Calcitonin receptor

Overview
NameCalcitonin receptor
Smed IDSMED30014736
Length (bp)1355
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcitonin receptor (SMED30014736) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcitonin receptor (SMED30014736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcitonin receptor (SMED30014736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcitonin receptor (SMED30014736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014736SMESG000035956.1 SmedASXL_005854SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014736SMESG000035956.1 dd_Smed_v4_22246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014736SMESG000035956.1 dd_Smed_v6_22246_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcitonin receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 83.1889 bits (204), Expect = 1.617e-16
Identity = 102/387 (26.36%), Postives = 184/387 (47.55%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D  L WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L     +D    L +E+    ++          G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S N  WI+ +  +  I +N +  IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDHILCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWELVPGH-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVW-VSVRATLANTGCWD-LSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 81.6481 bits (200), Expect = 6.453e-16
Identity = 102/387 (26.36%), Postives = 184/387 (47.55%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D  L WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L     +D    L +E+    ++          G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S N  WI+ +  +  I +N +  IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDHILCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWELVPGH-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVW-VSVRATLANTGCWD-LSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 81.6481 bits (200), Expect = 6.453e-16
Identity = 102/387 (26.36%), Postives = 184/387 (47.55%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D  L WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L     +D    L +E+    ++          G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S N  WI+ +  +  I +N +  IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDHILCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWELVPGH-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVW-VSVRATLANTGCWD-LSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 81.6481 bits (200), Expect = 6.453e-16
Identity = 102/387 (26.36%), Postives = 184/387 (47.55%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D  L WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L     +D    L +E+    ++          G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S N  WI+ +  +  I +N +  IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDHILCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWELVPGH-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVW-VSVRATLANTGCWD-LSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 81.6481 bits (200), Expect = 6.453e-16
Identity = 102/387 (26.36%), Postives = 184/387 (47.55%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D  L WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L     +D    L +E+    ++          G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S N  WI+ +  +  I +N +  IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDHILCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWELVPGH-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVW-VSVRATLANTGCWD-LSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 113.235 bits (282), Expect = 8.539e-27
Identity = 117/403 (29.03%), Postives = 192/403 (47.64%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNV-FGEPSENINGSYTNFDECFKSKT----YNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINL-----DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            C A YD+ L WP T  N +V   C     L       + CH SG W+    GE    + G +TNF  C+  +      NL  E +    ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I       ++  F           +  YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPG-WTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM--YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 472          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 113.235 bits (282), Expect = 8.539e-27
Identity = 117/403 (29.03%), Postives = 192/403 (47.64%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNV-FGEPSENINGSYTNFDECFKSKT----YNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINL-----DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            C A YD+ L WP T  N +V   C     L       + CH SG W+    GE    + G +TNF  C+  +      NL  E +    ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I       ++  F           +  YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPG-WTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM--YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 472          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 113.235 bits (282), Expect = 9.286e-27
Identity = 119/412 (28.88%), Postives = 192/412 (46.60%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNV-FGEPSENINGSYTNFDECFKSKT----YNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLD--------------MQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            C A YD+ L WP T  N +V   C     L       + CH SG W+    GE    + G +TNF  C+  +      NL  E +    ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I                   SF Y+           YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPG-WTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM-----------YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 472          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 113.235 bits (282), Expect = 9.286e-27
Identity = 119/412 (28.88%), Postives = 192/412 (46.60%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNV-FGEPSENINGSYTNFDECFKSKT----YNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLD--------------MQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            C A YD+ L WP T  N +V   C     L       + CH SG W+    GE    + G +TNF  C+  +      NL  E +    ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I                   SF Y+           YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPG-WTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM-----------YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 472          
BLAST of Calcitonin receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 110.153 bits (274), Expect = 7.281e-26
Identity = 117/401 (29.18%), Postives = 191/401 (47.63%), Query Frame = 2
Query:   17 QINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINL-----DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            +I C A YD+ L WP T  N +V   C     L       + C  +G+W        EN  G +TNF  CFK     +  E  K   ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I       ++  F           +  YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   71 RIWCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKYIVKRCDETGRWAGKKPGHYENPWG-WTNFTVCFK-----IDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM--YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 462          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0070436)

HSP 1 Score: 135.576 bits (340), Expect = 5.448e-34
Identity = 115/374 (30.75%), Postives = 200/374 (53.48%), Query Frame = 2
Query:   38 YDSYLLWPETAPNETVYQNCTISSNLFEFGK-AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLN-----------DLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLL----KEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENL---YWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            +D+ L WP T        NC    +  +  K A R C   G+W +       N  G +T++  C+K       PE I+ +            D+ +    + I GL L  F L +S+LI   F+ L N RTKIHK LF+A++ +  ++++L++D      KE + ++S     N P +   S +   + EY  T++F+WM +EG+++HN++ V VF   +    +  +GW +PI +T  WA   +V +  T   + +++ NL   YWI+   R+  I +N  FL+N+IRVLV+KLR + +SD+ Q + A++AAI+L+PLLG+ N +  +     +  + V       L S+QG F+++++C +N ++R  +++S
Sbjct:  151 WDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPG-WTDYGPCYK-------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYV---LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWA-RCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKS 512          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340084)

HSP 1 Score: 135.191 bits (339), Expect = 9.497e-34
Identity = 115/374 (30.75%), Postives = 200/374 (53.48%), Query Frame = 2
Query:   38 YDSYLLWPETAPNETVYQNCTISSNLFEFGK-AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLN-----------DLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLL----KEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENL---YWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            +D+ L WP T        NC    +  +  K A R C   G+W +       N  G +T++  C+K       PE I+ +            D+ +    + I GL L  F L +S+LI   F+ L N RTKIHK LF+A++ +  ++++L++D      KE + ++S     N P +   S +   + EY  T++F+WM +EG+++HN++ V VF   +    +  +GW +PI +T  WA   +V +  T   + +++ NL   YWI+   R+  I +N  FL+N+IRVLV+KLR + +SD+ Q + A++AAI+L+PLLG+ N +  +     +  + V       L S+QG F+++++C +N ++R  +++S
Sbjct:  151 WDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPG-WTDYGPCYK-------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYV---LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARC-TVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKS 512          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340085)

HSP 1 Score: 135.191 bits (339), Expect = 9.497e-34
Identity = 115/374 (30.75%), Postives = 200/374 (53.48%), Query Frame = 2
Query:   38 YDSYLLWPETAPNETVYQNCTISSNLFEFGK-AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLN-----------DLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLL----KEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENL---YWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            +D+ L WP T        NC    +  +  K A R C   G+W +       N  G +T++  C+K       PE I+ +            D+ +    + I GL L  F L +S+LI   F+ L N RTKIHK LF+A++ +  ++++L++D      KE + ++S     N P +   S +   + EY  T++F+WM +EG+++HN++ V VF   +    +  +GW +PI +T  WA   +V +  T   + +++ NL   YWI+   R+  I +N  FL+N+IRVLV+KLR + +SD+ Q + A++AAI+L+PLLG+ N +  +     +  + V       L S+QG F+++++C +N ++R  +++S
Sbjct:  151 WDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPG-WTDYGPCYK-------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYV---LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARC-TVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKS 512          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0308565)

