Phosphatidylinositol transfer protein

Overview
NamePhosphatidylinositol transfer protein
Smed IDSMED30014734
Length (bp)1719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol transfer protein (SMED30014734) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol transfer protein (SMED30014734) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol transfer protein (SMED30014734) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol transfer protein (SMED30014734) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014734

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014734SMESG000062807.1 SmedASXL_008678SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014734SMESG000062807.1 dd_Smed_v4_7956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014734SMESG000062807.1 dd_Smed_v6_7956_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014734SMESG000062807.1 OX_Smed_1.0.08159ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014734SMESG000062807.1 dd_Smed_v4_7956_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 303.523 bits (776), Expect = 4.080e-99
Identity = 153/285 (53.68%), Postives = 198/285 (69.47%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTIL+N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W +    +   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E+ T++EL+  R RG VRGT A +
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTILQN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 301.212 bits (770), Expect = 2.442e-98
Identity = 152/285 (53.33%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W +    +   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E+ T++EL+  R RG VRGT A +
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Match: PITPNB (phosphatidylinositol transfer protein beta [Source:HGNC Symbol;Acc:HGNC:9002])

HSP 1 Score: 299.671 bits (766), Expect = 1.094e-97
Identity = 151/283 (53.36%), Postives = 198/283 (69.96%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W +    +   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E+ T++EL+  R++G+VRGT A
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRNQGQVRGTSA 268          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Match: PITPNA (phosphatidylinositol transfer protein alpha [Source:HGNC Symbol;Acc:HGNC:9001])

HSP 1 Score: 296.975 bits (759), Expect = 1.094e-96
Identity = 150/285 (52.63%), Postives = 195/285 (68.42%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++ +                KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT+L N  YM + F IKIE+ H  +    EN+H+L  E     E VYIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVLPN-EYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Match: PITPNA (phosphatidylinositol transfer protein alpha [Source:HGNC Symbol;Acc:HGNC:9001])

HSP 1 Score: 296.204 bits (757), Expect = 2.376e-96
Identity = 149/285 (52.28%), Postives = 195/285 (68.42%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++ +                KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +    EN+H+L  E     E VYIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Celegans
Match: Y54F10AR.1 (pep chromosome:WBcel235:III:2572031:2575723:-1 gene:WBGene00021854.1 transcript:Y54F10AR.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10AR.1)

HSP 1 Score: 322.783 bits (826), Expect = 4.178e-107
Identity = 152/277 (54.87%), Postives = 203/277 (73.29%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDP--VDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRG 844
            MIIKE+R++LPM+VEEY + QLWSVAE SK ETGGGEG+EV+KNEPFD+       PL   + Q+ KGQ+T+KIY+L+ KVP  +R +APK SL I E AWNAYPYC+T++ NP+YM + F++KIE++H+ ++   EN H L  + LA+REVV I+IAND   +++ D   +S P  FQS KTGRGPL G   W+++  P+MCAYKLVT  FKW+G Q  VEN    Q  R+F  FHR++FCW+DKWHGLTM  +R++E   ++EL+EQR  G+VRG
Sbjct:    1 MIIKEYRVVLPMSVEEYQVGQLWSVAEASKAETGGGEGVEVLKNEPFDN------VPLL--NGQFTKGQYTHKIYHLQSKVPAILRKIAPKGSLAIHEEAWNAYPYCKTVVTNPDYMKENFYVKIETIHLPDNGTTENAHGLKGDELAKREVVNINIANDHEYLNSGDLHPDSTPSKFQSTKTGRGPLSGN--WKDSVQPVMCAYKLVTVYFKWFGFQKIVENYAHTQYPRLFSKFHREVFCWIDKWHGLTMVDIREIEAKAQKELEEQRKSGQVRG 267          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Celegans
Match: Y71G12B.17 (pep chromosome:WBcel235:I:1667501:1669792:1 gene:WBGene00022155.1 transcript:Y71G12B.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71G12B.17)

HSP 1 Score: 211.846 bits (538), Expect = 2.732e-64
Identity = 114/281 (40.57%), Postives = 164/281 (58.36%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIA-NDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            MI+KE+RI LP+TV+E+    L++V+  S+NETGGGEG+E +  E F S T  P         Q   G +T KIY L  K P  ++ L P  +  I E +WNAYPYC+T+L NP YM D F   IE++H+ ++   EN  +  +    +RE+V+IDIA ND     +Y +E D +LF+++   RGPL   + W +   P+MC YKLV+C FKW GLQ  VE  +  Q  R+F   HR  +  +D W  ++M  +R+ E AT   L +Q +  E RGT  ++
Sbjct:    1 MIVKEYRIPLPLTVDEFERGLLYAVSACSRNETGGGEGVEFLVQEDFTSNTLRP--------GQTVSGTYTKKIYRLRSKAPWVLQKLLPPEAFVIYEESWNAYPYCKTVLTNPGYMKDNFHQIIETIHLDDNGSSENPLDGPE----KREIVFIDIADNDIFGTKNYEKEKDARLFEAETVERGPLD--EDWIDEHDPVMCCYKLVSCHFKWTGLQRMVEKTVHKQYPRVFGLMHRDAYVLLDNWFNMSMESIREYERATGDILRKQLAEPEKRGTKCDD 267          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Celegans
Match: pitp-1 (PhosphatidylInositol Transfer Protein family [Source:UniProtKB/TrEMBL;Acc:G5EED9])

HSP 1 Score: 201.06 bits (510), Expect = 5.235e-55
Identity = 107/277 (38.63%), Postives = 165/277 (59.57%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGE-GIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE---NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEER-IFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGE 835
            M+IKE+RI+LPMTV+EY IAQL+ + + S+ ++ G + G+E++ N+P+   T+ P             GQ+T+KIY++  ++P +IR + P N+LE  E +WNAYP  +T    P  M D+F +++E+++  +  Q EN+  L+++  + R + Y+D   DP+ + DY  E DPKL++S+ T RGP L   W        LPIMCAYKL   +F++WG+QTR E  I +   R      HRQ + W D+W GLTM  +R+LE      L +  S  E
Sbjct:    1 MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDSHGQDSGVEIISNKPY---TDGPG----------GSGQYTFKIYHIGSRIPAWIRTVLPTNALEAHEESWNAYPVTKTRYSTP--MMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVKDPISSHDYCAEEDPKLYRSETTNRGP-LNDDWVAEHLKKGLPIMCAYKLCKVEFRYWGMQTRAERWIHDLALRNTMMRAHRQAWAWQDEWTGLTMNDIRKLEAEAALHLSKVMSVKE 261          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0083745)

HSP 1 Score: 341.658 bits (875), Expect = 2.294e-114
Identity = 164/279 (58.78%), Postives = 205/279 (73.48%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMAN 856
            M IKEFR+ LP+TVEEY +AQL+SVAE SK  TGGGEGIEV+KNEPF+      + PL     +YN GQ+TYKIY+L+ KVP +IR LAPK SLEI E AWNAYPYCRTI+ NP +M D F I I+++HV +    EN+HEL+ + L  RE+V+IDIANDPV   DY  + DP  +QS+KTGRGPL+G  W ++   P+M  YKLVTC+FKW+GLQTRVEN I   E R+F NFHRQ+FC  D+W+GLTM  +R +E+ TK ELD+ R  GEVRG  A+
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLL--GGKYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTLHVGDAGDSENVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVN-PVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRGMRAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0344554)

