTTACTGTCTAAATAAATTACTGCCAATTTG
CATTTCAATAATAAACTTTATTCGTTATTTTTTGTGCTGAGATTTCCATT
ATTTATTCATCTGTAATTGGTCAATTTTTTATTGAACTTTTACATTGGTT
TTATAAATATATATATATATTTCATTGGCTGATAATTTTATTGAATTTGT
TGTATTCAATGTTACAATTTCGGGATTTTTTGAACCTATAATCGATTTGA
TAAATTGCATTTCAATATAAAATATTTCGCATTCTATTGATAACTTTGTA
ATCAATGTTGGATATTCAATAATCAATATCAAGGGACTTTTAATATGATA
TTCAATTGTACCCCGGGATTGTTGAAATGTTTTTTAAAAGTTATAAATTT
TCAATTTATTTTATTTTTTTAAACGAATTTTAGAAATACTGGATTTATGA
AAAAAAGATTGTATTTAAATATAAAATGTACTTGGTCAAAAAAAAA
back to top

protein sequence of SMED30014738-orf-1

>SMED30014738-orf-1 ID=SMED30014738-orf-1|Name=SMED30014738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=651bp
MNMKSLLGVDIQSVKNIEEDHRWAISLGFSFVFANIYTSHERNTDENDDS
RTDKLSAPNFLQTNDSSIINGVVGKISSWIDLDNELESFRKKSEKALLEE
LEWASFQGFPAVLIRLKKKNNTNLARVLTTFMSNDYLTFRIWIGLPMIDE
TEYSCVNGNNIPQKDNSPISWWRQFSILLGDSISNFMLMLALPKSPVDQN
IINHWYSEPIAALETRTDIYFTNKKGFPVLSVEYQDIINRFLKMKIQLVL
TGDAKNLHGHLAYRQYLSWIWTNKCPMTVYEKHSKDMEDYLQDPLQPLAD
HLPSSTYSIFELDPYKYAAYEKATFQAINDLIEKRKQDGEVNINNTKSFA
SIVGGSPNLTLKEKITIMVLGAGRGPLVDSAFKAADSANCEVKMYIVEKN
PNAVSYLTRRITSDWNNRDVELFAGDMREVLLPTRADIFVSELLGSFGDN
ELSPECLDGAQHFLKPDGISIPQSYTSYIAPLQSTKLFSYMSTQRPPRYS
KKTKYASLETPYVVRLLNCHLLAPVQSVFTFEHPKPDINASNDRYRELVF
KVKEDGVIHGFAGFFHCILYKDVTMSIHPDMHSPDMFSWFPIVFPIIKPI
QIKADSELSFHIWRVGNSKAVWYEWACTNPEVTSIHNPNGRSYSMSLLSK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016274protein-arginine N-methyltransferase activity
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0018216peptidyl-arginine methylation
GO:0006479protein methylation
GO:0035246peptidyl-arginine N-methylation
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035075PRMT5
IPR035247PRMT5_TIM
IPR035248PRMT5_C
IPR025799Arg_MeTrfase
IPR007857Arg_MeTrfase_PRMT5
IPR029063SAM-dependent_MTases
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007857Protein arginine N-methyltransferase PRMT5PIRSFPIRSF015894PRMT5coord: 9..648
e-value: 1.4E-167
score: 556.7
IPR007857Protein arginine N-methyltransferase PRMT5PANTHERPTHR10738PROTEIN ARGININE N-METHYLTRANSFERASE 5coord: 8..647
IPR035075PRMT5 arginine-N-methyltransferasePFAMPF05185PRMT5coord: 281..471
e-value: 7.1E-60
score: 201.8
NoneNo IPR availableGENE3DG3DSA:2.70.160.11coord: 474..650
e-value: 1.4E-63
score: 216.4
NoneNo IPR availableGENE3DG3DSA:3.20.20.150coord: 5..281
e-value: 1.6E-58
score: 199.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 283..473
e-value: 2.3E-63
score: 214.8
IPR035247PRMT5, TIM barrel domainPFAMPF17285PRMT5_TIMcoord: 28..269
e-value: 1.5E-42
score: 145.6
IPR035248PRMT5, oligomerisation domainPFAMPF17286PRMT5_Ccoord: 474..645
e-value: 4.1E-51
score: 173.4
IPR025799Protein arginine N-methyltransferasePROSITEPS51678SAM_MT_PRMTcoord: 291..624
score: 59.881
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 359..646