HSP 1 Score: 134.806 bits (338), Expect = 1.331e-33
Identity = 115/374 (30.75%), Postives = 200/374 (53.48%), Query Frame = 2
Query:   38 YDSYLLWPETAPNETVYQNCTISSNLFEFGK-AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLN-----------DLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLL----KEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENL---YWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            +D+ L WP T        NC    +  +  K A R C   G+W +       N  G +T++  C+K       PE I+ +            D+ +    + I GL L  F L +S+LI   F+ L N RTKIHK LF+A++ +  ++++L++D      KE + ++S     N P +   S +   + EY  T++F+WM +EG+++HN++ V VF   +    +  +GW +PI +T  WA   +V +  T   + +++ NL   YWI+   R+  I +N  FL+N+IRVLV+KLR + +SD+ Q + A++AAI+L+PLLG+ N +  +     +  + V       L S+QG F+++++C +N ++R  +++S
Sbjct:  220 WDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPG-WTDYGPCYK-------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYV---LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWA-RCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKS 581          
BLAST of Calcitonin receptor vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 76.2554 bits (186), Expect = 1.329e-14
Identity = 97/426 (22.77%), Postives = 181/426 (42.49%), Query Frame = 2
Query:   20 INCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGK---AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAI---GGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETAL-QMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAV-------LMSVRFSSTQ-KWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNMFE 1252
            + CP+ +DS L WP T         C        +     A R C  +G W +            Y+++D C ++         I  + D +  +   AI   GG  L   TL ++++I   FK L   R  IH  LF+  +    L  ++L + ++              +    G   L   +++YF  + F WM VEG++++ ++          F  Y  +GW  P    L W++       L +  F+  +    ++   ++ WI  +     + +N+VFLI ++ VL+ KLR+ ++ +  Q   A KA ++LIPL G I ++ ++    Q     +   ++  L S QG FV++ +C +N ++R+ +   + ++R   N++    +K  R  +         T +  L S +   T  +E
Sbjct:   82 LQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDH------------YSDYDRCHQNSG------SIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVIT------------TESSQAGCITL-VIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFG-ITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRRHRASKDYSLRSRTESLRLTSTSPIPTGHYE 475          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 93.5893 bits (231), Expect = 5.571e-20
Identity = 110/435 (25.29%), Postives = 202/435 (46.44%), Query Frame = 2
Query:   11 TIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKS-KTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFE--------------TALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNM 1246
            T + +C   +D  L WPE  P + V  +C     +++F   G A+R C  +G W     E + + N ++ N+ EC K    YN   ER     ++   L  I   G  +   +L ++ +IL  F+ L   R  IH  LF++ +                +ALQ    I +  ED    ++    N  +  G   +   ++ YF+ + + W+LVEG+++H++I +  F  R +   +  +GW +P      WA + +   + T+ W  + + NL WI+ I  +  I +N +  +N+IRVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+ M   ++    + + +  + L  S QG FV+I++C  N +++  + +++N+             +    D K K +S  NT +   + +  + TN+
Sbjct:   58 TSEGSCLPEWDGILCWPEGVPGKMVSTSC--PEYIYDFNHKGHAYRRCDLNGTW-----ELASHNNKTWANYSECAKFFPHYNQNQER-----EVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITV--EDLKSITEAPPANKTQFIG-CKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRAT-LADTECWD-LSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAWNR-------------RTLALDFKRKARSGSNTYSYGPMVSHTSVTNV 462          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 92.8189 bits (229), Expect = 7.639e-20
Identity = 110/435 (25.29%), Postives = 202/435 (46.44%), Query Frame = 2
Query:   11 TIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKS-KTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFE--------------TALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNM 1246
            T + +C   +D  L WPE  P + V  +C     +++F   G A+R C  +G W     E + + N ++ N+ EC K    YN   ER     ++   L  I   G  +   +L ++ +IL  F+ L   R  IH  LF++ +                +ALQ    I +  ED    ++    N  +  G   +   ++ YF+ + + W+LVEG+++H++I +  F  R +   +  +GW +P      WA + +   + T+ W  + + NL WI+ I  +  I +N +  +N+IRVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+ M   ++    + + +  + L  S QG FV+I++C  N +++  + +++N+             +    D K K +S  NT +   + +  + TN+
Sbjct:   33 TSEGSCLPEWDGILCWPEGVPGKMVSTSC--PEYIYDFNHKGHAYRRCDLNGTW-----ELASHNNKTWANYSECAKFFPHYNQNQER-----EVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITV--EDLKSITEAPPANKTQFIG-CKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRAT-LADTECWD-LSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAWNR-------------RTLALDFKRKARSGSNTYSYGPMVSHTSVTNV 437          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 84.7297 bits (208), Expect = 3.614e-17
Identity = 97/430 (22.56%), Postives = 196/430 (45.58%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFET-----------ALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVC---QXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDS--KNKLKSNQNTMTSTLLSNTETKTNMFE 1252
            C   +D  + WP+ +P       C   S +++F   G A+R C  +G W +V        N ++ N+ +C +     L P   K   D  + L  +   G  +   +L ++I I+  F+ L   R  IH  LF++ +              A  +    D +  D+  +  ++  +  +  G   +    + YF+ + + W+LVEG+++H++I +  F    +   +  +GW +P     TWAV+ +   +  + W+ + + N+ WI  +  +  I +N +  +N++RVL  K+R  N+       Q +   K+ ++L+ + GV  I FV M +      G+ + +  +    S+QG FVSI++C  N +++  + +++ ++ +  +      L   R+ S   N   SNQ+ +TS   S+    + ++ 
Sbjct:   31 CSPGWDGLVCWPQGSPGTVTKVPC--PSYVYDFNHNGFAYRQCSSNGSWVSV-------ENRTWVNYSDCLRF----LAPGIEKGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGVLQEYDTMLMDNISTVSISPLDKTQYFG-CKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKYLWGFTLIGWGVPALFVSTWAVVRAT-LADARCWE-LSAGNIKWIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPH-TFTGLGWELRMYCELFFNSFQGFFVSIIYCFCNGEVQAEIRKTWLRWTLAFDWKGPVVLANYRYGSVLNNSGASNQSQLTSVTRSSALLTSRIYR 443          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 83.1889 bits (204), Expect = 1.189e-16
Identity = 97/422 (22.99%), Postives = 193/422 (45.73%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFET-----------ALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVC---QXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDS--KNKLKSNQNTMTSTLLSNT 1228
            C   +D  + WP+ +P       C   S +++F   G A+R C  +G W +V        N ++ N+ +C +     L P   K   D  + L  +   G  +   +L ++I I+  F+ L   R  IH  LF++ +              A  +    D +  D+  +  ++  +  +  G   +    + YF+ + + W+LVEG+++H++I +  F    +   +  +GW +P     TWAV+ +   +  + W+ + + N+ WI  +  +  I +N +  +N++RVL  K+R  N+       Q +   K+ ++L+ + GV  I FV M +      G+ + +  +    S+QG FVSI++C  N +++  + +++ ++ +  +      L   R+ S   N   SNQ+ +TS   S+ 
Sbjct:   59 CSPGWDGLVCWPQGSPGTVTKVPC--PSYVYDFNHNGFAYRQCSSNGSWVSVE-------NRTWVNYSDCLRF----LAPGIEKGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDRVVYANGVLQEYDTMLMDNISTVSISPLDKTQYFG-CKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSDSKYLWGFTLIGWGVPALFVSTWAVVRAT-LADARCWE-LSAGNIKWIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPH-TFTGLGWELRMYCELFFNSFQGFFVSIIYCFCNGEVQAEIRKTWLRWTLAFDWKGPVVLANYRYGSVLNNSGASNQSQLTSVTRSSA 463          
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Match: calcr (calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-060503-420])

HSP 1 Score: 77.411 bits (189), Expect = 1.047e-14
Identity = 103/412 (25.00%), Postives = 179/412 (43.45%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCT-ISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNMFEHS 1258
            C   +D +L W +T       Q C    ++     K  ++C  +G W   F  P    N +++N+  C       L    I         L Y+AI G  L   +L +S+ I   F+ L   R  +HK LF + +  +A  +   ++L+       + VNN    + N    +    + Y +   + WML EG+++H +I V VF      + Y  +GW  P+      AV     F     W  + +  LY +   + +  + +N+ FL+N++RVLV KLR  + ++      A++A ++L+PLLG I FV +           +   +  +L  YQGL V+ +FC  N +++ A+ R + +Y+             A+W  + +   +  + + T  S TE    MF H 
Sbjct:  162 CNRTWDGWLCWDDTPAGTFTSQYCPNYFADFDSTEKVTKYCDETGNW---FRHPE--TNRTWSNYTLCIAHTKDKLKMAYI---------LYYMAIVGHALSIVSLLISLAIFFYFRSLSCQRITLHKNLFCSYVLNSAFTI---VNLI-------TVVNNPKVVQRNPVCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPASIHAVARKKYFDD-NCWMSVETHLLYVVHGPI-MAALLVNLFFLLNIVRVLVTKLRDTHRAESNMYMKAVRATLILVPLLG-IQFVIIPWRPENRLAGEIYDYIMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYK-------------AQWGQRRREHCSMRSTSYTATSITEVPAFMFHHD 533          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 89.3521 bits (220), Expect = 1.485e-18
Identity = 108/437 (24.71%), Postives = 197/437 (45.08%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF-GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKS----KTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND-------PKMNGFSNLRSAI----YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNT------MTSTLLSNTETKTNMFEH 1255
            C   +D  + WPE  P  TV  +C      F   G A+R C  +G W  V G      N ++ N+ EC  +    K++NLP   ++  + L   L Y     + LGS  LT+++LIL  F+ L   R  IH  LFI+ +            L    + + +++ +  D       P  +    +   +    + YF+ + + W+LVEG+++H++I +     + +   +   GW +P    L WA   +   + T  W  + +  L WI+ +  +  I +N    IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +               D K K +S   T      ++ T ++N  T+  +  H
Sbjct:   56 CLPEWDGVVCWPEGLPGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGN-----NRTWANYTECCPTFSIGKSFNLPSNSLEVFDRLY--LIYTVGYSISLGS--LTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFMAFISDKKYLWGFTLFGWGVPAIFVLIWARERAT-VADTGCWD-LSAGYLKWIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTEVSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL-------------ALDFKRKARSGSTTYSYGPMVSHTSITNVTTRGTLALH 468          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 82.4185 bits (202), Expect = 2.641e-16
Identity = 105/433 (24.25%), Postives = 192/433 (44.34%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF-GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND-------PKMNGFSNLRSAI----YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNT------MTSTLLSNTETKTNMFEH 1255
            C   +D  + WPE  P  TV  +C      F   G A+R C  +G W  V G      N ++ N+ EC K   +N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LFI+ +            L    + + +++ +  D       P  +    +   +    + YF+ + + W+LVEG+++H++I +     + +   +   GW +P    L WA   +   + T  W  + +  L WI+ +  +  I +N    IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +               D K K +S   T      ++ T ++N  T+  +  H
Sbjct:   47 CLPEWDGVVCWPEGLPGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGN-----NRTWANYTECAK-YLFNETKER-----EVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFMAFISDKKYLWGFTLFGWGVPAIFVLIWARERAT-VADTGCWD-LSAGYLKWIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTEVSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL-------------ALDFKRKARSGSTTYSYGPMVSHTSITNVTTRGTLALH 453          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 82.4185 bits (202), Expect = 2.892e-16
Identity = 105/433 (24.25%), Postives = 192/433 (44.34%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF-GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND-------PKMNGFSNLRSAI----YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNT------MTSTLLSNTETKTNMFEH 1255
            C   +D  + WPE  P  TV  +C      F   G A+R C  +G W  V G      N ++ N+ EC K   +N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LFI+ +            L    + + +++ +  D       P  +    +   +    + YF+ + + W+LVEG+++H++I +     + +   +   GW +P    L WA   +   + T  W  + +  L WI+ +  +  I +N    IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +               D K K +S   T      ++ T ++N  T+  +  H
Sbjct:   37 CLPEWDGVVCWPEGLPGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGN-----NRTWANYTECAK-YLFNETKER-----EVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFMAFISDKKYLWGFTLFGWGVPAIFVLIWARERAT-VADTGCWD-LSAGYLKWIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTEVSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL-------------ALDFKRKARSGSTTYSYGPMVSHTSITNVTTRGTLALH 443          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: PTH2R (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:100488565])