HSP 1 Score: 341.658 bits (875), Expect = 2.294e-114
Identity = 164/279 (58.78%), Postives = 205/279 (73.48%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMAN 856
            M IKEFR+ LP+TVEEY +AQL+SVAE SK  TGGGEGIEV+KNEPF+      + PL     +YN GQ+TYKIY+L+ KVP +IR LAPK SLEI E AWNAYPYCRTI+ NP +M D F I I+++HV +    EN+HEL+ + L  RE+V+IDIANDPV   DY  + DP  +QS+KTGRGPL+G  W ++   P+M  YKLVTC+FKW+GLQTRVEN I   E R+F NFHRQ+FC  D+W+GLTM  +R +E+ TK ELD+ R  GEVRG  A+
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLL--GGKYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTLHVGDAGDSENVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVN-PVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRGMRAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Match: vib (gene:FBgn0267975 transcript:FBtr0310064)

HSP 1 Score: 340.502 bits (872), Expect = 6.712e-114
Identity = 165/280 (58.93%), Postives = 205/280 (73.21%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDY-QIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMAN 856
            M IKEFR+ LP+TVEEY +AQL+SVAE SK  TGGGEGIEV+KNEPF+      + PL     +YN GQ+TYKIY+L+ KVP +IR LAPK SLEI E AWNAYPYCRTI+ NP YM   F I I S H++ND   ++N+HEL+ + L  RE+V+IDIANDPV   DY  + DP  +QS+KTGRGPL+G  W ++   P+M  YKLVTC+FKW+GLQTRVEN I   E R+F NFHRQ+FC  D+W+GLTM  +R +E+ TK ELD+ R  GEVRG  A+
Sbjct:    1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFE------DFPLL--GGKYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVDNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVN-PVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKARQVGEVRGMRAD 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0331716)

HSP 1 Score: 193.741 bits (491), Expect = 3.255e-52
Identity = 113/286 (39.51%), Postives = 164/286 (57.34%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGG-GEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLL------------GLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEER-IFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGE 835
            M+IKE+RI LP+TVEEY IAQL+ +A+ S+ E+ G G G+E++ NEP+            KD    N GQ+T KIY++   +P +I+ L PK++L + E AWNAYPY RT    P    +KF + IE+ +  ++   +N+ +LS   L  R V  IDI  D +   DYV+E DPK F S KTGRGPL             G K      + +M AYK+   +F++WG+QT++E  I +   R +    HRQ + W D+W GLT+  +R+LE  T+  L ++   GE
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPY------------KDGPGGN-GQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCP--FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0340289)

HSP 1 Score: 193.741 bits (491), Expect = 3.297e-52
Identity = 113/286 (39.51%), Postives = 164/286 (57.34%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGG-GEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLL------------GLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEER-IFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGE 835
            M+IKE+RI LP+TVEEY IAQL+ +A+ S+ E+ G G G+E++ NEP+            KD    N GQ+T KIY++   +P +I+ L PK++L + E AWNAYPY RT    P    +KF + IE+ +  ++   +N+ +LS   L  R V  IDI  D +   DYV+E DPK F S KTGRGPL             G K      + +M AYK+   +F++WG+QT++E  I +   R +    HRQ + W D+W GLT+  +R+LE  T+  L ++   GE
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPY------------KDGPGGN-GQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCP--FVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 298.901 bits (764), Expect = 1.189e-97
Identity = 150/283 (53.00%), Postives = 198/283 (69.96%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            M+IKEFR+ILP++VEEY + QL+SVAE SKNETGGGEG+EV+KNEP++ +                KGQ+T+KIY+L+ KVP+F+R LAP ++L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +  Q +N+H L  +   + +VVYIDIA+   V+  DY  E DP  ++S KTGRGPL G  W     + T  P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  L M  +R++EE T++ELDE R +  V+G +A
Sbjct:    1 MLIKEFRVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPASALNIHEKAWNAYPYCRTVITN-EYMKENFLIKIETWHKPDMGQQDNVHGLDPDTWKKVDVVYIDIADRSQVEPKDYKPEEDPSKYKSVKTGRGPL-GPDWKRELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDEMRVKDPVKGMVA 267          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 296.975 bits (759), Expect = 8.103e-97
Identity = 149/285 (52.28%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            M+IKEFRI+LP++VEEY + QL+SVAE SKNETGGG+G+EV+KNEP++ E                KGQ+T+KIY L+ KVP+F+R LAP ++L I E+AWNAYPYCRT+L N  YM D F I IE+ H  +  + EN+H L  E   Q EV++IDIA+   VD  DY  + DP  F+SQKTGRGPL G  W     +    P MCAYKLVT +FKW+GLQ +VE  I  QE+R+F +FHRQ+FCW+D+W  LTM  +R++EE T++ELD+ R +  V+G  A +
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKEDG-------------EKGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTN-EYMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPL-GPDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 296.975 bits (759), Expect = 8.103e-97
Identity = 149/285 (52.28%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            M+IKEFRI+LP++VEEY + QL+SVAE SKNETGGG+G+EV+KNEP++ E                KGQ+T+KIY L+ KVP+F+R LAP ++L I E+AWNAYPYCRT+L N  YM D F I IE+ H  +  + EN+H L  E   Q EV++IDIA+   VD  DY  + DP  F+SQKTGRGPL G  W     +    P MCAYKLVT +FKW+GLQ +VE  I  QE+R+F +FHRQ+FCW+D+W  LTM  +R++EE T++ELD+ R +  V+G  A +
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKEDG-------------EKGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTN-EYMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPL-GPDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 296.975 bits (759), Expect = 8.103e-97
Identity = 149/285 (52.28%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            M+IKEFRI+LP++VEEY + QL+SVAE SKNETGGG+G+EV+KNEP++ E                KGQ+T+KIY L+ KVP+F+R LAP ++L I E+AWNAYPYCRT+L N  YM D F I IE+ H  +  + EN+H L  E   Q EV++IDIA+   VD  DY  + DP  F+SQKTGRGPL G  W     +    P MCAYKLVT +FKW+GLQ +VE  I  QE+R+F +FHRQ+FCW+D+W  LTM  +R++EE T++ELD+ R +  V+G  A +
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNETGGGDGVEVLKNEPYEKEDG-------------EKGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTN-EYMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPL-GPDWKKELPQKKDCPHMCAYKLVTVNFKWFGLQKKVEGFIHRQEKRLFTSFHRQLFCWLDRWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 293.508 bits (750), Expect = 1.740e-95
Identity = 148/282 (52.48%), Postives = 195/282 (69.15%), Query Frame = 2
Query:   23 IIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
             IKE R+ILP++VEEY + QL+SVAE SKNETGGGEG+EV+KNEP++ +                KGQ+T+KIY+L+ KVP+F+R LAP ++L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +  Q +N+H L  +   + +VVYIDIA+   V+  DY  E DP  ++S KTGRGPL G  W     + T  P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  L M  +R++EE T++ELDE R +  V+G +A
Sbjct:    1 FIKEHRVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPASALNIHEKAWNAYPYCRTVITN-EYMKENFLIKIETWHKPDMGQQDNVHGLDPDTWKKVDVVYIDIADRSQVEPKDYKPEEDPSKYKSVKTGRGPL-GPDWKRELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDEMRVKDPVKGMVA 266          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Match: rho (rhodopsin [Source:Xenbase;Acc:XB-GENE-966887])

HSP 1 Score: 290.812 bits (743), Expect = 2.545e-94
Identity = 150/283 (53.00%), Postives = 195/283 (68.90%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            ++IKEFRI+LP +VEEY + QL+SVAE SKNETGGGEGIEV+KNEP++ E                KGQ+T+KIY+L+ KVP F++  AP+ SL   E+AWNA+PYCRTI+ N  YM D FFIKIE+ H  +    EN+H L   +    +VV IDIA+   V+  DY ++ DP +FQS KT RGPL G  W +    +   P MCAYKLVT  FKWWGLQ +VE+ I  QE+RIF NFHRQ+FCW+D W  LTM  +R++E+ T+REL+  R++G+VRGT A
Sbjct:    2 VLIKEFRIVLPCSVEEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKEGE--------------KGQYTHKIYHLKSKVPGFVKMFAPEGSLIFHEKAWNAFPYCRTIVTN-EYMKDDFFIKIETWHKPDMGTQENVHCLDPNIWKSVDVVDIDIADRSQVEPADYKEKEDPAIFQSLKTKRGPL-GPNWKKELANSEDCPHMCAYKLVTIKFKWWGLQNKVESFIQKQEKRIFTNFHRQLFCWIDDWVDLTMEDIRRMEDKTQRELEALRNQGQVRGTSA 268          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Match: pitpna (phosphatidylinositol transfer protein alpha [Source:NCBI gene;Acc:100038215])

