LapA_dom domain-containing protein

Overview
NameLapA_dom domain-containing protein
Smed IDSMED30014735
Length (bp)3554
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LapA_dom domain-containing protein (SMED30014735) t-SNE clustered cells

Violin plots show distribution of expression levels for LapA_dom domain-containing protein (SMED30014735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LapA_dom domain-containing protein (SMED30014735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LapA_dom domain-containing protein (SMED30014735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014735SMESG000063585.1 dd_Smed_v4_4923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014735SMESG000063585.1 dd_Smed_v4_4923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014735SMESG000063585.1 dd_Smed_v4_4923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014735SMESG000063585.1 dd_Smed_v4_4923_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014735SMESG000063585.1 dd_Smed_v4_4923_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LapA_dom domain-containing protein vs. TrEMBL
Match: A0A359LHF3 (Uncharacterized protein OS=Coxiellaceae bacterium OX=2026727 GN=DEG23_04860 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.224e-18
Identity = 169/708 (23.87%), Postives = 310/708 (43.79%), Query Frame = 2
Query:  500 EVISLLENNQMD-LKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKRHDNC-SINLNGINFEILYQVKLVLDSTDKY-----QLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLS-------AESKPPQCPMEHIIN---FVNNFYYPIILGRIKSEISQIGE--FDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENXXXXXXXXXXXXXXXXXXXXPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKIL--LKTP---GNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNL-QNSKKSPRNGSENIE------------KNVKKDGELT--LKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRDISDLNSHLKVLQM----SSIIDEASKSATQARNQGLAHNVFAFDKDWLDDQIKNNILPANKHFQAILTIFKKNDCEVSRMSLI--SIALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQC----------NLFELWFQLTIESD-SEELLGMDMFS------FICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHG 2437
            E+  +L+  + D ++ AL +LG +   ++ I+Y+  D  CIRNKY       N      NGINF    + K + D  ++      +++S L+ I+       +DL      +  +   E + I  +  L+       A +K P    E + N        Y  +++  I  E+    E   DF  +EDRYY  R L  +GEL    L  +    +    + FK +  LR++LIH H  + +   ++++  +        F  L+  I +   +E     EL+ + +D        + EK++    K  + P    + E + +  KK    + ++  + I++A   L  LK P   G   D     K   E L  L+N+    Y   L GT L   EG+ K L ++S+++    +ENI+              VK+D EL+   K++  + +++ E +++ +   S ++   ++P++I+H  +VIG+ MR+I    S  K   +    S    EA+++A   R++GL H   + D + +   + ++ILP+ +  +AI  + + +   V + ++I   +  + L L  +  AVD+FRR L+ I   P+  N  C          +   +     I  D  +EL G+D ++       +  L LA      CK    F       +++ + R+A+ KK  +L  V   + G