HSP 1 Score: 82.4185 bits (202), Expect = 3.055e-16
Identity = 61/277 (22.02%), Postives = 123/277 (44.40%), Query Frame = 2
Query:    2 MNLTIQI-----NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWI 784
            +N+T+Q+     NC   +D  + WP   P   +  +C   S +++F   G A+R C+ +G W  V       +N ++ N+ EC     + L PER +   +  + L  +   G  +   +L ++I I+  F+ L   R  IH  LF++ +         +  +   + +  L         ++   D        +   ++ YF+ + + W+LVEG+++H++I V  F    +   +  +GW  P    + WAV  +   +  + W+ + + ++ WI
Sbjct:   30 LNITVQLQEEDSNCIPEWDGLVCWPRGIPGRILAVSC--PSYVYDFNHRGLAYRRCNINGTWDFV-----HRLNKTFANYTECL----HFLKPERSQGKREFFERLYVMYTVGYSISFCSLAVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAGSIFIKDKVVHTHIGVKELDAVLMGDLMISPVLDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHSLIFVAFFSDTKYLWGFTLIGWGFPAVFVVIWAVARAT-LADARCWE-LSAGDIKWI 293          
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 82.4185 bits (202), Expect = 3.422e-16
Identity = 105/433 (24.25%), Postives = 192/433 (44.34%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF-GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND-------PKMNGFSNLRSAI----YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNT------MTSTLLSNTETKTNMFEH 1255
            C   +D  + WPE  P  TV  +C      F   G A+R C  +G W  V G      N ++ N+ EC K   +N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LFI+ +            L    + + +++ +  D       P  +    +   +    + YF+ + + W+LVEG+++H++I +     + +   +   GW +P    L WA   +   + T  W  + +  L WI+ +  +  I +N    IN++RVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +               D K K +S   T      ++ T ++N  T+  +  H
Sbjct:   74 CLPEWDGVVCWPEGLPGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGN-----NRTWANYTECAK-YLFNETKER-----EVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFMAFISDKKYLWGFTLFGWGVPAIFVLIWARERAT-VADTGCWD-LSAGYLKWIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTEVSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL-------------ALDFKRKARSGSTTYSYGPMVSHTSITNVTTRGTLALH 480          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 89.3521 bits (220), Expect = 1.271e-18
Identity = 96/387 (24.81%), Postives = 183/387 (47.29%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA--------LQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS--DVCQXXXXXXXXXXXXXXXGVINFVQMINL---DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  +F++ +   A        L     +D    L +E+    ++V         G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S +  WI+ +  +  + +N +  IN+IRVL  KLR  N+   D  Q    +  + L++  L  +++   + L   ++    + + +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDNIVCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWEVVPGH-----NRTWANYSECLKFMT-NETRER-----EVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVW-VGVRATLANTGCWD-LSSGHKKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 89.3521 bits (220), Expect = 1.271e-18
Identity = 96/387 (24.81%), Postives = 183/387 (47.29%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA--------LQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS--DVCQXXXXXXXXXXXXXXXGVINFVQMINL---DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  +F++ +   A        L     +D    L +E+    ++V         G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S +  WI+ +  +  + +N +  IN+IRVL  KLR  N+   D  Q    +  + L++  L  +++   + L   ++    + + +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDNIVCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWEVVPGH-----NRTWANYSECLKFMT-NETRER-----EVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVW-VGVRATLANTGCWD-LSSGHKKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 89.3521 bits (220), Expect = 1.271e-18
Identity = 96/387 (24.81%), Postives = 183/387 (47.29%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA--------LQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS--DVCQXXXXXXXXXXXXXXXGVINFVQMINL---DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  +F++ +   A        L     +D    L +E+    ++V         G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S +  WI+ +  +  + +N +  IN+IRVL  KLR  N+   D  Q    +  + L++  L  +++   + L   ++    + + +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDNIVCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWEVVPGH-----NRTWANYSECLKFMT-NETRER-----EVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVW-VGVRATLANTGCWD-LSSGHKKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTL 479          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Vipr1 (vasoactive intestinal peptide receptor 1 [Source:MGI Symbol;Acc:MGI:109272])