HSP 1 Score: 285.419 bits (729), Expect = 2.921e-92
Identity = 148/286 (51.75%), Postives = 193/286 (67.48%), Query Frame = 2
Query:   26 IKEF-RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENT-----TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            IK+F R+ILP++VEEY + QL+SVAE SKNETGGGEG+EV+ NEP++ +                KGQ+T+KIY+L+ KVP F+R LAP+ +L I E+AWNAYPYCRTI+ N  YM D F IKIE+ H  +    EN+H+L  ++    EVV IDIA+   V   DY  E DP  F+S KTGRGPL     W+ T       P MCAYKLVT  FKWWGLQ ++E+ I  QE+R+F NFHRQ+FCW+D+W  LTM  +R++E+ TK++LDE R R  V+G MA + 
Sbjct:    3 IKQFHRVILPVSVEEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPMFVRMLAPEGALNIHEKAWNAYPYCRTIITN-EYMKDDFLIKIETWHKPDLGMQENVHKLEPDVWKNVEVVQIDIADRSQVLTKDYKPEEDPAKFKSVKTGRGPLCPD--WKKTLGQQKDCPHMCAYKLVTVKFKWWGLQNKIESFIQKQEKRLFTNFHRQLFCWLDRWVELTMEDIRRMEDETKKQLDEMRERDPVKGMMAADD 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Match: pitpnb (phosphatidylinositol transfer protein, beta [Source:NCBI gene;Acc:394727])

HSP 1 Score: 281.182 bits (718), Expect = 1.543e-90
Identity = 142/286 (49.65%), Postives = 194/286 (67.83%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIA-NDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE-----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++IKE+R++LP++VEEY + QL+SVAE SK+ TGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F++ +AP+ SL   E+AWNAYPYCRTI+ N  YM D FF+KIE+ H  +    EN+H L      + EVV IDIA N  ++  DY    DP  ++S+KTGRGPL   + W+     N + P MCAYKLVT  F+WWGLQ +VE  I  QE+R+F NFHRQ+FC +D+W  LTM  +R++E+ T++ELDE R +G VRG  A +
Sbjct:    2 VLIKEYRVLLPVSVEEYQVGQLFSVAEASKDNTGGGEGIEVLKNEPYELDGE--------------KGQYTHKIYHLQSKVPGFVKMVAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDNFFVKIETWHKPDFGDQENVHGLDSNTWKEVEVVPIDIADNSQINEGDYKANEDPACYRSEKTGRGPLK--QDWKKELANNPSCPHMCAYKLVTVKFQWWGLQGKVERFIHKQEKRLFTNFHRQLFCSLDRWVELTMEDIRRMEDETQKELDEMRQKGAVRGMSAKD 270          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Match: pitpnb (phosphatidylinositol transfer protein, beta [Source:NCBI gene;Acc:394727])

HSP 1 Score: 271.552 bits (693), Expect = 1.445e-86
Identity = 139/282 (49.29%), Postives = 187/282 (66.31%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTI--LENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIA-NDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE-----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            R++LP++VEEY + QL+SVAE SK+ TGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F++ +AP+ SL   E+AWNAYPYCRTI  L    YM D FF+KIE+ H  +    EN+H L      + EVV IDIA N  ++  DY    DP  ++S+KTGRGPL   + W+     N + P MCAYKLVT  F+WWGLQ +VE  I  QE+R+F NFHRQ+FC +D+W  LTM  +R++E+ T++ELDE R +G VRG  A +
Sbjct:   20 RVLLPVSVEEYQVGQLFSVAEASKDNTGGGEGIEVLKNEPYELDGE--------------KGQYTHKIYHLQSKVPGFVKMVAPEGSLVFHEKAWNAYPYCRTISFLSQNEYMKDNFFVKIETWHKPDFGDQENVHGLDSNTWKEVEVVPIDIADNSQINEGDYKANEDPACYRSEKTGRGPLK--QDWKKELANNPSCPHMCAYKLVTVKFQWWGLQGKVERFIHKQEKRLFTNFHRQLFCSLDRWVELTMEDIRRMEDETQKELDEMRQKGAVRGMSAKD 285          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Match: pitpna (phosphatidylinositol transfer protein alpha [Source:NCBI gene;Acc:100038215])

HSP 1 Score: 263.462 bits (672), Expect = 1.777e-83
Identity = 142/298 (47.65%), Postives = 188/298 (63.09%), Query Frame = 2
Query:   14 FAMIIKEFRIILPM--TVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRT-------ILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENT-----TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            F + + + R+IL +     +Y + QL+SVAE SKNETGGGEG+EV+ NEP++ +                KGQ+T+KIY+L+ KVP F+R LAP+ +L I E+AWNAYPYCRT       IL    YM D F IKIE+ H  +    EN+H+L  ++    EVV IDIA+   V   DY  E DP  F+S KTGRGPL     W+ T       P MCAYKLVT  FKWWGLQ ++E+ I  QE+R+F NFHRQ+FCW+D+W  LTM  +R++E+ TK++LDE R R  V+G MA + 
Sbjct:    8 FHVYVTKSRLILGIWNRFCQYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPMFVRMLAPEGALNIHEKAWNAYPYCRTKLISGPYILLQNEYMKDDFLIKIETWHKPDLGMQENVHKLEPDVWKNVEVVQIDIADRSQVLTKDYKPEEDPAKFKSVKTGRGPLCPD--WKKTLGQQKDCPHMCAYKLVTVKFKWWGLQNKIESFIQKQEKRLFTNFHRQLFCWLDRWVELTMEDIRRMEDETKKQLDEMRERDPVKGMMAADD 289          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 298.901 bits (764), Expect = 1.759e-97
Identity = 149/285 (52.28%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++           KD  +  KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT++    YM + F IKIE+ H  +    EN+H+L  E     E +YIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYE-----------KDDGE--KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITKNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 272          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 296.975 bits (759), Expect = 7.126e-97
Identity = 150/285 (52.63%), Postives = 198/285 (69.47%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++           KD  +  KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +    EN+H+L  E     E +YIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYE-----------KDDGE--KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Match: Pitpnb (phosphatidylinositol transfer protein, beta [Source:MGI Symbol;Acc:MGI:1927542])

HSP 1 Score: 296.59 bits (758), Expect = 1.028e-96
Identity = 151/286 (52.80%), Postives = 197/286 (68.88%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW---WENT-TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++++                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LF S KT RGPL G  W     NT   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF N HRQ+FCW+DKW  LTM  +R++E+ T++EL+  R +G VRGT A ++
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPL-GPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Match: Pitpnb (phosphatidylinositol transfer protein, beta [Source:MGI Symbol;Acc:MGI:1927542])

HSP 1 Score: 296.59 bits (758), Expect = 1.236e-96
Identity = 152/283 (53.71%), Postives = 197/283 (69.61%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW---WENT-TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++++                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LF S KT RGPL G  W     NT   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF N HRQ+FCW+DKW  LTM  +R++E+ T++EL+  RS+G+VRGT A
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFHSVKTKRGPL-GPNWKKELANTPDCPRMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETLRSQGQVRGTSA 268          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Match: Pitpna (phosphatidylinositol transfer protein, alpha [Source:MGI Symbol;Acc:MGI:99887])