Sbjct:  531 EIYEILKQFRGDSVEEALDTLGGVGARARLINYDMSDKECIRNKYSTVDAFGNGREPRANGINF---IEFKHLGDLIERKLLKGEEVSSCLEKIK-------SDLATTVNKILFVFFQEREKIAKDSALAKKLEEICAANKQPAGLGEELPNIPKLARLHYDKLVMRSILEELKLFEEAHLDFSRREDRYYWGRILVKVGEL----LHPDELSDSYRLSETFKPITKLRSQLIHAHRMLIS--IDAKYQLEFYRHAKVTFDSLRSIIKQLEKSE-----ELDSKAKD--------ELEKNARIFLKFFDKPEGSSTAEVEQTEQKKDKPTNASSLERCIVRAGIYLEKLKEPKKLGRQAD----KKKGPESLESLDNE----YQVLLKGTSLP--EGYPKKLDKDSEENILRLAENIKKQSKEKKEKSIPATVKQD-ELSNDEKITKLLDKIMKEIDYIREVGASPSIPGNRKPYIIQHAETVIGEYMREIKKEVSSSKTPTLIEKGSVTWGEANRTAIFQRSKGLGHEPLSLDHNVMMQGLHDDILPSYQDHKAIYIVGQNSIRAVPQTAIILNRVGRALLRLCLYKEAVDFFRRALQDIESTPKLSNIGCLRTKIDQYKLDAMGITQPTAIVIDMPKELFGIDSYALAFTHNLMFALLLAGDLEGVCKLARQFF------DKVSLDRLAQYKKTIILGSVMERFGG 1192          
BLAST of LapA_dom domain-containing protein vs. TrEMBL
Match: K1ZLK4 (Uncharacterized protein OS=uncultured bacterium OX=77133 GN=ACD_69C00355G0001 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.439e-18
Identity = 169/708 (23.87%), Postives = 310/708 (43.79%), Query Frame = 2
Query:  500 EVISLLENNQMD-LKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKRHDNC-SINLNGINFEILYQVKLVLDSTDKY-----QLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLS-------AESKPPQCPMEHIIN---FVNNFYYPIILGRIKSEISQIGE--FDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENXXXXXXXXXXXXXXXXXXXXPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKIL--LKTP---GNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNL-QNSKKSPRNGSENIE------------KNVKKDGELT--LKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRDISDLNSHLKVLQM----SSIIDEASKSATQARNQGLAHNVFAFDKDWLDDQIKNNILPANKHFQAILTIFKKNDCEVSRMSLI--SIALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQC----------NLFELWFQLTIESD-SEELLGMDMFS------FICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHG 2437
            E+  +L+  + D ++ AL +LG +   ++ I+Y+  D  CIRNKY       N      NGINF    + K + D  ++      +++S L+ I+       +DL      +  +   E + I  +  L+       A +K P    E + N        Y  +++  I  E+    E   DF  +EDRYY  R L  +GEL    L  +    +    + FK +  LR++LIH H  + +   ++++  +        F  L+  I +   +E     EL+ + +D        + EK++    K  + P    + E + +  KK    + ++  + I++A   L  LK P   G   D     K   E L  L+N+    Y   L GT L   EG+ K L ++S+++    +ENI+              VK+D EL+   K++  + +++ E +++ +   S ++   ++P++I+H  +VIG+ MR+I    S  K   +    S    EA+++A   R++GL H   + D + +   + ++ILP+ +  +AI  + + +   V + ++I   +  + L L  +  AVD+FRR L+ I   P+  N  C          +   +     I  D  +EL G+D ++       +  L LA      CK    F       +++ + R+A+ KK  +L  V   + G
Sbjct:  496 EIYEILKQFRGDSVEEALDTLGGVGARARLINYDMSDKECIRNKYSTVDAFGNGREPRANGINF---IEFKHLGDLIERKLLKGEEVSSCLEKIK-------SDLATTVNKILFVFFQEREKIAKDSALAKKLEEICAANKQPAGLGEELPNIPKLARLHYDKLVMRSILEELKLFEEAHLDFSRREDRYYWGRILVKVGEL----LHPDELSDSYRLSETFKPITKLRSQLIHAHRMLIS--IDAKYQLEFYRHAKVTFDSLRSIIKQLEKSE-----ELDSKAKD--------ELEKNARIFLKFFDKPEGSSTAEVEQTEQKKDKPTNASSLERCIVRAGIYLEKLKEPKKLGRQAD----KKKGPESLESLDNE----YQVLLKGTSLP--EGYPKKLDKDSEENILRLAENIKKQSKEKKEKSIPATVKQD-ELSNDEKITKLLDKIMKEIDYIREVGASPSIPGNRKPYIIQHAETVIGEYMREIKKEVSSSKTPTLIEKGSVTWGEANRTAIFQRSKGLGHEPLSLDHNVMMQGLHDDILPSYQDHKAIYIVGQNSIRAVPQTAIILNRVGRALLRLCLYKEAVDFFRRALQDIESTPKLSNIGCLRTKIDQYKLDAMGITQPTAIVIDMPKELFGIDSYALAFTHNLMFALLLAGDLEGVCKLARQFF------DKVSLDRLAQYKKTIILGSVMERFGG 1157          