HSP 1 Score: 84.7297 bits (208), Expect = 3.006e-17
Identity = 103/421 (24.47%), Postives = 194/421 (46.08%), Query Frame = 2
Query:   23 NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAF---RHCHFSGKWTNVFGEP---SENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANN--SSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVAR-WDSKNKLKSNQNTMTSTLLSNTETKTNMFE 1252
             C   +D+   WP T   + V  +C +   LF     +   R+C   G W+ +   P   +  +N   ++ DE  +++ Y+     +KT   +   LS        L S  + M+IL L  F+ L   R  IH  LF++ +          + L           N   D       + ++A+  ++Y V + F W+LVEG+++H ++AV+ F  R +F  Y+ +GW +P    + W ++  + F     W  I + +L+WI+    +  I +N +  I +IR+LV KLR  +   +D        K+ +LLIPL GV ++V M      +F   V +  + ++ S+QG  V+I++C +N +++  + R + ++ ++  L  G+  K    W   N +  +      T +S +  +++ F+
Sbjct:   62 GCSKMWDNLTCWPTTPWGQVVVLDCPLIFQLFSPIHGYNISRNCTEEG-WSQLEPGPYHIACGLNDRASSMDEQQQTEFYD----AVKTGYTIGYSLS--------LASLLVAMAILSL--FRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFN---------NGETDHCSEASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVFIMIWTIV-RIHFEDFGCWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDIGKNDSSPYSRLAKSTLLLIPLFGV-HYV-MFAFFPDNFKAQVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVL--GWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSSSFQ 453          
BLAST of Calcitonin receptor vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 82.8037 bits (203), Expect = 1.074e-16
Identity = 101/383 (26.37%), Postives = 173/383 (45.17%), Query Frame = 2
Query:   56 WPETAPNETVYQNCTISSNLFEFGK---AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAV--NVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKW---------KYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVAR 1162
            WP++AP   V + C    N  ++     A+R C  +G W       +  +N S+       K + Y+L       +N L   +S +A          L  + L+    + +   R  IH  L    +        L +           +V+  N+     +    + I+ YFV + F WM VEG ++H  I +  +  H R W   +LF+GW IP PI + WAV   + + + Q W          YIY   +  ++ I        N VFL N++R+L+ KLRA+ +S+  Q + A+KA ++L+PLLG+   +  +N        +V +     L S+QG FVS+ +C  N ++R A+ + +++++  + L    R+ VAR
Sbjct:   51 WPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTW-------ASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVA----------LVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQL--------IDHEVHEGNEV----WCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWL--FLFIGWCIPCPIIIAWAV-GKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLI--------NFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHAL----RVPVAR 389          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q9W4Y2|PDFR_DROME (PDF receptor OS=Drosophila melanogaster OX=7227 GN=Pdfr PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 5.462e-33
Identity = 115/374 (30.75%), Postives = 200/374 (53.48%), Query Frame = 2
Query:   38 YDSYLLWPETAPNETVYQNCTISSNLFEFGK-AFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLN-----------DLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLL----KEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENL---YWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            +D+ L WP T        NC    +  +  K A R C   G+W +       N  G +T++  C+K       PE I+ +            D+ +    + I GL L  F L +S+LI   F+ L N RTKIHK LF+A++ +  ++++L++D      KE + ++S     N P +   S +   + EY  T++F+WM +EG+++HN++ V VF   +    +  +GW +PI +T  WA   +V +  T   + +++ NL   YWI+   R+  I +N  FL+N+IRVLV+KLR + +SD+ Q + A++AAI+L+PLLG+ N +  +     +  + V       L S+QG F+++++C +N ++R  +++S
Sbjct:  151 WDTLLCWPPTPAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPG-WTDYGPCYK-------PEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYV---LLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWA-RCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKS 512          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|Q09460|PDFR1_CAEEL (Calcitonin receptor-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=pdfr-1 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 1.181e-25
Identity = 119/412 (28.88%), Postives = 192/412 (46.60%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNV-FGEPSENINGSYTNFDECFKSKT----YNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTW--AVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLD--------------MQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM----RNNLNSGFRLKVARWDSKN 1177
            C A YD+ L WP T  N +V   C     L       + CH SG W+    GE    + G +TNF  C+  +      NL  E +    ++ +    +   GL L   +L ++I I + F+ L  +R  +H  L IA+L    L++ L+IDL+    ++    N+     +N    +   ++   EYF T  F WM +EG++++N I    F++      Y   G+ IP+  T+ W   VL+   F   +     Y E  +WI+   R+  + IN+ F+ NVIRVL  K+R +N++     K ++KAA++L+PLLGV N +Q I                   SF Y+           YQGL V+ ++C  NK++   +   Y +YR+    +N L  G R   + + +KN
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPG-WTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIF-TGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYM-----------YQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKN 472          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|P25107|PTH1R_DIDVI (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Didelphis virginiana OX=9267 GN=PTH1R PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 4.319e-19
Identity = 101/384 (26.30%), Postives = 187/384 (48.70%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHIDLLKEXXXXXXKVNNRNDP-KMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP   P + V   C     +++F   G+A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  LF++ +         +  L   +  D ++  +++  +      P    GF   R A+  + YF+T+ + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T+ W  + S N  WI+ +  +  I +N +  IN+IRVL  KLR  N+       Q +  +K+ ++L+PL GV  I F+     ++    + V +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  105 CLPEWDNIVCWPAGVPGKVVAVPC--PDYIYDFNHKGRAYRRCDSNGSWELVPGN-----NRTWANYSECVKFLT-NETRER-----EVFDRLGMIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFVSFMLRAVSIFIKDAVLYSGVSTDEIERITEEELRAFTEPPPADKAGFVGCRVAVTVFLYFLTTNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTLFGWGLPAVFVAVW-VTVRATLANTECWD-LSSGNKKWIIQVPILAAIVVNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGILWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTL 473          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|P41593|PTH1R_MOUSE (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Mus musculus OX=10090 GN=Pth1r PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 8.890e-18
Identity = 96/387 (24.81%), Postives = 183/387 (47.29%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA--------LQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS--DVCQXXXXXXXXXXXXXXXGVINFVQMINL---DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  +F++ +   A        L     +D    L +E+    ++V         G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S +  WI+ +  +  + +N +  IN+IRVL  KLR  N+   D  Q    +  + L++  L  +++   + L   ++    + + +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDNIVCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWEVVPGH-----NRTWANYSECLKFMT-NETRER-----EVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVW-VGVRATLANTGCWD-LSSGHKKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTL 479          
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Match: sp|P25961|PTH1R_RAT (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Rattus norvegicus OX=10116 GN=Pth1r PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.458e-17
Identity = 96/387 (24.81%), Postives = 183/387 (47.29%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA--------LQMSLHID----LLKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS--DVCQXXXXXXXXXXXXXXXGVINFVQMINL---DMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
            C   +D+ + WP  AP E V   C     +++F   G A+R C  +G W  V G      N ++ N+ EC K  T N   ER     ++   L  I   G  +   +LT+++LIL  F+ L   R  IH  +F++ +   A        L     +D    L +E+    ++V         G++  R A+  + YF+ + + W+LVEG+++H++I +  F  + +   +   GW +P      W V +    ++T  W  + S +  WI+ +  +  + +N +  IN+IRVL  KLR  N+   D  Q    +  + L++  L  +++   + L   ++    + + +  + L  S+QG FV+I++C  N +++  + +S++++ +
Sbjct:  108 CLPEWDNIVCWPLGAPGEVVAVPC--PDYIYDFNHKGHAYRRCDRNGSWEVVPGH-----NRTWANYSECLKFMT-NETRER-----EVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVW-VGVRATLANTGCWD-LSSGHKKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTL 479          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A1J1IHS0 (CLUMA_CG013115, isoform A (Fragment) OS=Clunio marinus OX=568069 GN=putative PDF receptor PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.415e-41
Identity = 129/371 (34.77%), Postives = 211/371 (56.87%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLND------LTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHID--LLKEXXXXXXKVNN-RNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYS-ENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQM--INLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRS 1102
            C   +DSYL WP T   ET  Q C  +  L     A R C   GKW    G PS N N  +TN+  C+  +   L     K  ND      + K    + + GL+     L +S++I  +F+ L N RT+IHK LFIA++ +  ++++L+ID  +++   +++  + +  N P +   S +   + EY  T++FLWM +EG+++HNI+ V VF  R+    Y  +GW +P+ +T+ WA   +V+  S QK  Y Y+  + Y I+   R+  I +N VFL N+IRVLV+KLR +++SDV Q + A++AAI+L+PLLG+ N + M    LD   F + V   +   L ++QG F+++++C +N ++R A+++S
Sbjct:    4 CSWIFDSYLCWPPTRAGETALQKCPPTKGLDPTKFAERRCTEEGKWEGKLGVPSTN-NQGWTNYTNCYLPEVLEL---LRKLGNDAEIKLNIAKRTRTLEMIGLVTSLIALVISLIIFYRFRSLRNNRTRIHKNLFIAMVIQVLIRLTLYIDQAIIRNADENAKPLYSIENTPYLCEASYI---LLEYARTAMFLWMFIEGLYLHNIVTVTVFQGRFPHAIYAIVGWGVPVLMTVIWAGFTAVK--SNQKCWYNYNLTDYYRILEGPRLVVILLNFVFLFNIIRVLVVKLRQSHTSDVEQVRKAVRAAIVLLPLLGITNLLNMSKAPLDRSPFEFAVWSYVTHFLTTFQGFFIAMIYCFLNGEVRTAILKS 365          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A182YG29 (Uncharacterized protein OS=Anopheles stephensi OX=30069 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 9.154e-37
Identity = 117/379 (30.87%), Postives = 201/379 (53.03%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNL--------PPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSN---LRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMIN--LDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKY 1114
            C   +DS L WP T  N T+ Q C  +  +     A R C   G+W    G PS N++G +TN+  C+  +   L          +      D+ +    +   G  L    L +S++I  KF+ L N RT+IHK LF+A++ +  ++++L+ID   +    S      N+    G  N   L  A Y   EY  T +F+WM +EG+++HN++ V VF  R+    Y  +GW  P+ +T+ WA+  +      + W        YWI+   R+  + +N +FL+N+IRVL++KLR +++SDV Q + A++AA++L+PLLG+ N + M    LD  +  + +   +   L S+QG F+++++C +N ++R A+++S + Y
Sbjct:   60 CNWTWDSILCWPPTPANLTIRQRCPPAHGIDTSKFAERRCSAEGQWEGKPGSPS-NLHG-WTNYTPCYSPEVIQLFRKLYAGGSDDEANDKIDIAERTRTLETVGFSLSLVALIISLIIFCKFRGLRNNRTRIHKNLFVAMVIQVVIRLTLYID---QAIIRSGGKKFGNESSRQGIDNTPFLCEASYVLLEYARTCMFMWMFIEGLYLHNVVTVTVFQGRFPHTLYAIVGWGGPVVLTVIWAITTAQYIRQQKCWWGYNLTPYYWILEGPRLAVVVLNFIFLLNIIRVLIVKLRQSHTSDVEQVRKAVRAAVVLVPLLGITNILNMTQAPLDKTALEFAIWSYVTHFLTSFQGFFIALLYCFLNGEVRTALMKSISVY 433          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A182W100 (Uncharacterized protein OS=Anopheles minimus OX=112268 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 4.342e-36
Identity = 118/385 (30.65%), Postives = 202/385 (52.47%), Query Frame = 2
Query:    8 LTIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNL--------PPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSN---LRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMIN--LDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKY 1114
            LT+   C   +DS L WP T  N T+ Q C     +     A R C   G+W    G P+ N  G +TN+  C+  +   L          + +    D+ +    +   G  L    L +S++I  KF+ L N RT+IHK LF+A++ +  ++++L+ID   +    S      N+    G  N   L  A Y   EY  T +F+WM +EG+++HN++ V VF  R+    Y  +GW  P+ +T+ WA+  +      + W        YWI+   R+  + +N +FL+N+IRVL++KLR +++SDV Q + A++AA++L+PLLG+ N + M    LD  +  + +   +   L S+QG F+++++C +N ++R A+++S + Y
Sbjct:  116 LTLVPYCNWTWDSILCWPPTPANLTIRQRCPSGHGIDTSKFAERRCSAEGQWEGRLGFPA-NQQG-WTNYTPCYSPEVVQLFRKLSAGGNDDEVNVKIDIAERTRTLETVGFSLSLVALIISLIIFCKFRGLRNNRTRIHKNLFVAMVIQVVIRLTLYID---QAIIRSGGKKFGNESSRQGIDNTPYLCEASYVLLEYARTCMFMWMFIEGLYLHNVVTVTVFQGRFPHTLYAIVGWGGPVVLTVIWAITTAHYIRQQKCWWGYNLTPYYWILEGPRLAVVVLNFIFLLNIIRVLIVKLRQSHTSDVEQVRKAVRAAVVLVPLLGITNILNMTQAPLDKTALEFAIWSYVTHFLTSFQGFFIALLYCFLNGEVRTALMKSISVY 495          
BLAST of Calcitonin receptor vs. TrEMBL
Match: A0A084VTN4 (AGAP003654-PA-like protein OS=Anopheles sinensis OX=74873 GN=ZHAS_00008810 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.224e-35
Identity = 118/389 (30.33%), Postives = 201/389 (51.67%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNL------------------PPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSN---LRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMIN--LDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKY 1114
            C   +DS L WP T  N T+ Q C  +  +     A R C   G+W    G P+  +   +TN+  C+  +   L                    ER +TL  +   LS +A          L +S++I  KF+ L N RT+IHK LF+A++ +  ++++L+ID   +    S      N+    G  N   L  A Y   EY  T +F+WM +EG+++HN++ V VF  R+    Y  +GW  P+ +T+ WA+  +      + W        YWI+   R+  + +N +FL+N+IRVL++KLR +++SDV Q + A++AA++L+PLLG+ N + M    LD  +  + +   +   L S+QG F+++++C +N ++R A+++S + Y
Sbjct:   51 CNWTWDSILCWPPTPANLTIRQRCPPAHGIDTSKFAERRCSAEGQWEGKPGSPATLVG--WTNYTPCYSPEVIQLFRKLYAGGSDDDANIKIDIAERTRTLETVGFSLSLVA----------LIISLIIFCKFRGLRNNRTRIHKNLFVAMVIQVVIRLTLYID---QAIIRSGGKKFGNESSRQGIDNTPFLCEASYVLLEYARTCMFMWMFIEGLYLHNVVTVTVFQGRFPHTLYAVVGWGGPVVLTVIWAITTAQYIRQQKCWWGYNLTPYYWILEGPRLAVVVLNFIFLLNIIRVLIVKLRQSHTSDVEQVRKAVRAAVVLVPLLGITNILNMTQAPLDKTALEFAIWSYVTHFLTSFQGFFIALLYCFLNGEVRTALMKSISVY 424          
BLAST of Calcitonin receptor vs. TrEMBL
Match: Q7PQE3 (AGAP003654-PA OS=Anopheles gambiae OX=7165 GN=GPRCAL3 PE=3 SV=5)