HSP 1 Score: 296.204 bits (757), Expect = 1.780e-96
Identity = 150/285 (52.63%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++           KD  +  KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT+  N  YM + F IKIE+ H  +    EN+H+L  E     E +YIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYE-----------KDDGE--KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVSAN-EYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Match: sp|Q9TR36|PIPNB_BOVIN (Phosphatidylinositol transfer protein beta isoform OS=Bos taurus OX=9913 GN=PITPNB PE=1 SV=3)

HSP 1 Score: 301.982 bits (772), Expect = 7.220e-98
Identity = 152/285 (53.33%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W +    N   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E+ T++EL+  R +G VRGT A +
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANNPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Match: sp|P48739|PIPNB_HUMAN (Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2)

HSP 1 Score: 301.212 bits (770), Expect = 1.173e-97
Identity = 152/285 (53.33%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W +    +   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E+ T++EL+  R RG VRGT A +
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAAD 270          
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Match: sp|P53812|PIPNB_RAT (Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2)

HSP 1 Score: 298.901 bits (764), Expect = 1.012e-96
Identity = 152/286 (53.15%), Postives = 198/286 (69.23%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW---WENT-TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            ++IKEFR++LP +V+EY + QL+SVAE SKNETGGGEGIEV+KNEP++++                KGQ+T+KIY+L+ KVP F+R +AP+ SL   E+AWNAYPYCRTI+ N  YM D FFIKIE+ H  +   +EN+H L        E+V+IDIA+   V+  DY  + DP LFQS KT RGPL G  W     NT   P MCAYKLVT  FKWWGLQ++VEN I  QE+RIF N HRQ+FCW+DKW  LTM  +R++E+ T++EL+  R +G VRGT A ++
Sbjct:    2 VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGE--------------KGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTN-EYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPL-GPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA 271          
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Match: sp|Q2HJ54|PIPNA_BOVIN (Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3)

HSP 1 Score: 297.36 bits (760), Expect = 3.844e-96
Identity = 148/285 (51.93%), Postives = 197/285 (69.12%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++VEEY + QL+SVAE SKNETGGGEG+EV+ NEP++ +                KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +   +EN+H+L  E     EV+YIDIA+   V + DY  E DP  ++S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE R+F NFHRQ+FCW+DKW  LTM  +R++E+ TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVEEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGE--------------KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKPDLGTLENVHKLEPEAWKHVEVIYIDIADRSQVLSKDYKAEEDPAKYKSIKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEDETKRQLDEMRQKDPVKGMTADD 270          
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Match: sp|P53810|PIPNA_MOUSE (Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 4.985e-96
Identity = 150/285 (52.63%), Postives = 198/285 (69.47%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            +++KE+R+ILP++V+EY + QL+SVAE SKNETGGGEG+EV+ NEP++           KD  +  KGQ+T+KIY+L+ KVPTF+R LAP+ +L I E+AWNAYPYCRT++ N  YM + F IKIE+ H  +    EN+H+L  E     E +YIDIA+   V + DY  E DP  F+S KTGRGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  LTM  +R++EE TKR+LDE R +  V+G  A++
Sbjct:    2 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYE-----------KDDGE--KGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPL-GPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD 271          
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Match: A0A3Q0KMP2 (Phosphatidylinositol transfer protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 2.089e-134
Identity = 182/281 (64.77%), Postives = 227/281 (80.78%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNV-DYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            MIIKEFRIILP+TV+EYH+ QLW+VAE SKNETGGGEGIEV+ NEPF+ + N PE+PL+ +  +++ GQ+T+K +YL  KVP ++R LAPK SLEI E+AWNAYPYCRT+L+NP YM + F + IESMHVQ+   IENIH L  +LLAQREVVYIDI ND + +  DY    DP+++QS KTGRGPL+G +WWENT LPIMCAYKLVTC+FKWWG+Q RVEN+I  QE RIF NF+RQ+FCW+DKWHGL+M  +R +E  TK ELDEQR  G +RGT+A++
Sbjct:    1 MIIKEFRIILPLTVDEYHVGQLWAVAEASKNETGGGEGIEVLVNEPFNLQVNPPESPLKANGEEFSSGQYTHKRFYLAGKVPGYVRLLAPKGSLEIDEKAWNAYPYCRTVLQNPKYMQNNFTLMIESMHVQDKIDIENIHNLPPKLLAQREVVYIDIVNDQLHSASDYDATCDPRIYQSVKTGRGPLVGPRWWENTDLPIMCAYKLVTCEFKWWGIQGRVENMIQTQERRIFLNFNRQVFCWLDKWHGLSMDDIRAIENKTKEELDEQRLVGSIRGTVAHD 281          
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Match: A0A4Z2DUP5 (Phosphatidylinositol transfer protein alpha isoform isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004540 PE=4 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 5.805e-134
Identity = 183/281 (65.12%), Postives = 227/281 (80.78%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVD-NVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            MIIKEFRIILP+TV+EY + QLW+VAE SKNETGGGEGIEV+ NEPFD E N PE+PL  +  ++  GQ+T+K +YL  KVP ++R+LAPK SLE+ E+AWNAYPYCRTIL+NP YM D F + IESMHVQ+   IENIH L  +LLAQREV+YIDIAND +    DY    DP+++QS KTGRGPL+G +WWENT LPIMCAYKLVTC+FKWWG+Q RVEN+I +QE RIF NF+RQ+FCW+DKWHGL+M+ +R +E  TK ELD+QR  G +RGT+A++
Sbjct:    1 MIIKEFRIILPLTVDEYRVGQLWAVAEASKNETGGGEGIEVLVNEPFDREVNPPESPLIANGEEFFSGQYTHKRFYLASKVPGYVRFLAPKGSLEVDEKAWNAYPYCRTILQNPKYMQDNFTLIIESMHVQDKVNIENIHNLPPKLLAQREVIYIDIANDQLHIASDYDPSCDPRIYQSVKTGRGPLVGPRWWENTDLPIMCAYKLVTCEFKWWGIQGRVENMIQSQERRIFLNFNRQVFCWLDKWHGLSMSDIRDVENKTKEELDQQRLIGGIRGTVAHD 281          
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Match: G4VIB5 (Phosphatidylinositol transfer protein OS=Schistosoma mansoni OX=6183 GN=Smp_137020 PE=4 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 5.246e-129
Identity = 178/282 (63.12%), Postives = 222/282 (78.72%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNV-DYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            MIIKEFRIILP+TV+EYH+ QLW+VAE SKNETGGGEGIEV+ NEPF+ + N PE+PL+ +  +++ GQ+T+K +YL  KVP ++R LAPK SLEI E+AWNAYPYCRT+L+NP YM + F + IESMHVQ+   IENIH L  +LLAQREVVYIDI ND + +  DY    DP+++QS KTGRGPL+G +WWENT LPIMCAYKLVTC+FKWWG+Q RVEN+I  QE RIF NF+RQ+FCW+DKWHGL+M  +R +E  TK ELDE R  G  +  +  +S
Sbjct:    1 MIIKEFRIILPLTVDEYHVGQLWAVAEASKNETGGGEGIEVLVNEPFNLQVNPPESPLKANGEEFSSGQYTHKRFYLAGKVPGYVRLLAPKGSLEIDEKAWNAYPYCRTVLQNPKYMQNNFTLMIESMHVQDKIDIENIHNLPPKLLAQREVVYIDIVNDQLHSASDYDATCDPRIYQSVKTGRGPLVGPRWWENTDLPIMCAYKLVTCEFKWWGIQGRVENMIQTQERRIFLNFNRQVFCWLDKWHGLSMDDIRAIENKTKEELDEVRLFGGYKCMITFSS 282          
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Match: A0A4Z2DV07 (Phosphatidylinositol transfer protein alpha isoform isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004540 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 4.886e-128
Identity = 176/267 (65.92%), Postives = 216/267 (80.90%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVD-NVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDE 817
            MIIKEFRIILP+TV+EY + QLW+VAE SKNETGGGEGIEV+ NEPFD E N PE+PL  +  ++  GQ+T+K +YL  KVP ++R+LAPK SLE+ E+AWNAYPYCRTIL+NP YM D F + IESMHVQ+   IENIH L  +LLAQREV+YIDIAND +    DY    DP+++QS KTGRGPL+G +WWENT LPIMCAYKLVTC+FKWWG+Q RVEN+I +QE RIF NF+RQ+FCW+DKWHGL+M+ +R +E  TK ELD+
Sbjct:    1 MIIKEFRIILPLTVDEYRVGQLWAVAEASKNETGGGEGIEVLVNEPFDREVNPPESPLIANGEEFFSGQYTHKRFYLASKVPGYVRFLAPKGSLEVDEKAWNAYPYCRTILQNPKYMQDNFTLIIESMHVQDKVNIENIHNLPPKLLAQREVIYIDIANDQLHIASDYDPSCDPRIYQSVKTGRGPLVGPRWWENTDLPIMCAYKLVTCEFKWWGIQGRVENMIQSQERRIFLNFNRQVFCWLDKWHGLSMSDIRDVENKTKEELDQ 267          
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Match: A0A075AIL5 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12896 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.317e-125
Identity = 178/270 (65.93%), Postives = 212/270 (78.52%), Query Frame = 2
Query:   11 IFAMIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAND-PVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDE 817
            I  MIIKEFRIILPMTVEEY++AQLWSVAE+SKNETGGGEGIEV+ NEPFD E + P+ PL      ++KGQ+T+K +YL  KVP ++R LAPK  LE+ ERAWNAYPYCRTI+ENP YM + FF+KIESM+VQ+     NIH+L  E+L +REVVYID  ND P  + DY    DP  FQS KTGRGPL+G  WW+NT +PIMCAYKLVTC+FKWWG+QTRVE ++ NQE RIF NFHRQ+FCWMDKWHGLTM  +R LE+  K ELD+
Sbjct:   61 IHRMIIKEFRIILPMTVEEYNVAQLWSVAEVSKNETGGGEGIEVLVNEPFDDEHHKPDPPLAVHGQVFDKGQYTHKRFYLANKVPAYVRILAPKRYLEVDERAWNAYPYCRTIIENPAYMQENFFLKIESMYVQDKVDEPNIHQLPPEMLERREVVYIDFVNDPPYSHSDYDPNCDPTKFQSVKTGRGPLIGPNWWKNTDMPIMCAYKLVTCEFKWWGIQTRVETMLQNQERRIFYNFHRQLFCWMDKWHGLTMNDIRALEDQAKHELDK 330          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Match: pitpnb (phosphatidylinositol transfer protein, beta [Source:ZFIN;Acc:ZDB-GENE-040426-895])