BLAST of LapA_dom domain-containing protein vs. TrEMBL
Match: A0A1Q3WBE3 (Uncharacterized protein OS=Candidatus Amoebophilus sp. 36-38 OX=1895716 GN=BGO68_04080 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.752e-14
Identity = 68/231 (29.44%), Postives = 119/231 (51.52%), Query Frame = 2
Query:  473 DIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKIHYNDK---DSNCIRNKYGYFKR-----HDNCSINLNGINFEILYQVKLVLDSTDKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYP----IILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKMLR 1129
            D+ +L  + ++I+ LE ++++L+ AL+ +G + GG  +I  ND    +   IRN+YGYF R      DN   N+NGI FE L+Q  ++L+ TD +++        ++ +GL  DL  +   + +IL  E + ++ ++ L    +P   P   ++N +    Y         +IK E+S++   D  ++E RY  ARK  I GEL  E L++    +    K  F+ L + R
Sbjct:  491 DLHKLYSIYQIINSLEKDEINLRDALLDIGQLCGGRYRIFRNDTHDPEKFYIRNRYGYFSRGRKNQEDN---NINGIFFERLHQFSVILNITD-FEIPF------EKEEGLRIDLKSLQHKIVYILHQEQEYLENKEILDIVGEPTLVPEGILLNTLPQLAYEQYEDKAFEKIKIELSRLNISDLDTREGRYIFARKFLIAGELCSELLEDEELSKIKYSKNFFEFLDLCR 711          
BLAST of LapA_dom domain-containing protein vs. TrEMBL
Match: A0A378KRE1 (Uncharacterized protein OS=Legionella quateirensis OX=45072 GN=NCTC12376_00939 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.240e-8
Identity = 61/205 (29.76%), Postives = 95/205 (46.34%), Query Frame = 2
Query:  563 DISGGSKKIHYNDKDSNC---IRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDST-DKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYPIILGRIKSEISQIG--EFDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKMLRNKLIHYHSKI 1159
            +IS  +K I YNDK  +    IRNKYG   RHDN     NG+    L  +  ++ +  DK  +  GL+ +++       D   +   +  IL+ E  +      L+     P     H+I  V   Y    + RI S ++ +   + D+++KE RYYL R L  IGEL++E +D    +       VF   K +R+KL H H  +
Sbjct:  149 EISRLAKSISYNDKGEHAHHYIRNKYGNINRHDNAKRRPNGLELTYLSALDQIISTEFDKLTIRQGLQDLKN-------DFRNIKNKIRSILNAERNNKSPGSILAGFKISP-----HLIALVQYTYSQKHIHRISSLLNDLHSLDLDYENKEHRYYLGRVLARIGELSKELID---FLNFGKDSGVFTFFKKIRDKLAHEHQSM 338          
BLAST of LapA_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000063585.1 (SMESG000063585.1)

HSP 1 Score: 2010.73 bits (5208), Expect = 0.000e+0
Identity = 1044/1052 (99.24%), Postives = 1047/1052 (99.52%), Query Frame = 2
Query:  140 MSDILASVTELKIIDNLPDPESTSFQTIHFTQIKLNPTSKSIPYEMNRQILDARASFIQLHGTIENKSNLSLEDQTLDMLDSIPQEEPNEGHSFEHERKELQNQNEEIRKLDIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDSTDKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENXXXXXXXXXXXXXXXXXXXXPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKTPGNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENIEKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRDISDLNSHLKVLQMSSIIDEASKSATQARNQGLAHNVFAFDKDWLDDQIKNNILPANKHFQAILTIFKKNDCEVSRMSLISIALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQCNLFELWFQLTIESDSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHGLVHCLLIKGMNRKCISLLNEIIPITNFPIFEVHLAWAYHNENDYLQAYQIIKKHYPFDFKPLERYMVFYRYSRILAYQPNKKESIEESYKCIDEMEKIFRENAREFKERYDDEFIMMKSHXXXXXXXXXXEECCLVQDTXXXXXXXXXXXXIFVEKFYSIIRFIKHEFSEDVRIASMEFWFCRAYSSLINXXXXXXXXXXXXLENAQMFYDRARIRLNSYRKSGRMSVSSVKEMIKTTDYLANGYIKFATRSDLNLSQQEMYKSKAIPYLSMVKQYMDYYNKLPKL 3295