HSP 1 Score: 148.288 bits (373), Expect = 2.278e-35
Identity = 119/387 (30.75%), Postives = 203/387 (52.45%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNL----------------PPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSN---LRSAIY---EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMIN--LDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKY 1114
            C   +DS L WP T  N T+ Q C  +  +     A R C   G+W    G P   ++G +TN+  C+  +   L                  ER +TL  +   LS IA          L +S++I  KF+ L N RT+IHK LF+A++ +  ++++++ID     +   S     N+    G  N   L  A Y   EY  T +F+WM +EG+++HN++ V VF  R+    Y  +GW  P+ +T+ WA++ +      + W        YWI+   R+  + +N +FL+N+IRVL++KLR +++SDV Q + A++AA++L+PLLG+ N + M    LD  +  + +   +   L S+QG F+++++C +N ++R A+++S + Y
Sbjct:   73 CNWTWDSILCWPPTPANLTIRQRCPPAHGIDTSKFAERRCSAEGQWEGKPGSP-PTLHG-WTNYTPCYSPEVIQLFRKLYASGSDDEANFDIAERTRTLETVGFSLSLIA----------LIVSLVIFCKFRGLRNNRTRIHKNLFVAMVIQVVIRLTVYID----QAIIRSGGKKGNESSRQGIDNTLFLCEASYVLLEYARTCMFMWMFIEGLYLHNVVTVTVFQGRFPHKLYAIVGWGGPLILTVIWAIITAQYIRQQKCWWGYNLTPYYWILEGPRLAAVVLNFIFLLNIIRVLIVKLRQSHTSDVEQVRKAVRAAVVLVPLLGITNILNMTQAPLDKTALEFAIWSYVTHFLSSFQGFFIALLYCFLNGEVRTALMKSISVY 443          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 100.523 bits (249), Expect = 2.431e-22
Identity = 109/426 (25.59%), Postives = 201/426 (47.18%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHIDLLKEXXXXXXKVNNRNDPK-MNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNM 1246
            C   +D  L WPE AP  TV   C     +++F   G A+R C  +G W     E + + N ++ N+ EC K   YN   +  +  + L   L Y     + LGS  L ++++IL  F+ L   R  IH  LF++ +         +  L     ++  +  + +  K      P     F   + A+  + YF+ + + W+LVEG+++H++I +  F  R +   +  +GW +P      WA + +   + T+ W  + + NL WI+ I  +  I +N +  +N+IRVL  KLR +N+       Q +  +K+ ++L+PL GV  I F+ M   ++    + + +  + L  S+QG FV+I++C  N +++  + +S+++             +    D K K +S  NT +   + +  + TN+
Sbjct:   66 CMPEWDGILCWPEGAPGRTVSTAC--PEYIYDFNHKGHAYRRCDLNGSW-----ELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLY--LIYTIGYSISLGS--LMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTVWASVRAT-LADTECWD-LSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSR-------------RTLALDFKRKARSGSNTYSYGPMVSHTSVTNV 465          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 100.138 bits (248), Expect = 3.205e-22
Identity = 109/426 (25.59%), Postives = 201/426 (47.18%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLF--------ETALQMSLHIDLLKEXXXXXXKVNNRNDPK-MNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNM 1246
            C   +D  L WPE AP  TV   C     +++F   G A+R C  +G W     E + + N ++ N+ EC K   YN   +  +  + L   L Y     + LGS  L ++++IL  F+ L   R  IH  LF++ +         +  L     ++  +  + +  K      P     F   + A+  + YF+ + + W+LVEG+++H++I +  F  R +   +  +GW +P      WA + +   + T+ W  + + NL WI+ I  +  I +N +  +N+IRVL  KLR +N+       Q +  +K+ ++L+PL GV  I F+ M   ++    + + +  + L  S+QG FV+I++C  N +++  + +S+++             +    D K K +S  NT +   + +  + TN+
Sbjct:   52 CMPEWDGILCWPEGAPGRTVSTAC--PEYIYDFNHKGHAYRRCDLNGSW-----ELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLY--LIYTIGYSISLGS--LMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTVWASVRAT-LADTECWD-LSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSR-------------RTLALDFKRKARSGSNTYSYGPMVSHTSVTNV 451          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 85.8853 bits (211), Expect = 1.277e-17
Identity = 91/390 (23.33%), Postives = 184/390 (47.18%), Query Frame = 2
Query:   23 NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSA----------------IYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVC---QXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
             CPA +D  + WP   P       C     +++F   G A+R C  +  W  + GE   ++N ++ N+ EC KS      P R + +    + L  +   G  +   +L ++ILI+  F+ L   R  IH  LF++ +       ++ I +       S+ +   +   MN F+N                    ++ YF+ + + W+LVEG+++H++I +       +   +  +GW +P     TWA++ +   + ++ W+ + + N+ WI  +  +  I +N +  +N++RVL  K+R  N+       Q +   K+ ++L+ + GV  I FV M +  ++  G+ V +  +    S+QG FVSI++C  N +++  + +++ ++ +
Sbjct:   58 ECPAEWDGLICWPRGYPGTLAKVPC--PRYIYDFNHAGHAYRRCDSNSSW--LLGE---SLNKTWANYTECIKSPG----PNRERQV--FFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLR-----AVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDTKYLWGFTLIGWGVPAVFVATWAIVRAT-VADSRCWE-LSAGNIKWIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPH-TIEGLGWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKKTWTRWNL 426          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 85.1149 bits (209), Expect = 2.214e-17
Identity = 91/390 (23.33%), Postives = 184/390 (47.18%), Query Frame = 2
Query:   23 NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSA----------------IYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVC---QXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRM 1120
             CPA +D  + WP   P       C     +++F   G A+R C  +  W  + GE   ++N ++ N+ EC KS      P R + +    + L  +   G  +   +L ++ILI+  F+ L   R  IH  LF++ +       ++ I +       S+ +   +   MN F+N                    ++ YF+ + + W+LVEG+++H++I +       +   +  +GW +P     TWA++ +   + ++ W+ + + N+ WI  +  +  I +N +  +N++RVL  K+R  N+       Q +   K+ ++L+ + GV  I FV M +  ++  G+ V +  +    S+QG FVSI++C  N +++  + +++ ++ +
Sbjct:   48 ECPAEWDGLICWPRGYPGTLAKVPC--PRYIYDFNHAGHAYRRCDSNSSW--LLGE---SLNKTWANYTECIKSPG----PNRERQV--FFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLR-----AVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDTKYLWGFTLIGWGVPAVFVATWAIVRAT-VADSRCWE-LSAGNIKWIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPH-TIEGLGWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKKTWTRWNL 416          
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Match: gcgra (glucagon receptor [Source:NCBI gene;Acc:103044520])