HSP 1 Score: 273.863 bits (699), Expect = 3.171e-88
Identity = 141/263 (53.61%), Postives = 177/263 (67.30%), Query Frame = 2
Query:   80 QLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW----WENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            QL+SVAE SKNETGGGEGIEV+ NEP++ E                KGQ+T+KIY+L+ KVP F++ +AP+ +L   E+AWNAYPYC T   N  YM D F IKIE+ H  +   +EN+H+L  E     EVV IDIA+   V+  DY QE DP +F S+KTGRGPL G +W      N   P MCAYKLVT  FKWWGLQ+++E+ I  QE+RIF NFHRQ+FCWMD W GLTM  +R++E  T++EL+E RS G VRGT A
Sbjct:    1 QLFSVAEASKNETGGGEGIEVLTNEPYEKEGE--------------KGQYTHKIYHLKSKVPGFVKMIAPEGALVFHEKAWNAYPYCCTSKFNNEYMKDDFMIKIETWHKPDMGSLENVHDLDPETWKTVEVVPIDIADRSQVEPGDYKQEEDPAVFHSEKTGRGPL-GPEWKSELAANENAPRMCAYKLVTVKFKWWGLQSKIEHFIHKQEKRIFTNFHRQLFCWMDSWVGLTMEDIRRMEAETQKELEEMRSSGTVRGTTA 248          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Match: pitpnbl (phosphatidylinositol transfer protein, beta, like [Source:ZFIN;Acc:ZDB-GENE-040426-2791])

HSP 1 Score: 273.478 bits (698), Expect = 6.306e-88
Identity = 141/277 (50.90%), Postives = 183/277 (66.06%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW---WENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMAN 856
            +++LP +VEEY + QL+SVAE SKN TGGGEGIEV++NEP++ E                KGQ+T+KIY++  KVP+FI+  AP+ +L   E+AWNAYPYCRT         + FFIKIE+ H  +    +N H L  E   + EVV IDIA+   VD+VDY  + DP LF S+KTGRGPL G  W     N+  P M AYKLVT  F+WWGLQ RVE+ I  QE+R+F NFHRQ+FCW+D+W  LTM  +R++EE T+RELD+ R+ G VRG  A 
Sbjct:    8 QVVLPCSVEEYQVGQLYSVAEASKNNTGGGEGIEVLRNEPYEKEGE--------------KGQYTHKIYHIHSKVPSFIQMFAPEGALVFHEKAWNAYPYCRT---------NDFFIKIETWHKPDLGTTDNPHGLPPEEWEETEVVPIDIADRSQVDDVDYKPDEDPALFHSEKTGRGPL-GPGWKKELHNSNCPYMTAYKLVTVHFRWWGLQGRVESFIHKQEKRLFTNFHRQLFCWLDRWVDLTMDDIRRMEEETQRELDQMRNEGSVRGMKAG 260          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 267.7 bits (683), Expect = 1.270e-85
Identity = 138/286 (48.25%), Postives = 185/286 (64.69%), Query Frame = 2
Query:   17 AMIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDP-VDNVDYVQESDPKLFQSQKTGRGPLLGLKWW----ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++     R++LP++VEEY + QL+SVAE SKNETGGGEG+EV+KNEP++ E                KGQ+T+KIY+L+ KVPTF+R LAP ++L I E+AWN             YM D F + IE+ H  +    EN+H+L  E   + EVVYIDIA+   +D  DY Q+ DP  F+S KTGRGPL G +W     + T  P MCAYKLVT  FKW+GLQ +VE  I  QE+R+F NFHRQ+FCW+DKW  LTM  +R++EE T++ELD+ R +  V+G  A +
Sbjct:    8 SLFFSSSRVVLPISVEEYQVGQLFSVAEASKNETGGGEGVEVLKNEPYEKEDG-------------EKGQYTHKIYHLQSKVPTFVRMLAPSSALNIHEKAWNN-----------EYMKDNFMVMIETWHKPDFGDQENVHKLDPETWKKVEVVYIDIADKSQIDAKDYKQDEDPATFKSVKTGRGPL-GPEWRKELPQKTDCPHMCAYKLVTVKFKWFGLQNKVEGFIHKQEKRLFTNFHRQLFCWLDKWIDLTMEDIRRMEEETQKELDKMREKDPVKGMSAAD 268          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Match: ENSAMXT00000052719.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6116017:6136613:-1 gene:ENSAMXG00000030401.1 transcript:ENSAMXT00000052719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 8.849e-83
Identity = 136/265 (51.32%), Postives = 175/265 (66.04%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDE 817
            R++LP +VEEY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+L+ KVP F++  AP+ SL   E+AWNAYPYCRT         + FFI IE+ H  +   IEN+H+L        EV+ IDIA+ D V   DY  + DP LF+S KTGRGPL G  W +    N   P MCAYKLVT  FKWWGLQ +VE+ I  QE+RIF NFHRQ+FCW+D+W  LTM  +R++E  T++EL+E
Sbjct:    8 RVVLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHLKSKVPGFVKMFAPEGSLVFHEKAWNAYPYCRT---------NDFFIMIETWHKPDLGTIENVHKLDSSTWKSVEVMPIDIADRDQVAYSDYKADEDPALFKSTKTGRGPL-GPNWRKELVSNPESPRMCAYKLVTVKFKWWGLQNKVESFIHKQEKRIFTNFHRQLFCWIDRWVDLTMEDIRRMEAETQKELEE 248          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Match: pitpnab (phosphatidylinositol transfer protein, alpha b [Source:ZFIN;Acc:ZDB-GENE-110408-51])