            MSDILASVTELKIIDNLPDPESTSFQTIHFTQIKLNPTSKSIPYEMNRQILDARASFIQ HGTIENKSNLSLEDQTLDMLDSIPQEEPNEGHSFEHERKELQNQNEEIRKLDIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDST+KYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNN TIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENIIFKSDSEKSSSEKNKIDENPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKTPGNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENIEKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMR ISDLNSHLKVLQMSSIIDEASKSATQARNQGLAHNVFAFDKDWLD+QIKNNILPANKHFQAILTIFKKNDCEVSRMSLIS+ALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQCNLFELWFQLTIESDSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHGLVHCLLIKGMNRKCISLLNEIIPITNFPIFEVHLAWAYHNENDYLQAYQIIKK YPFDFKPLERYMVFYRYSRILAYQPNKKESIEESYKCIDEMEKIFRENAREFKERYDDEFIMMKSHLVRLRVQLLVEECCLVQDTEENY KLLENLEIFVEKFYSIIRFIKHEFSEDVRIASMEFWFCRAYSSLINKKIKEVSWEKKKLENAQMFYDRARIRLNSYRKSGRMSVSSVKEMIKTTDYLANGYIKFATRSDLNLSQQEMYKSKAIPYLSMVKQYMDYYNKLPKL
Sbjct:    1 MSDILASVTELKIIDNLPDPESTSFQTIHFTQIKLNPTSKSIPYEMNRQILDARASFIQSHGTIENKSNLSLEDQTLDMLDSIPQEEPNEGHSFEHERKELQNQNEEIRKLDIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDSTNKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNNFTIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENIIFKSDSEKSSSEKNKIDENPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKTPGNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENIEKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRHISDLNSHLKVLQMSSIIDEASKSATQARNQGLAHNVFAFDKDWLDEQIKNNILPANKHFQAILTIFKKNDCEVSRMSLISLALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQCNLFELWFQLTIESDSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHGLVHCLLIKGMNRKCISLLNEIIPITNFPIFEVHLAWAYHNENDYLQAYQIIKKLYPFDFKPLERYMVFYRYSRILAYQPNKKESIEESYKCIDEMEKIFRENAREFKERYDDEFIMMKSHLVRLRVQLLVEECCLVQDTEENYIKLLENLEIFVEKFYSIIRFIKHEFSEDVRIASMEFWFCRAYSSLINKKIKEVSWEKKKLENAQMFYDRARIRLNSYRKSGRMSVSSVKEMIKTTDYLANGYIKFATRSDLNLSQQEMYKSKAIPYLSMVKQYMDYYNKLPKL 1052          
BLAST of LapA_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000076790.1 (SMESG000076790.1)

HSP 1 Score: 154.836 bits (390), Expect = 8.441e-44
Identity = 72/106 (67.92%), Postives = 86/106 (81.13%), Query Frame = 2
Query: 2465 MNRKCISLLNEIIPITNFPIFEVHLAWAYHNENDYLQAYQIIKKHYPFDFKPLERYMVFYRYSRILAYQPNKKESIEESYKCIDEMEKIFRENAREFKERYDDEFI 2782
            MNRKCISLLNEIIPITNF   ++ LAWAY+ EN+Y Q YQIIKKH PF F+PL+RY   YRY RIL YQPNKKE+I ESY+CI+ ME +F+EN+  FKE+Y+D FI
Sbjct:    1 MNRKCISLLNEIIPITNFSFLDMQLAWAYYFENEYSQVYQIIKKHVPFTFEPLKRYTALYRYCRILEYQPNKKETILESYECINTMEILFQENSSVFKEQYNDGFI 106          