HSP 1 Score: 77.7962 bits (190), Expect = 6.108e-15
Identity = 94/400 (23.50%), Postives = 179/400 (44.75%), Query Frame = 2
Query:    8 LTIQINCPAFYDSYLLWPETAPNETVYQNCT---ISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETA---------LQMSLHIDL-LKEXXXXXXKVNNRNDPKMNGFSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGV-INFVQMINLDMQSFGYXXXXXXXXXXP----SYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFR 1147
            L   + C   +D Y  WP+  PN TV   C            G  +  C   G+W        +N +    N  +   ++ Y     + +T+        Y     L LG+  L + IL+   F+ L   R  IH  LF + +   A          + SL+ID  +  + +    V N       G    R+A+   +Y + +   W+LVEG+++HN++AV V     + + YL +GW  P+   L W +++   + + + W+   +   +WI+    +  + IN    I++I++LV KLRA+            K+ + LIPLLG+ +    ++  +  S G + L   +  +     S+QGL V+I++C +NK+++  +++ + ++++  ++   +R
Sbjct:   48 LVTGLVCNRTFDKYACWPDGLPNTTVSVPCPWYLPWHRTVRQGLVYLECDADGQWAK-----KKNTSECEHNDPDQMDTQHYGRILSKFRTM--------YTVGYSLSLGALVLALGILV--AFRKLHCMRNNIHMNLFASFILRAASILIKDALLERPSLNIDPGITTEMEMEWLVKNEVSQTAIG---CRTAVVMMQYSIIANSYWLLVEGIYLHNLLAVTVLTEGNYLSIYLCIGWGAPLIFVLPW-IIVKYLYENEECWEQNINMEYWWIIRSPILLAVLINFFIFIHIIKILVSKLRAHQMRYNDYKCRLAKSTLTLIPLLGIHLVLFSLVTDESTSNGAMPLRLTKLFIDLFFNSFQGLLVAILYCFVNKEVQSEILKRWKRWKLGKDIEEEYR 428          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 78.5666 bits (192), Expect = 4.743e-16
Identity = 92/384 (23.96%), Postives = 177/384 (46.09%), Query Frame = 2
Query:   23 NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNG--FSNLRSAI--YEYFVTSVFLWMLVEGVHIHNIIAVNVFHT-RYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSS---DVCQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLN 1135
            +C A +D  + WP   P   V + C   S +++F   G A+R C  +G W           N  + N+ EC    T  L P       +    LS +   G  +   +L +++ ILT F+ L   R  IH  LF++ +   A  + +   +L  D++        + P      F+  R  +  + Y + + + W+LVEG++++++I +    + R W   +  +GW  P+     WA   +   +++Q W  + +  L WI     +  + +N V  +N++RVL  KLR  N++      Q +  +K+ ++L+PL GV  + F  M   D+    + + +  +    S+QG FV+I++C  N ++R  + + ++++ +   L 
Sbjct:   47 HCTAEWDGLICWPWGLPGSMVREKC--PSYIYDFNAHGHAYRKCESNGTWK------MSTANRLWANYSEC----TEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAA-SIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFLTFSASGRLW--TFALIGWGFPVVFVFVWAAARAT-LANSQCWD-LSAGWLKWIYQAPILAAVAVNFVLFVNIVRVLATKLRETNAARQESRQQYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVIGLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMKKLWSRWSLDQALK 413          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004243.1 (pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 gene:ENSPMAG00000003877.1 transcript:ENSPMAT00000004243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 8.463e-13
Identity = 55/241 (22.82%), Postives = 101/241 (41.91%), Query Frame = 2
Query:   20 INCPAFYDSYLLWPETAPNETVYQNCTIS---SNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDP----KMNGFSNLRS--AIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAV 715
            + C   +D Y  WP++ P+  V   C       +  E G  +R+C   G W        +N+  ++ +  EC   +  N+  E  +        L Y     + L S  + M ILI+  F+ L   R  IH  LF + +      +S+ +       + + +  N +D        G++  R+     +Y + + + W+LVEG ++H ++ + VF  +     Y+ +GW  PI   + W V
Sbjct:   31 VYCNRTFDHYACWPDSLPDTKVAIPCPSYLPWIDKVEGGYVYRYCTRDGTWLT-----QDNVTAAWRDHSECLDDEN-NISTEGKEMYLLHALRLVYTTGYSVSLASLVVAMGILIM--FRRLHCTRNYIHMNLFASFILRA---ISVLLKDAALTHNYTKRPQNASDWLGYFGYEGYTGCRATHVFMQYCIGANYFWLLVEGSYLHTLLTMCVFTKKKLIAFYVLLGWGTPIMFIIPWMV 260          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.413e-11
Identity = 88/382 (23.04%), Postives = 158/382 (41.36%), Query Frame = 2
Query:   56 WPETAPNETVYQNCTISSNLFEFGKA---FRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSIL-ILTKFKY------LMNYRTKIHKQLFIALLFETALQMSLHI-DLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKW---------KYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXX-XXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNS 1138
            WPE+    TV   C    N   +  +    R C  +G W               +N+  C             K + D  KP S      LI+      +S+  ++T F +      +   R  IH  L    +   A  + L I DL             RN+P    +  +   ++ YF  + F WM VEG ++H  I +     +   + ++ +GW IP PI + WA ++ + +   + W          YIY   +  ++ +        N +FL N++R+L+ KLRA+ +S+  Q       A L++  LLG+   +  +N        ++ + +   L S+QG FVS+ +C +N ++R A+ + +N++   + L +
Sbjct:   53 WPESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTW------------AQRSNYSLC-------------KPIIDAKKPNSQHYKIALIVNYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDL---------STQERNEP----WCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKSIFVCIGWCIPAPIIIVWA-MVKLFYEDEKCWFGKTEGKYIDYIYQGPIILVLLV--------NFIFLFNIVRILMTKLRASTTSETIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWNRWMDNHRLQA 387          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.048e-10
Identity = 96/415 (23.13%), Postives = 188/415 (45.30%), Query Frame = 2
Query:   23 NCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFG-KAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSY--QGLFVSIVFCLINKDIRKAVIRSYNKY-RMRNNLNSGFRLKVARWD-SKNKLKSNQNTMTSTLLSNTETKTNMFE 1252
            +C   +D +L W +T   +   Q+C      F+   K  + C+  G+W   F  P  N   +++N+  C       L          +   L Y+A+ G  +    L +S+ I   FK L   R  +HK LF++ +  +       I +++  +  +++    + P    +  +    ++Y +   + WML EG+++H +I V VF  +     Y  +GW  PI   L  AV  ++ +     W    +  LY I   V +  + +N+ FL+N++RVLV KL+  + ++      A++A ++L+PLLG I FV ++    + F   +   +  + P++  QG  V+ +FC  N +++ A+ R +  Y RM +     + +    +  S  +L           +++++ + N F+
Sbjct:   40 HCNRTWDGWLCWGDTMAGDVAVQHCPDYFPDFDLQEKVTKICNTDGQW---FRHPDSN--RTWSNYTLCNAFTADKL---------KMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSI------ITIIQLTAVANNQELVASKPV---WCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTIYYDD-NCWISSATHLLYIIHGPV-VAALLVNLFFLLNIVRVLVTKLKVTHRAETSMYMKAVRATLILVPLLG-IQFV-LVPWKPERFVGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAALKRYWILYLRMGHERRDQYFMASTSYTASVTELPCPNGGEHHGRMASSDAEANAFK 427          
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009048.1 (pep scaffold:Pmarinus_7.0:GL476704:23457:33669:1 gene:ENSPMAG00000008188.1 transcript:ENSPMAT00000009048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 5.619e-7
Identity = 23/77 (29.87%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  557 EYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIM 787
            +Y + + + W+LVEGV++H ++ V VF    +F  YL +GW  P+     W V+  ++  +T+ W +  +   +WI+
Sbjct:   14 QYCIVANYYWLLVEGVYLHTLLVVPVFSEETYFKVYLAVGWGTPVLFVAPWVVVKYLK-ENTECWGHNENMGYWWII 89          
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Match: EDO50018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF24])

HSP 1 Score: 53.5286 bits (127), Expect = 5.781e-8
Identity = 48/165 (29.09%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  209 TNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITL 703
            TN+          +P +  + L+ +T    YI     ILG F   ++++ L     L + RT+IH  L IA+     L ++   + L E      KV  +          L +A+  Y   SVF WMLVEG+H++ +I +  F TR     Y F+GW +P+ I +
Sbjct:   24 TNYAVLMSIGDMPIPAKHTRALSIVT----YIGCTLSILGVF---LTVVTLISLPVLRSERTRIHCNLCIAVGVSQILFLAGGTEELVES-----KVGCK----------LYAALMFYAFMSVFSWMLVEGIHLYQMIII-AFITRAMMKFYYFIGWGLPMCIVV 165          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: pth1r (parathyroid hormone 1 receptor [Source:NCBI gene;Acc:101155466])

HSP 1 Score: 89.3521 bits (220), Expect = 9.156e-19
Identity = 104/427 (24.36%), Postives = 197/427 (46.14%), Query Frame = 2
Query:   26 CPAFYDSYLLWPETAPNETVYQNCTISSNLFEF---GKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFK-SKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND-------PKMNGFSNLRSAI----YEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDV---CQXXXXXXXXXXXXXXXGV--INFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNM 1246
            C A +D  + WPE  P + V   C     +++F   G A+R C  +G W         + N ++ N++EC K    YN   E+     ++   L  I   G  +   +L ++++IL  F+ L   R  IH  LF++ +          + L  E   ++ +    +D       P +N    +   +    + YF+ + + W+LVEG+++H++I +  F  R +   +  +GW +P      WA + +  F+ T+ W  + + NL WI  +  +  + +N +  +N+IRVL  KLR  N+       Q +  +K+ ++L+PL GV  I F  M   ++    +L+ +  + L  S+QG  V+I++C  N +++  + +S+N+             +    D K K +S  NT +   + +  + TN+
Sbjct:   61 CSAEWDGIVCWPEGPPGKLVSTAC--PEYIYDFNHKGLAYRRCDNNGTWEQA------SANKTWANYNECAKFLYHYNHSHEK-----EVFHRLYLIYTVGYSVSLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSYMLRAISIFVKDVVLYSESPLENMERVTLDDLKSITIAPPVNKTQFIACKVVVTLFMYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAVFVSIWATVRAT-FADTECWD-LSAGNLKWIYQVPILMAVVVNFILFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIIFNAMPYTEVSGIPWLIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSWNR-------------RTLALDFKRKARSGSNTYSYGPMVSHTSVTNV 459          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: gcgra (glucagon receptor [Source:NCBI gene;Acc:101167871])

HSP 1 Score: 86.6557 bits (213), Expect = 6.472e-18
Identity = 99/405 (24.44%), Postives = 183/405 (45.19%), Query Frame = 2
Query:   11 TIQINCPAFYDSYLLWPETAPNETVYQNCT------ISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND--------PKMNGF-SNLRSA-------IYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXX----PSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFR 1147
            + ++ C   +D Y+ WP+  PN TV   C          N  + G  ++ C  +GKW  +             N  EC    +  L    I+ +  +          G  L    L +++ IL  F+ L   R  IH  LF + +   AL + +  D L E +  +  ++   D        P M    SN+ S        + +Y + +   W+LVEG+++HN++ + VF  R +F  YL +GW  P+   + W +L  +   + + W+   S N +WI+    +  + IN +  I++I++LV KLRA+            K+ + LIPLLG+   + +   D  + G + L   +        S+QGL V+I++C +NK+++  +++ + ++++  N+   +R
Sbjct:   49 STELVCNRMFDKYVCWPDGLPNTTVSVPCPWYLPWYHKGNRIQHGMVYQECDANGKWVTM------------ENTSECDPLDSTPLYYGHIRIMYTV----------GYSLSLVALVLALGILIFFRKLHCMRNNIHMNLFASFILR-ALSILIK-DALLEANHTAQDLSRDQDQGFPSASMPPMELLVSNMTSVSCRIAVVMMQYSIMANSYWLLVEGIYLHNLLVITVFTERNYFKIYLCIGWGTPLIFLVPWVILKYLN-ENQECWEQNISMNYWWIIRAPILLAVVINFLIFIHIIKILVSKLRAHQMRYTDYKFRLAKSTLTLIPLLGIHQVIFIFVTDESTKGTISLRLTKLFTDLFFSSFQGLLVAILYCFVNKEVQSEILKKWKRWKLGRNIEEEYR 428          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: gcgra (glucagon receptor [Source:NCBI gene;Acc:101167871])