HSP 1 Score: 252.677 bits (644), Expect = 5.737e-80
Identity = 135/269 (50.19%), Postives = 174/269 (64.68%), Query Frame = 2
Query:   35 FRIILPM-TVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDP-VDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQR 823
            FR++L       Y + QL+SVAE SKNETGGGEG+EV+KNEP++ +                KGQ+T+KIY+L+ KVP+F+R LAP ++L I E+AWNAYPYCRT         + F IKIE+ H  +    EN+H L  +   + +VVYIDI +   V+  DY  E DP  F+S KTGRGPL G  W +     T  P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  L M  +R++EE T++ELDE R
Sbjct:    7 FRVLLECGCCFIYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKDGE--------------KGQYTHKIYHLQSKVPSFVRMLAPSSALNIHEKAWNAYPYCRT---------ENFLIKIETWHKPDMGHQENVHGLDPDTWKKVDVVYIDIGDRTQVEPKDYKPEEDPARFKSAKTGRGPL-GHDWKKELPKKTDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMDDIRRMEEETRKELDEVR 251          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004160.1 (pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 gene:ENSPMAG00000003779.1 transcript:ENSPMAT00000004160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.937 bits (694), Expect = 7.041e-88
Identity = 146/286 (51.05%), Postives = 187/286 (65.38%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILE---NPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKW---WENT-TLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            +++KEFR++LP +VEEY + QL+SVAE SKNETGGGEGIEV++NEP++ E                KGQ+T+KIY++  KVP F+R  AP+ SL   E+A   +P    I        YM D FF+KIE+ H  +    EN+H L +    Q EV++IDI + + V + DY  E DP LF+S KT RGPL G  W    EN    P MCAYKLVT  FKWWGLQT++E+ I  QE RIF NFHRQ+FCW+D+W GLTM  +R++EE TKRELDE R +G VRGT A
Sbjct:    2 VLVKEFRVLLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLRNEPYEKEGG-------------EKGQYTHKIYHVHSKVPNFVRLFAPEGSLVFHEKA--LFPTLINITSQVVTNEYMKDDFFVKIETWHKPDMGTQENVHGLDELTWKQVEVMHIDIGDRNQVLSSDYKTEEDPALFKSTKTSRGPL-GPNWKAELENREDCPHMCAYKLVTVKFKWWGLQTKMESFIQKQERRIFTNFHRQLFCWIDRWVGLTMEDIRRMEEETKRELDELREKGNVRGTTA 271          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003232.1 (pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 gene:ENSPMAG00000002952.1 transcript:ENSPMAT00000003232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 7.744e-48
Identity = 88/230 (38.26%), Postives = 135/230 (58.70%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGG-GEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVY------IDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVI 688
            M+IKE+RI LPM+VEEY IAQL+ + + S++ET G G G+E+++N P++                   GQ+T+K+Y++   +P + R + PK +L + E++WNAYPY RT    P    +KF I IE+ + Q+     N+  L      Q  V        IDI  DP+   +YV + DP++++S++TGRGP LG  W      PIMCAYKL   +F++WG+Q+++E  I
Sbjct:    1 MLIKEYRIPLPMSVEEYRIAQLYMIQKKSRDETSGEGSGVEILENRPYEDGPGG-------------TGQYTHKLYHIGMHIPGWFRAILPKAALRVEEQSWNAYPYTRTRYTCP--FVEKFSIDIETHYQQDGGDQLNVFNLGAAEKRQCSVGAGPVADTIDIVRDPMAPHEYVVDEDPRVYRSERTGRGP-LGDDWASLNPSPIMCAYKLCKVEFRYWGMQSKIERFI 214          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002979.1 (pep scaffold:Pmarinus_7.0:GL478233:8948:23532:1 gene:ENSPMAG00000002717.1 transcript:ENSPMAT00000002979.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 1.856e-33
Identity = 81/213 (38.03%), Postives = 115/213 (53.99%), Query Frame = 2
Query:  188 PLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELL-AQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLE----EATKREL 811
            P  KD  Q +     +    L  K+P++ + + P+    I E+AWN YPY  TI E       KF I I++ +  N+    N H  SDE   A +EV  +DIA D +    + +  D + F S +T RGPLL  + W + T P+MC+YKLVT  F+ WGLQTRVE  +      +    HRQ F W+D+W+G+TM  VR+ E    EAT ++L
Sbjct:    5 PTHKDKEQISPVAIQFS---LHSKLPSWAKVVVPR-IFYITEKAWNYYPY--TITEYTCSFLPKFSIYIKTKYEDNNGS--NDHIFSDEQNNADKEVCSLDIAYDEIPERYFKESEDLRGFMSTRTARGPLL--EGWRDDTTPVMCSYKLVTVKFEVWGLQTRVEQFVHKAIRDVLLTGHRQAFAWVDEWYGMTMEEVREYERNTQEATNKKL 207          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Sea Lamprey
Match: PITPNC1 (phosphatidylinositol transfer protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:21045])

HSP 1 Score: 80.4925 bits (197), Expect = 1.441e-17
Identity = 55/149 (36.91%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  377 KFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNF------HRQIFCWMDK-WHGLTMTHVRQLEEATK 802
            KF I IE+ +  N+   +++ + S+    +RE   +DIA D +    Y +  D + F+S KTGRGPL   + W +T  PIMC+YKLVT  F+ WGLQTRVE  +     ++  NF      H Q   W    W  ++M  VR+ E  T+
Sbjct:    6 KFSIYIETKYEDNNGCNDHVFD-SETNNVERETCKVDIAYDELPERYYKESEDVRQFKSLKTGRGPLA--EGWRDTLGPIMCSYKLVTVKFEVWGLQTRVEQFV----HKVLHNFLTISMGHCQCLEWAPLWWWYMSMEDVREYERTTQ 147          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Match: EDO43279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ09])

HSP 1 Score: 275.404 bits (703), Expect = 7.104e-89
Identity = 140/286 (48.95%), Postives = 188/286 (65.73%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDY-QIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTT----------LPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRG 844
            ++IKE+RI LP++VEEY IAQL++VAE SKNETGGGEGIEV+ NEP+     A E    K+      GQ+T+K+ +L  KVP+F+R LAP  SLE+ E+AWNAYP+CRT   N  YM + F + I++ H      +  N+H L +  L +RE+V IDI ND VD  +Y  + DP    S+K  RGPL   K W+              P+M  YKL   +FKWWGLQT+VE++IM    R+ RNFHRQ+FCWMD+W G+TM  +R++E+ TK+ELDE R +GEV+G
Sbjct:    2 VVIKEYRIPLPISVEEYQIAQLYAVAEASKNETGGGEGIEVLVNEPY----TAGEGGHGKNMPPGMDGQYTHKLIHLHSKVPSFVRMLAPSGSLEVHEKAWNAYPFCRTEYSN-TYMKEHFSVIIDTWHKPGHKDEFHNVHNLGNPELQKREIVNIDIVNDKVDPHEYKADEDPSKVGSEKAKRGPLK--KDWQQKNEEDPSKSKEGYPMMTCYKLYRVEFKWWGLQTKVESIIMKAVHRLLRNFHRQMFCWMDRWFGMTMDDIRRIEDKTKKELDEMRHKGEVKG 280          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Match: EDO43322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ10])