BLAST of LapA_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000019226.1 (SMESG000019226.1)

HSP 1 Score: 123.635 bits (309), Expect = 3.861e-28
Identity = 122/431 (28.31%), Postives = 216/431 (50.12%), Query Frame = 2
Query:  446 NQNEEIRKLDIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKIHYNDKD---SNCIRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDSTDKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQC-PMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNNS-TIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENXXXXXXXXXXXXXXXXXXXXPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKTPGNTTDISELDKL---YQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENIEKNVKKDGELTLK 1714
            NQ  E+   DI  + EM+  I    NN++DL+  LI +G++S   ++I YNDK+   S  IRNKYG+ +R+ N   N+NGI FE ++Q+K++      Y   SG+   E +  G     L++  +   ++   N+SI        ES P     +++I+   + +Y  II   I+  I  I   +F  KEDRY++AR LT+IG+L  E+L++ S  I+ +     F++L  +RN  +H+H+KI     N      +N+ I+ I   L+  I +G         ++N + ++ EN        +S+       +   KP+S+  K S   K N K+      +I ++ KI+ +    T D S+L KL   YQ  +++L+     +YP  L  +  N ++ F+ +++ + K  ++      K + K+ ++ +K
Sbjct:  206 NQTNELVSNDIDIIYEMKCSIINFLNNKLDLQNCLIEIGNLS---EQISYNDKNDPQSKSIRNKYGFIQRNKNKQKNINGIYFEKIFQLKIICSDDIVY---SGIAQHEKDKLGRDLINLKILLNKLLLIENRNESIN-----ELESIPDGLFFIDNIVEIASKYYDIIIFREIRKTIKNIDNINFSIKEDRYFIARILTVIGQLLNEYLESKSINIKTNKLFIGFQDLMNIRNLTVHFHAKIKTFADNENQLSILNDSIINIRHHLENIITEG--------FQINSQYDNSEN------FIESTKIILNYLKFKSKPNSIVEKNSELIKINIKN------LISKSVKIIERMGSKTKDDSQLMKLNNEYQNLINQLDAQDKSDYPELLSISNKNILKEFINSMEKNMKGNKSEKAKKVKPIAKNNKVEMK 605          

HSP 2 Score: 98.2117 bits (243), Expect = 2.603e-20
Identity = 108/476 (22.69%), Postives = 216/476 (45.38%), Query Frame = 2
Query: 1400 KVSSAKKSNNKDKTAAIK-MIIQAHKILLKTPGNTTDI----SELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENIEKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRDISDLN-SHLKVLQM------------SSIIDEASKSATQARNQGLAHNVFAFDKDWLDDQIKNNILPANKHFQAILTIFKKNDCEVSRMSLISIALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQCNLFELWFQLTIESDSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAKLKKESLLYYVNFLYHGLVHCLLIKGMNRKCISLLNEIIPITNFPIFEVHLAWAYHNENDYLQAYQIIKKHYPFDFKPLERYMVFYRYSRILAYQPNKKESIEESY----KCIDEMEKIFRENAREFKE 2761
            KV    K+N  +  + I  ++ +++KI+     N+ +I    + +++ Y+  +++LE    D YP  +   Y N      KN+      P+  S               KL  ++K++  E  +L  +E +  L  +K+ ++ EHI+ VIGQI+RD+ +L   + + L +            S I+ EA +SA ++RN+GLAHN+++FD   L   I N++LPA+ + + +  I +     +S  S  ++ + F ++G +  A++Y ++ L  ++      +               SD   + GM+ F F     LA  Y    +Y      LE L  ++  +     + + +   V+ +Y  + +  +++   RK I + ++ I I++      +LA A   +    +A +I++     +   ++  M    +   +A+    +  IE+ +    KC++EMEK    N   +KE