HSP 1 Score: 84.3445 bits (207), Expect = 4.568e-17
Identity = 98/402 (24.38%), Postives = 183/402 (45.52%), Query Frame = 2
Query:   11 TIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLF---EFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND--------PKMNGF-SNLRSA-------IYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXX----PSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFR 1147
            + ++ C   +D Y+ WP+  PN TV   C      +   + G  ++ C  +GKW  +             N  EC    +  L    I+ +  +          G  L    L +++ IL  F+ L   R  IH  LF + +   AL + +  D L E +  +  ++   D        P M    SN+ S        + +Y + +   W+LVEG+++HN++ + VF  R +F  YL +GW  P+   + W +L  +   + + W+   S N +WI+    +  + IN +  I++I++LV KLRA+            K+ + LIPLLG+   + +   D  + G + L   +        S+QGL V+I++C +NK+++  +++ + ++++  N+   +R
Sbjct:   49 STELVCNRMFDKYVCWPDGLPNTTVSVPCPWYLPWYHKVQHGMVYQECDANGKWVTM------------ENTSECDPLDSTPLYYGHIRIMYTV----------GYSLSLVALVLALGILIFFRKLHCMRNNIHMNLFASFILR-ALSILIK-DALLEANHTAQDLSRDQDQGFPSASMPPMELLVSNMTSVSCRIAVVMMQYSIMANSYWLLVEGIYLHNLLVITVFTERNYFKIYLCIGWGTPLIFLVPWVILKYLN-ENQECWEQNISMNYWWIIRAPILLAVVINFLIFIHIIKILVSKLRAHQMRYTDYKFRLAKSTLTLIPLLGIHQVIFIFVTDESTKGTISLRLTKLFTDLFFSSFQGLLVAILYCFVNKEVQSEILKKWKRWKLGRNIEEEYR 425          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: gcgra (glucagon receptor [Source:NCBI gene;Acc:101167871])

HSP 1 Score: 84.3445 bits (207), Expect = 4.568e-17
Identity = 98/402 (24.38%), Postives = 183/402 (45.52%), Query Frame = 2
Query:   11 TIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLF---EFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRND--------PKMNGF-SNLRSA-------IYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXX----PSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFR 1147
            + ++ C   +D Y+ WP+  PN TV   C      +   + G  ++ C  +GKW  +             N  EC    +  L    I+ +  +          G  L    L +++ IL  F+ L   R  IH  LF + +   AL + +  D L E +  +  ++   D        P M    SN+ S        + +Y + +   W+LVEG+++HN++ + VF  R +F  YL +GW  P+   + W +L  +   + + W+   S N +WI+    +  + IN +  I++I++LV KLRA+            K+ + LIPLLG+   + +   D  + G + L   +        S+QGL V+I++C +NK+++  +++ + ++++  N+   +R
Sbjct:   49 STELVCNRMFDKYVCWPDGLPNTTVSVPCPWYLPWYHKVQHGMVYQECDANGKWVTM------------ENTSECDPLDSTPLYYGHIRIMYTV----------GYSLSLVALVLALGILIFFRKLHCMRNNIHMNLFASFILR-ALSILIK-DALLEANHTAQDLSRDQDQGFPSASMPPMELLVSNMTSVSCRIAVVMMQYSIMANSYWLLVEGIYLHNLLVITVFTERNYFKIYLCIGWGTPLIFLVPWVILKYLN-ENQECWEQNISMNYWWIIRAPILLAVVINFLIFIHIIKILVSKLRAHQMRYTDYKFRLAKSTLTLIPLLGIHQVIFIFVTDESTKGTISLRLTKLFTDLFFSSFQGLLVAILYCFVNKEVQSEILKKWKRWKLGRNIEEEYR 425          
BLAST of Calcitonin receptor vs. Ensembl Medaka
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:101157488])

HSP 1 Score: 82.4185 bits (202), Expect = 1.471e-16
Identity = 101/384 (26.30%), Postives = 179/384 (46.61%), Query Frame = 2
Query:   56 WPETAPNETVYQNCTISSNLFEFG---KAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSK-TYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAV--NVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKW---------KYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVAR 1162
            WP ++    V + C    N  ++     A+R C  +G W          +  +Y+N +   + K  Y +  +    +N L   +S   +G L++ +F L + +      + +   R  IH  L    +    +   L +            ++  N+P    +  L + IY YFV + F WM VEG ++H  I +  +    R W   +LF+GW IP PI +TWA+   + F + + W          YIY   +  ++ I        N VFL N++R+L+ KLRA+ +S+  Q + A+KA ++L+PLLG+   +  +N        +V +     L S+QG FVS+ +C +N ++R AV + +++++     N   R++VAR
Sbjct:  116 WPRSSTGRIVERPCPAYINGVKYNATRSAYRECMDNGTWA---------LKINYSNCEPILEEKRKYPMHYKIALIINYLGHCIS---VGALVV-AFVLFLCL------RSIRCLRNIIHWNLITTFILRNVMWFLLQL--------IDHNIHESNEP----WCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWV--FLFIGWCIPCPIIVTWAI-GKLYFENEKCWFGKEPGKYMDYIYQGPVILVLLI--------NFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAVRKRWHRWQD----NHALRVRVAR 453          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000035956.1 (SMESG000035956.1)

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 410/414 (99.03%), Postives = 410/414 (99.03%), Query Frame = 2
Query:   20 INCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRXXXXXXXXXXXXXXXXXXXXKLRANNSSDVCQXXXXXXXXXXXXXXXGVINFVQMINLDMQSFGYXXXXXXXXXXPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNMFEHSY 1261
            INCP FYDSYLLWPETAPNETVYQNC ISSNLFEFGKAFRHCHFSGKWTNVFGEPSENIN SYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEDSDDSSKVNNRND KMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRIFCIFINIVFLINVIRVLVLKLRANNSSDVCQAKTAIKAAILLIPLLGVINFVQMINLDMQSFGYLVLLTLQGLLPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNMFEHSY
Sbjct:   37 INCPTFYDSYLLWPETAPNETVYQNCIISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINSSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEDSDDSSKVNNRNDAKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWKYIYSENLYWIMAIVRIFCIFINIVFLINVIRVLVLKLRANNSSDVCQAKTAIKAAILLIPLLGVINFVQMINLDMQSFGYLVLLTLQGLLPSYQGLFVSIVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNTMTSTLLSNTETKTNMFEHSY 450          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000066855.1 (SMESG000066855.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.009e-12
Identity = 59/226 (26.11%), Postives = 95/226 (42.04%), Query Frame = 2
Query:   17 QINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGWIIPIP 694
            Q+ C A YD  L W  T    TV QNC    +      A++ C  SG+W    G     +N SYT++  C    +Y++                YI   G  +    L +S+ +L  FK L  +R  +HK +F   L  +   + L+I++L           + ND  +         I  Y  T+ + WML EG+++  I+        + FN   F+G++I +P
Sbjct:   31 QLYCRAIYDGLLCWNYTKAGLTVEQNCPALYDFNVSALAYKSCLPSGEWLTKGG-----VNQSYTDYMACVPKASYSI----------------YIYFVGYSMSIIALVISLAVLFYFKQLNCHRITLHKNMFFCNLMNSTGWL-LYINVLSM---------HSNDSAVYSMCQALYLIVNYTGTATYFWMLCEGLYLLMILI-------FTFNKGQFIGFLITMP 218          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000066855.1 (SMESG000066855.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.598e-11
Identity = 55/221 (24.89%), Postives = 90/221 (40.72%), Query Frame = 2
Query:   17 QINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNIIAVNVFHTRYWFNCYLFMGW 679
            Q+ C A YD  L W  T    TV QNC    +      A++ C  SG+W    G     +N SYT++  C    +Y++                YI   G  +    L +S+ +L  FK L  +R  +HK +F   L  +   + L+I++L           + ND  +         I  Y  T+ + WML EG+++  I+       ++     + +GW
Sbjct:   31 QLYCRAIYDGLLCWNYTKAGLTVEQNCPALYDFNVSALAYKSCLPSGEWLTKGG-----VNQSYTDYMACVPKASYSI----------------YIYFVGYSMSIIALVISLAVLFYFKQLNCHRITLHKNMFFCNLMNSTGWL-LYINVLSM---------HSNDSAVYSMCQALYLIVNYTGTATYFWMLCEGLYLLMILIFTFNKGQFIVRFCIILGW 220          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000066855.1 (SMESG000066855.1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.992e-11
Identity = 53/202 (26.24%), Postives = 84/202 (41.58%), Query Frame = 2
Query:   17 QINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNII 622
            Q+ C A YD  L W  T    TV QNC    +      A++ C  SG+W    G     +N SYT++  C    +Y++                YI   G  +    L +S+ +L  FK L  +R  +HK +F   L  +   + L+I++L           + ND  +         I  Y  T+ + WML EG+++  I+
Sbjct:   31 QLYCRAIYDGLLCWNYTKAGLTVEQNCPALYDFNVSALAYKSCLPSGEWLTKGG-----VNQSYTDYMACVPKASYSI----------------YIYFVGYSMSIIALVISLAVLFYFKQLNCHRITLHKNMFFCNLMNSTGWL-LYINVLSM---------HSNDSAVYSMCQALYLIVNYTGTATYFWMLCEGLYLLMIL 201          
BLAST of Calcitonin receptor vs. Planmine SMEST
Match: SMESG000006966.1 (SMESG000006966.1)