HSP 1 Score: 238.424 bits (607), Expect = 1.375e-74
Identity = 130/281 (46.26%), Postives = 179/281 (63.70%), Query Frame = 2
Query:   26 IKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQN-DYQIENIHELSDELLAQREVVYIDIANDP--VDNVDYVQESDPKLFQSQKTGRGPLL-----GLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRG 844
            +KE+R+ LP++VE Y IAQL++V E S NETGGGEGIEVVKNEP+       E      +     GQ+T KI +L+ KVP +I  LAP+ +LE+ E AWNAYPYC+T+  NP YM + F + I++ H +    +  N+HEL++  LA+REV+ IDIA +   V   DY ++ DP L +S+K   GPL      G         P+M  YKL    FKW  LQT VE+ I     R+ RNFHRQ+FCWMD+W+GLT+  +R++E+ TK +LD+ R+ GEV+G
Sbjct:    4 LKEYRVELPISVENYRIAQLYTVTEASMNETGGGEGIEVVKNEPY------VEGKGEFGNDVTEPGQYTLKIMHLKSKVPQWIVKLAPEGALEVHEEAWNAYPYCKTVYTNP-YMGENFHVIIKTWHKEGPSSRHSNVHELNESELAKREVIDIDIAAEKKLVGPHDYKEDEDPLLVRSEKANCGPLTPDWNKGASDTTKDGYPMMTCYKLYDVRFKWCLLQTVVESEIGKAVYRLLRNFHRQMFCWMDRWYGLTLDDIRRIEDETKDKLDKMRNEGEVKG 277          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Match: EDO41887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S326])

HSP 1 Score: 206.838 bits (525), Expect = 4.283e-57
Identity = 107/272 (39.34%), Postives = 167/272 (61.40%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNET-GGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE-----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDE 817
            M+IKE+RI LPM+V+EY IAQL+ + + S+ E+ G G G+E+++N P+          + KD      GQFT KIY++   +P +++ + PK++L + E AWNAYPY +     P    +KFF+ +E+ ++ +  Q  N+  L+   L  REV +ID   + V + DY+ E DP ++QS+KTGRGP+    W E     N   P+MCAYKL+  +F++WG+Q+++E+ I +   R     HRQ + W D+W+GLTM  +R+LEE TK  L +
Sbjct:    1 MLIKEYRIPLPMSVDEYRIAQLYMIQKKSRLESVGEGSGVEILENRPY----------MNKDG---GSGQFTKKIYHIGSHLPGWLKAILPKSALRVEEEAWNAYPYTKMRTTCP--FVEKFFVDVETHYLPDAGQTANVFNLTPAELNSREVDFIDPIAEVVASGDYLAEEDPLIYQSKKTGRGPMKA-DWLEAYQTDNPPTPVMCAYKLIKVEFRYWGMQSKIEHFIHSGLRRPMLMGHRQAWVWQDEWYGLTMGDIRRLEEETKAILSQ 256          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Match: EDO47917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ2])

HSP 1 Score: 174.096 bits (440), Expect = 2.066e-50
Identity = 100/271 (36.90%), Postives = 154/271 (56.83%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRG 832
            M++KE+RI +P++V+EY + QL+ +   S +++  GEG+ VVKNE  + +             ++  GQFT K  YL  ++P+++R   PK    IVE+AWN YP+  TI    +++  +F IKIE+ ++ +    EN   LS E L  REV+ +DIA D +    YV E D + F+S  TGRGPL     W +T+ PIMC+YKLV   F  WGL  RVE  +    + I    HRQ F W+D W+ + +  VR+ E+  + + + + + G
Sbjct:    1 MMLKEYRICMPLSVDEYRVGQLYMINRHSHDQSETGEGVHVVKNEACEDK-------------EHGNGQFTEKRVYLSSRLPSWVRSYIPK-IFYIVEKAWNFYPF--TITGICSFLP-RFSIKIETRYLNDKGCTENCFNLSPEELESREVIPVDIAFDELPEKYYVAEEDCRTFKSAVTGRGPLE--PGWRDTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKVVQDILLVGHRQAFAWIDLWYEMDINDVREYEKTMQEKTNNKVAVG 252          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Match: EDO47918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ5])

HSP 1 Score: 61.6178 bits (148), Expect = 3.845e-12
Identity = 28/79 (35.44%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  596 ENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRG 832
            ++T+ PIMC+YKLV   F  WGL  RVE  +    + I    HRQ F W+D W+ + +  VR+ E+  + + + + + G
Sbjct:    1 QDTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKVVQDILLVGHRQAFAWIDLWYEMDINDVREYEKEMQEKTNNKVAVG 79          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Match: pitpnab (phosphatidylinositol transfer protein alpha isoform [Source:NCBI gene;Acc:101174122])

HSP 1 Score: 285.034 bits (728), Expect = 2.508e-92
Identity = 149/276 (53.99%), Postives = 188/276 (68.12%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTM 850
            R+ILP++VEEY + QL+SVAE SKNETGGGEG+EV+KNEP++ E                KGQ+T+KIY+L+ KVP+F+R LAP ++L I E+AWNAYPYCRT  E   YM D F IKIE+ H  +    EN+H L  E   + +VVYIDIA+   V+  DY  E DP  F+S KT RGPL G  W +        P MCAYKLVT  FKWWGLQ +VEN I  QE+R+F NFHRQ+FCW+DKW  L M  +R++EE T++ELDE R RG +RGT+
Sbjct:    8 RVILPISVEEYQVGQLYSVAEASKNETGGGEGVEVLKNEPYEKEGE--------------KGQYTHKIYHLQSKVPSFVRMLAPSSALNIHEKAWNAYPYCRTGNE---YMKDNFLIKIETWHKPDMGHQENVHGLDAETWKKVDVVYIDIADRSQVEPKDYKPEEDPCKFKSTKTARGPL-GPDWKKELPNKKDCPHMCAYKLVTVKFKWWGLQNKVENFIQKQEKRLFTNFHRQLFCWIDKWIELNMEDIRRMEEETRKELDEARQRG-IRGTV 264          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Match: ENSORLT00000014894.2 (phosphatidylinositol transfer protein beta [Source:NCBI gene;Acc:101173068])

HSP 1 Score: 281.952 bits (720), Expect = 3.365e-91
Identity = 147/277 (53.07%), Postives = 182/277 (65.70%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            R++LP +VEEY + QL+SVAE SKNETGGGEGIEV+KNEP++ +                KGQ+T+KIY+++ KVP F+R  AP+ SL   E+AWNAYPYCRT         + FFIKIE+ H  +    EN+H L         VV IDIA+   V N DY  + DP  F+S KTGRGPL G  W +    N   P MCAYKLVT  FKWWGLQT+VEN I  QE+RIF NFHRQ+FCW+DKW  LTM  +R++E  T++EL+E R RGEVRGT A
Sbjct:    8 RVVLPCSVEEYQVGQLFSVAEASKNETGGGEGIEVLKNEPYEKDGE--------------KGQYTHKIYHIQSKVPAFVRLFAPEGSLVFHEKAWNAYPYCRT---------NNFFIKIETWHKPDMGTQENVHNLDASTWKNVTVVPIDIADRSQVSNADYKPDEDPAKFKSAKTGRGPL-GPDWKKELVSNAECPRMCAYKLVTVKFKWWGLQTKVENFIQEQEKRIFNNFHRQLFCWIDKWVELTMDDIRRMEAETQKELEELRRRGEVRGTSA 260          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Match: ENSORLT00000012124.2 (phosphatidylinositol transfer protein alpha isoform [Source:NCBI gene;Acc:101157147])