Sbjct:  592 KVKPIAKNNKVEMKSVIDDLLWKSYKIVSNNQINSNEIDKQLAPINQHYRSRINQLELSDRDFYPDEIN--YAN------KNIIIKYNEPKIRS---------------KLLTSIKEINDEMSYLESTENNVELIEIKKMYICEHIVLVIGQIVRDLLNLGLCNYQSLNLPDEKWFVSRCISSEILSEAGRSARRSRNEGLAHNIWSFDSFKLWKIIINDLLPASNYLEKLFYINESETLPLSVYSSFTLGILFTDIGLYKRAIEYLQKALDLLNAVSTISDTS-------------SDYSSVCGMNQFLFQINANLAHVYRLNGQYQNATEILEFLLSKINYQEAILCENKIIKKEVSHVYVDICYLHILQLNYRKVIEICDQTILISDDLEIGYYLAIALWEDRQINRAIEIMENLKECNGDTIKSVM----FIETIAFMCLDRLEIEKYFHLAVKCVEEMEKRMENNIMYYKE 1027          
BLAST of LapA_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000073364.1 (SMESG000073364.1)

HSP 1 Score: 117.087 bits (292), Expect = 4.392e-26
Identity = 172/694 (24.78%), Postives = 322/694 (46.40%), Query Frame = 2
Query:  422 EHERKELQNQNEEIRKLDIIRLKEMQEVISLLE-----NNQMDLKTALISLGDISGGSKKIHYNDKDSNCIRNKYGYFKR---HDNCSINLNGINFEILYQVKLVLDSTDKYQLASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQCPMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTIIGELAREFLDNNSTIQNDNCKKVFKNLKM---LRNKLIHYHSKISNGISNSEHSKDVNERILRIFVGLKE-CIDKGPLTENAKYVELNKEIEDWENXXXXXXXXXXXXXXXXXXXXPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKTPGNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQNSKKSPRNGSENI-EKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLNRLKRPFVIEHIISVIGQIMRDISDLNSHLKVLQMSSIIDEASKSATQARNQGLAHNVFAFDKDWLDDQIKNNILPANKH--FQAILTIFKKNDCEVSRMSLISIALSFLNLGFFDSAVDYFRRTLKFIS---ENPENKNQQC--NLFELWFQLTIESDSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAK----LKKESLLYYVNFLY 2431
            +H+  +L+  N+ IRK+ +I + + +++  L +     +N++DLK+ L+ +G +    ++I  N+ D N IR K+G+ KR   H+N     N INF+   Q+K  +++       S L  IE+    L   +L + K    +   EN+ I+   ++ + ++         ++ V+ +    ++ +IK+E++     ++ + EDRY   R LTIIG L+ + LD++          VF +LK+   +RNK+IH H KI     NS++    NE+I  IF  +K+  +D+G   EN       K + ++                        K D+   K +S K  + KDK      I +AHK++ + P    D+ +LD+ YQ  L  L       +P  L    +N +E ++K      K   + +EN+  +N+ K   +  K+SD   ++    ++L Q + SN++   K+ ++I HII V+ Q +RD+SD++                 S+ +  ++ +      FD ++    IK  I   N++     + T+     C +  + L ++ +SF  L  +DSA++Y     + I+   EN  + +Q    NL +   Q    +    +LG+D +  + +  LA+    A K D    E   + + +Q+K        LK E + +Y+++ Y
Sbjct:  182 KHQPSDLEISNQLIRKVKVIDMDKQEDIKILKKILKLISNRIDLKSTLLEIGKLC---EEISLNENDENSIRMKFGFSKRLADHENN----NRINFDKFCQLKAYIENESSLLSQSDLGKIENYLSSLKKKILFILKE-NLVFVNENEIIR---EIESLNEIDLLESNEFVSIVDRYQSEFVVSKIKTELNMTRGINYNNVEDRYVFFRVLTIIGNLSNQ-LDHS----------VFPSLKLCFKIRNKIIHCHKKIK---ENSKNDTLNNEKIHAIFNCIKQYLVDRG---ENTDLCTKLKSLFNY----------------------IKKRDNKPIKETSLKNIDYKDKLD--DFIRKAHKLIKRNPN--EDLRKLDESYQLQLGSLNIKDKRRFPENLINK-INILE-YIKKF--PIKQNFDITENLLNQNILKRNIINYKISDIKNEI----DYLKQIQLSNSITTDKKSYIIGHIICVVTQYVRDLSDIDI----------------SSFELPSKWVKPTYIPFDAEF----IKICISETNEYQSIDYLYTLPHIEYCPIIALLLFNVGVSFAKLSLYDSAIEYLEMASENINVFIENSIHSDQTIIRNLGQ--HQKVTNNFYLAVLGIDPYELLIKRTLAKVLHLANKNDYSLKEFNDVHQTIQLKNFYLADKFLKIEIIKFYIDYSY 791          
The following BLAST results are available for this feature:
BLAST of LapA_dom domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A359LHF36.224e-1823.87Uncharacterized protein OS=Coxiellaceae bacterium ... [more]