HSP 1 Score: 63.929 bits (154), Expect = 7.383e-11
Identity = 60/250 (24.00%), Postives = 100/250 (40.00%), Query Frame = 2
Query:   14 IQINCPAFYDS-YLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHFSGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSYIAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMSLHIDLLKEXXXXXXKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEGVHIHNII--AVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKWK 754
            + I CP  +D  YL W  T      YQNC       +   A + C  +G W        + +N ++TNFD C           ++  +N +     YI   G  L    + +S+ I   FK L   R  IHK LFI+ +      M+    + K            ++P    +  +   I  +F  S + W   EG+++  ++  A      +  + C +F GW  P+ +T+ +A   S+R+   Q  K
Sbjct:   22 VDIFCPPIFDDLYLCWNFTKGGSKTYQNCPDIPGFSKEAMASKKCEINGTW-----YIDQALNRTWTNFDPCI---------NKVPNINAV-----YIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMV-------HNP---SYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLC-VFFGWGFPLILTIFYA---SLRYQLEQPEK 238          
The following BLAST results are available for this feature:
BLAST of Calcitonin receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTH1R1.617e-1626.36parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R6.453e-1626.36parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R6.453e-1626.36parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R6.453e-1626.36parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R6.453e-1626.36parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-18.539e-2729.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-18.539e-2729.03Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-19.286e-2728.88Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-19.286e-2728.88Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-17.281e-2629.18Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdfr5.448e-3430.75gene:FBgn0260753 transcript:FBtr0070436[more]
Pdfr9.497e-3430.75gene:FBgn0260753 transcript:FBtr0340084[more]
Pdfr9.497e-3430.75gene:FBgn0260753 transcript:FBtr0340085[more]
Pdfr1.331e-3330.75gene:FBgn0260753 transcript:FBtr0308565[more]
Dh44-R21.329e-1422.77gene:FBgn0033744 transcript:FBtr0087936[more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r5.571e-2025.29parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r7.639e-2025.29parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth2rb3.614e-1722.56parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
pth2rb1.189e-1622.99parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
calcr1.047e-1425.00calcitonin receptor [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc221.485e-1824.71coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc222.641e-1624.25coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc222.892e-1624.25coiled-coil domain containing 22 [Source:Xenbase;A... [more]
PTH2R3.055e-1622.02parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
ccdc223.422e-1624.25coiled-coil domain containing 22 [Source:Xenbase;A... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pth1r1.271e-1824.81parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r1.271e-1824.81parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r1.271e-1824.81parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Vipr13.006e-1724.47vasoactive intestinal peptide receptor 1 [Source:M... [more]
Crhr21.074e-1626.37corticotropin releasing hormone receptor 2 [Source... [more]
back to top
BLAST of Calcitonin receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W4Y2|PDFR_DROME5.462e-3330.75PDF receptor OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q09460|PDFR1_CAEEL1.181e-2528.88Calcitonin receptor-like protein 1 OS=Caenorhabdit... [more]
sp|P25107|PTH1R_DIDVI4.319e-1926.30Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P41593|PTH1R_MOUSE8.890e-1824.81Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P25961|PTH1R_RAT1.458e-1724.81Parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Calcitonin receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J1IHS02.415e-4134.77CLUMA_CG013115, isoform A (Fragment) OS=Clunio mar... [more]
A0A182YG299.154e-3730.87Uncharacterized protein OS=Anopheles stephensi OX=... [more]
A0A182W1004.342e-3630.65Uncharacterized protein OS=Anopheles minimus OX=11... [more]
A0A084VTN41.224e-3530.33AGAP003654-PA-like protein OS=Anopheles sinensis O... [more]
Q7PQE32.278e-3530.75AGAP003654-PA OS=Anopheles gambiae OX=7165 GN=GPRC... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r2.431e-2225.59parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r3.205e-2225.59parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth2ra1.277e-1723.33parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth2ra2.214e-1723.33parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
gcgra6.108e-1523.50glucagon receptor [Source:NCBI gene;Acc:103044520][more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r4.743e-1623.96parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000004243.18.463e-1322.82pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 ... [more]
ENSPMAT00000004899.11.413e-1123.04pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000000542.11.048e-1023.13pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000009048.15.619e-729.87pep scaffold:Pmarinus_7.0:GL476704:23457:33669:1 g... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcitonin receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO500185.781e-829.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcitonin receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r9.156e-1924.36parathyroid hormone 1 receptor [Source:NCBI gene;A... [more]
gcgra6.472e-1824.44glucagon receptor [Source:NCBI gene;Acc:101167871][more]
gcgra4.568e-1724.38glucagon receptor [Source:NCBI gene;Acc:101167871][more]
gcgra4.568e-1724.38glucagon receptor [Source:NCBI gene;Acc:101167871][more]
CRHR21.471e-1626.30corticotropin-releasing factor receptor 2 [Source:... [more]
back to top
BLAST of Calcitonin receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035956.10.000e+099.03SMESG000035956.1[more]
SMESG000066855.12.009e-1226.11SMESG000066855.1[more]
SMESG000066855.11.598e-1124.89SMESG000066855.1[more]
SMESG000066855.16.992e-1126.24SMESG000066855.1[more]
SMESG000006966.17.383e-1124.00SMESG000006966.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014736 ID=SMED30014736|Name=Calcitonin receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1355bp
GATGAATTTAACAATTCAGATTAATTGCCCAGCATTTTACGATTCCTATT
TACTGTGGCCAGAAACTGCACCAAATGAAACTGTTTATCAGAATTGCACA
ATCTCATCAAACCTATTTGAATTCGGAAAAGCCTTTCGTCATTGTCATTT
TAGTGGAAAGTGGACAAATGTTTTCGGAGAGCCTTCTGAAAATATAAATG
GTTCATATACAAATTTTGATGAATGCTTTAAAAGCAAAACGTATAATTTA
CCACCAGAACGAATAAAGACATTAAATGATCTGACAAAACCTTTGTCTTA
CATTGCAATTGGAGGACTGATTTTAGGATCTTTTACATTAACAATGTCAA
TTTTAATTCTTACAAAATTCAAGTATTTAATGAATTACAGAACAAAGATA
CACAAACAATTGTTCATAGCCCTTCTTTTTGAAACCGCCCTACAAATGTC
ACTTCATATAGATCTCCTAAAAGAAGATTCTGACGATTCGTCAAAAGTCA
ACAACAGGAACGATCCAAAAATGAACGGGTTTTCCAATTTAAGAAGTGCA
ATATATGAATATTTTGTAACTTCAGTGTTTTTGTGGATGCTGGTTGAAGG
AGTCCACATTCACAATATCATTGCAGTAAACGTGTTTCACACCCGATATT
GGTTTAACTGCTATTTATTTATGGGATGGATTATTCCAATTCCAATAACT
CTGACCTGGGCAGTCTTGATGTCCGTTCGGTTTTCTTCAACACAAAAGTG
GAAATATATTTATAGCGAAAATTTATACTGGATAATGGCAATCGTGCGAA
TATTTTGCATTTTTATAAATATTGTTTTCCTCATCAATGTAATACGAGTC
CTCGTTCTGAAACTAAGAGCCAACAACTCCTCCGATGTTTGCCAAGCCAA
AACTGCTATAAAAGCAGCAATTTTGCTTATTCCTCTTCTAGGAGTTATAA
ATTTTGTTCAAATGATTAATTTGGACATGCAGTCATTTGGGTACTTAGTT
CTGCTAACTTTACAAGGATTATTACCATCATATCAAGGTTTATTTGTATC
AATAGTTTTTTGTCTAATTAATAAAGACATTCGAAAAGCAGTGATCCGTA
GTTATAACAAATATCGTATGAGAAATAACCTTAATTCTGGATTTCGTTTG
AAGGTTGCAAGATGGGATTCTAAAAACAAGTTGAAATCTAATCAAAATAC
GATGACGTCCACGTTGCTCTCCAATACGGAAACAAAAACGAATATGTTTG
AGCATTCATATTAACAAAATTAATGCAGTTAAAACAATGTTTGTATAATC
TAATATACTTTTATTTTCTGCTTATTTGGTTTTTAACATGTAAAAAACGA
ATGGA
back to top

protein sequence of SMED30014736-orf-1

>SMED30014736-orf-1 ID=SMED30014736-orf-1|Name=SMED30014736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MNLTIQINCPAFYDSYLLWPETAPNETVYQNCTISSNLFEFGKAFRHCHF
SGKWTNVFGEPSENINGSYTNFDECFKSKTYNLPPERIKTLNDLTKPLSY
IAIGGLILGSFTLTMSILILTKFKYLMNYRTKIHKQLFIALLFETALQMS
LHIDLLKEDSDDSSKVNNRNDPKMNGFSNLRSAIYEYFVTSVFLWMLVEG
VHIHNIIAVNVFHTRYWFNCYLFMGWIIPIPITLTWAVLMSVRFSSTQKW
KYIYSENLYWIMAIVRIFCIFINIVFLINVIRVLVLKLRANNSSDVCQAK
TAIKAAILLIPLLGVINFVQMINLDMQSFGYLVLLTLQGLLPSYQGLFVS
IVFCLINKDIRKAVIRSYNKYRMRNNLNSGFRLKVARWDSKNKLKSNQNT
MTSTLLSNTETKTNMFEHSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 126..150
score: 18.85
coord: 296..316
score: 36.64
coord: 212..237
score: 27.84
coord: 329..350
score: 34.13
coord: 174..197
score: 31.99
coord: 254..279
score: 32.66
coord: 94..118
score: 24.54
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 92..343
e-value: 1.9E-40
score: 138.7
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 1..78
e-value: 0.0015
score: 27.8
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 3..69
e-value: 1.5E-8
score: 34.8
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 1..73
score: 12.067
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 80..382
e-value: 5.5E-52
score: 178.6
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 2..394
NoneNo IPR availablePANTHERPTHR45620:SF3PDF RECEPTORcoord: 2..394
NoneNo IPR availableCDDcd152617tmB1_PDFRcoord: 94..362
e-value: 1.2514E-60
score: 196.049
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
NoneNo IPR availableTMHMMTMhelixcoord: 328..350
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 1..77
e-value: 2.5E-9
score: 39.0
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 2..71
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00650G_PROTEIN_RECEP_F2_2coord: 339..354
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 92..351
score: 26.912