K1ZLK46.439e-1823.87Uncharacterized protein OS=uncultured bacterium OX... [more]
A0A1Q3WBE32.752e-1429.44Uncharacterized protein OS=Candidatus Amoebophilus... [more]
A0A378KRE14.240e-829.76Uncharacterized protein OS=Legionella quateirensis... [more]
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LapA_dom domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000063585.10.000e+099.24SMESG000063585.1[more]
SMESG000076790.18.441e-4467.92SMESG000076790.1[more]
SMESG000019226.13.861e-2828.31SMESG000019226.1[more]
SMESG000073364.14.392e-2624.78SMESG000073364.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014735 ID=SMED30014735|Name=LapA_dom domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3554bp
CTTCAATTTGATTGGCGCTTTGATTTATTATTGATTTACGGAATTTATTT
GACAATCCAATTTCTGCCTCAAAGAAACCTTTCAATAAAAATAATTATAA
CTAATTTCCCAATAAGAGGAACTGTGATTACCCAAGAATATGTCAGATAT
TTTAGCTTCTGTGACGGAATTGAAGATTATAGACAACCTTCCGGATCCTG
AGAGTACGAGCTTTCAAACAATTCATTTTACCCAAATTAAACTAAACCCA
ACAAGCAAATCTATTCCGTATGAAATGAATCGACAAATTCTCGATGCTCG
GGCATCCTTTATTCAGTTGCATGGAACTATTGAGAATAAATCCAATCTCT
CTTTGGAAGACCAAACTCTAGATATGCTGGATTCCATTCCACAAGAAGAA
CCTAATGAGGGGCATTCGTTTGAGCACGAAAGGAAAGAGTTACAAAACCA
GAATGAAGAAATAAGAAAACTGGACATTATTCGTTTAAAAGAAATGCAAG
AAGTTATAAGTTTGTTAGAAAACAATCAAATGGATTTGAAAACCGCCTTA
ATTAGCCTGGGTGACATTTCAGGGGGGAGTAAGAAAATCCATTACAACGA
TAAGGATAGCAATTGTATTCGGAACAAATACGGCTACTTTAAACGCCATG
ATAATTGCTCCATAAATCTAAACGGGATAAATTTTGAAATCCTTTATCAA
GTGAAACTTGTGCTTGACTCAACAGACAAATATCAACTTGCTTCAGGTTT
GAAATACATTGAGGATGAATCCAAAGGCTTACTGGCTGATTTGTTGCAGG
TTGGGAAGTCATTAACTCACATATTATCAATAGAAAACCAATCTATTCAA
GGAGAAGATAAATTATCAGCTGAATCGAAACCTCCTCAATGTCCAATGGA
ACATATAATTAATTTTGTTAACAACTTTTACTATCCAATCATCCTTGGGC
GAATAAAATCTGAAATCTCACAGATTGGCGAGTTCGATTTCAAATCGAAA
GAAGATCGGTATTATCTCGCCCGAAAACTGACGATAATTGGGGAACTGGC
TCGAGAATTCCTTGACAATAATTCCACAATTCAAAACGATAATTGTAAAA
AGGTCTTCAAAAACCTGAAAATGTTAAGAAATAAGCTCATCCATTACCAT
TCGAAAATATCAAATGGTATTTCAAACAGCGAACATTCAAAAGATGTTAA
TGAAAGAATCTTACGCATTTTTGTGGGTTTAAAAGAATGCATAGACAAAG
GCCCATTGACAGAAAACGCTAAATATGTTGAATTGAATAAAGAAATTGAA
GATTGGGAAAATATAATTTTTAAATCAGATTCGGAAAAGTCTTCAAGTGA
AAAAAATAAAATAGACGAAAACCCTCCTAAGCCCGATTCATTGGAAACGA
AAGTAAGTTCAGCCAAGAAAAGTAATAATAAAGATAAGACTGCCGCTATA
AAAATGATAATTCAAGCCCATAAAATATTATTAAAAACTCCAGGTAATAC
GACGGATATAAGCGAATTGGATAAATTATATCAAGAGCATCTTTCAAAAT
TAGAAAATGACCCCTCTGATAACTACCCTCCACGATTAGGTGGTACTTAC
TTGAATGCAATTGAAGGATTTGTGAAAAACCTCCAGAACTCCAAGAAATC
CCCTAGAAATGGTTCTGAGAACATTGAGAAAAATGTAAAGAAAGACGGCG
AATTGACTTTGAAACTGAGTGACACGATGAAACAGCTAGTCATAGAAAGC
GAATTTTTGGTTCAAAGCGAAAAGTCAAATAATTTGAACCGCTTAAAACG
ACCATTTGTCATTGAACATATCATATCGGTTATCGGTCAGATCATGCGAG
ACATTTCAGACCTTAATTCGCATCTGAAGGTGTTGCAAATGTCGAGTATC
ATTGATGAGGCCAGCAAGTCTGCTACTCAGGCCAGAAATCAAGGATTAGC
TCATAATGTTTTTGCATTTGACAAAGATTGGTTAGATGACCAAATAAAAA
ATAATATTCTACCGGCAAACAAACACTTTCAAGCGATTTTAACCATATTT
AAGAAAAATGATTGCGAAGTTTCTCGCATGTCTTTGATCAGTATAGCTTT
GTCTTTTCTAAATTTAGGCTTCTTTGATAGTGCTGTCGATTATTTTCGAA
GAACCCTTAAATTCATTTCCGAGAATCCTGAAAATAAAAATCAACAATGC
AATTTATTTGAGCTTTGGTTTCAATTGACTATCGAAAGTGATTCTGAAGA
GCTCTTGGGAATGGATATGTTCAGTTTTATATGTCGACTGTTTTTGGCGA
GAACTTATGTACAAGCTTGTAAATACGACGAGATGTTCGCGGAATTAGAA
ATACTAAAAGAGCGAATGCAAATTAAGAGAATTGCAAAGTTGAAAAAGGA
ATCCCTTTTATACTATGTGAATTTTCTATATCATGGCCTGGTTCATTGCT
TATTAATAAAAGGGATGAATAGGAAATGTATTTCATTACTAAATGAAATC
ATTCCCATCACCAATTTTCCAATTTTTGAGGTGCATCTAGCTTGGGCGTA
TCATAATGAGAATGATTATTTACAAGCCTATCAGATAATAAAAAAGCACT
ACCCATTTGACTTCAAACCATTAGAGAGATATATGGTATTTTACCGATAC
AGCCGAATCCTTGCATATCAACCCAATAAGAAGGAATCCATTGAAGAGTC
TTATAAATGTATAGATGAAATGGAAAAGATTTTTCGAGAAAATGCTCGAG
AATTCAAAGAAAGGTATGATGATGAATTCATCATGATGAAGTCTCACTTG
GTTAGGTTGAGAGTTCAATTACTGGTCGAAGAGTGTTGTCTGGTGCAAGA
CACAGAGGAAAATTATAATAAACTTCTGGAAAATTTAGAAATATTTGTGG
AAAAATTTTATTCCATTATTCGATTCATTAAACATGAGTTTAGTGAAGAT
GTGAGAATCGCTAGTATGGAGTTTTGGTTCTGTCGGGCATATTCGTCTCT
GATTAACAAAAAGATCAAAGAGGTTAGTTGGGAGAAAAAGAAACTGGAAA
ATGCCCAAATGTTTTACGATCGGGCCAGGATTCGGTTAAATTCTTATCGA
AAATCCGGTCGAATGTCAGTTTCAAGTGTAAAGGAGATGATTAAAACTAC
AGATTATCTAGCAAATGGTTACATAAAATTTGCAACAAGATCGGATTTGA
ATCTGTCACAACAAGAAATGTATAAAAGCAAAGCCATCCCATATCTGTCC
ATGGTAAAGCAGTACATGGACTATTATAACAAACTACCGAAGCTATAAAA
CTGCAGAAATTCATACGTAGATGTTTACTTTTCTATTTCATCAACTTTTT
GATTCTTTTGGACCTTGAATTAGTTTCTTTTGTTTTAATGAGGGAATTAA
CAAAATTAATTGCTATCATTAATTTGAATTCATTTAAAAAAATTGATATC
ATTTTTATGGAGATTTTATATTTAACACTTGGAAAACTGATGTAAAAATC
GTACATTATTTTATTGCAATGAAGTCCGTTAAAATATTTATCAAATAATA
ATTT
back to top

protein sequence of SMED30014735-orf-1

>SMED30014735-orf-1 ID=SMED30014735-orf-1|Name=SMED30014735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1053bp
MSDILASVTELKIIDNLPDPESTSFQTIHFTQIKLNPTSKSIPYEMNRQI
LDARASFIQLHGTIENKSNLSLEDQTLDMLDSIPQEEPNEGHSFEHERKE
LQNQNEEIRKLDIIRLKEMQEVISLLENNQMDLKTALISLGDISGGSKKI
HYNDKDSNCIRNKYGYFKRHDNCSINLNGINFEILYQVKLVLDSTDKYQL
ASGLKYIEDESKGLLADLLQVGKSLTHILSIENQSIQGEDKLSAESKPPQ
CPMEHIINFVNNFYYPIILGRIKSEISQIGEFDFKSKEDRYYLARKLTII
GELAREFLDNNSTIQNDNCKKVFKNLKMLRNKLIHYHSKISNGISNSEHS
KDVNERILRIFVGLKECIDKGPLTENAKYVELNKEIEDWENIIFKSDSEK
SSSEKNKIDENPPKPDSLETKVSSAKKSNNKDKTAAIKMIIQAHKILLKT
PGNTTDISELDKLYQEHLSKLENDPSDNYPPRLGGTYLNAIEGFVKNLQN
SKKSPRNGSENIEKNVKKDGELTLKLSDTMKQLVIESEFLVQSEKSNNLN
RLKRPFVIEHIISVIGQIMRDISDLNSHLKVLQMSSIIDEASKSATQARN
QGLAHNVFAFDKDWLDDQIKNNILPANKHFQAILTIFKKNDCEVSRMSLI
SIALSFLNLGFFDSAVDYFRRTLKFISENPENKNQQCNLFELWFQLTIES
DSEELLGMDMFSFICRLFLARTYVQACKYDEMFAELEILKERMQIKRIAK
LKKESLLYYVNFLYHGLVHCLLIKGMNRKCISLLNEIIPITNFPIFEVHL
AWAYHNENDYLQAYQIIKKHYPFDFKPLERYMVFYRYSRILAYQPNKKES
IEESYKCIDEMEKIFRENAREFKERYDDEFIMMKSHLVRLRVQLLVEECC
LVQDTEENYNKLLENLEIFVEKFYSIIRFIKHEFSEDVRIASMEFWFCRA
YSSLINKKIKEVSWEKKKLENAQMFYDRARIRLNSYRKSGRMSVSSVKEM
IKTTDYLANGYIKFATRSDLNLSQQEMYKSKAIPYLSMVKQYMDYYNKLP
KL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 116..136
NoneNo IPR availableCOILSCoilCoilcoord: 91..114
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 400..430
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 560..885
e-value: 2.6E-7
score: 31.8
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 626..866