HSP 1 Score: 271.166 bits (692), Expect = 4.880e-87
Identity = 143/279 (51.25%), Postives = 187/279 (67.03%), Query Frame = 2
Query:   38 RIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            RI+LP++VEEY + QL++VAE SK+ETGGGEG+EV+ NEP+  E N              KGQFT+K+Y+L+ KVP FI+ +APK SLEI E+AWNAYPYCRT        + KF IKIE+ H  +    EN+H L ++     EVV IDIA+ + + + DY  + DP +F+S+KTGRGPL G  W      N   P MCAYKLVT +FKW GLQ R+EN I   E+R+F +FHRQ+FC +DKW  LTM  +R++EE TKRELDE R   EV+G  A++
Sbjct:    8 RIVLPVSVEEYQVGQLYAVAEASKSETGGGEGVEVLVNEPY--EENG------------EKGQFTHKVYHLQSKVPAFIKTVAPKGSLEIHEKAWNAYPYCRT------SESHKFLIKIETWHKPDMGNQENVHGLDEKTWGNVEVVNIDIADKNSISSKDYKADQDPSIFKSEKTGRGPL-GPDWKSELPNNPNCPHMCAYKLVTVEFKWLGLQNRIENYIQKVEKRLFTHFHRQLFCSIDKWIELTMDDIRRMEEETKRELDEMRKNDEVKGMGADD 265          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Match: PITPNB (phosphatidylinositol transfer protein beta isoform [Source:NCBI gene;Acc:101162302])

HSP 1 Score: 265.774 bits (678), Expect = 8.232e-85
Identity = 149/290 (51.38%), Postives = 194/290 (66.90%), Query Frame = 2
Query:   20 MIIKEFRII--LP-----MTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIAN-DPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE--NTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANN 859
            ++I+EF II  LP      +  +Y + QL+SVAE SKNETGGGEGIEV+KNEP++ E                KGQ+T+KIY+L+ KVP +++ +AP+ +L   E+AWNAYPYCRT         + F IKIE+ H  +   +EN+H+L ++     EVV IDIA+ D V   DY  E DP LFQS KTGRGPL G +W     T  P MCAYKLVT  F+WWGLQT+VEN I  QE+RIF NFHRQ+FCW+DKW GLTM  +R++EE T++EL+E R +G+VRGT A +
Sbjct:    2 LLIQEFNIIKMLPAHSVCFSALQYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKEGE--------------KGQYTHKIYHLKSKVPGYVKMIAPEGALVFHEKAWNAYPYCRT---------NDFMIKIETWHKPDMGTVENVHDLDEQTWRTVEVVPIDIASRDEVAPGDYKPEEDPALFQSSKTGRGPL-GPEWKNELKTDCPYMCAYKLVTVKFRWWGLQTKVENFIHRQEKRIFTNFHRQLFCWIDKWVGLTMEDIRRMEEETQKELEEMRQKGDVRGTSATD 267          
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2 [Source:NCBI gene;Acc:101172908])

HSP 1 Score: 193.356 bits (490), Expect = 4.122e-52
Identity = 105/271 (38.75%), Postives = 159/271 (58.67%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGG-GEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWEN-----TTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEER-IFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKREL 811
            M+IKE+RI +PM+VEEY IAQL+ + + S+ ET G G G+E+++N+P+   T+ P             GQ+T+K+Y++   +P++ R + PK +L + E +WNAYPY RT    P    +KF I IE+ +  +     ++  LS     QR +  IDI  DP+   +Y  E DP+ ++S KT RGPL    W E         PIMCAYKL   +F++WG+Q+++E  I +   R +    HRQ +CW D+W+GLT+  +RQLE  T+  L
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREETCGEGSGVEILENKPY---TDGPG----------GTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCP--FVEKFSIDIETYYKSDTGNQPDVFNLSAADKRQRTIDPIDIVTDPIAPHEYKAEEDPRFYKSVKTQRGPLRD-DWIEEYNNNPGKTPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDIRQLELETQLAL 255          
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Match: SMESG000062807.1 (SMESG000062807.1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 281/281 (100.00%), Postives = 281/281 (100.00%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 862
            MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS
Sbjct:    1 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMANNS 281          
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Match: SMESG000014949.1 (SMESG000014949.1)

HSP 1 Score: 370.548 bits (950), Expect = 1.353e-125
Identity = 173/277 (62.45%), Postives = 211/277 (76.17%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDN-VDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGT 847
            M+IKEFR+ILPM+VEEY +AQLWSVAE SKNETG GEGIEV+ NEPFD+ T+ P+  L     ++ KGQ+TYKIY+L  KVP  +RY+APK +L++ E+AWNAYPYCRT+L NP YM DKF IKIESMH+Q+    EN H+LS +LL++REVV IDIAND +    DY ++ DPKLF+S K GRGPL    WW+    P+MCAYKLV CDFKW+GLQ ++E +IM QE RIF NFHR  FCWMDKW GLTM  +R +EE TK+ELDEQ     VRGT
Sbjct:    1 MLIKEFRVILPMSVEEYQVAQLWSVAEASKNETGAGEGIEVLINEPFDANTHVPDPSLLNGDPRFTKGQYTYKIYHLINKVPRIVRYIAPKEALQLEEKAWNAYPYCRTVLTNPGYMKDKFIIKIESMHMQDPGINENAHQLSPDLLSKREVVTIDIANDELYTYADYKEDQDPKLFKSLKAGRGPLTKKPWWKGDISPVMCAYKLVVCDFKWFGLQGQIEKMIMKQERRIFTNFHRMAFCWMDKWFGLTMEDIRAIEEKTKKELDEQLRDDIVRGT 277          
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Match: SMESG000064206.1 (SMESG000064206.1)

HSP 1 Score: 369.392 bits (947), Expect = 3.710e-125
Identity = 169/279 (60.57%), Postives = 215/279 (77.06%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVD-NVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIMCAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTMTHVRQLEEATKRELDEQRSRGEVRGTMA 853
            MI+KEFRIILPM+V+EY IAQLWS AE SKNETGGGEGIEV  N+PFD     P   L     ++  GQ+T+KIY+L++KVP+ IR  APK +L++ E AWN+YPYCRTIL+NP++M DKFFIKIESMHV      EN+H L  +LL QRE+V+IDIANDP+D + DY +E DPK F S KTGRGPL   +WW+N   P+MCAYKLV C+FKWWGLQT++E +I  QE+RIF NFHR +FCWMD+WHGLT+ ++R +E  T+++L EQ + GE RGT++
Sbjct:    1 MIVKEFRIILPMSVDEYQIAQLWSTAEASKNETGGGEGIEVRINDPFDQHKFPPTPKLLNGDPRFTSGQYTFKIYHLDRKVPSLIRVFAPKGALQLEETAWNSYPYCRTILQNPSFMKDKFFIKIESMHVSGMGTEENVHCLPLDLLQQREIVFIDIANDPLDPSSDYKEEHDPKKFHSIKTGRGPLNTTQWWKNLNCPVMCAYKLVICEFKWWGLQTKIEKMIQRQEKRIFTNFHRMVFCWMDQWHGLTLHNIRIIESETQQQLSEQLNVGEKRGTLS 279          
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 210.305 bits (534), Expect = 1.155e-60
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNE-TGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----------NTTLPIMCAYKLVTCDFKWWGLQTRVENVI--MNQEERIFRNFHRQIFCWMDKWHGLTMTHV 778
            M+IKE+RI +P+TVEEY IAQL+ + + SK+E TG G G+E+++NEP++   N P             GQ+T+KIY++   +PT+ R + PK++L + E AWNAYPY +T  + P  + DKF ++IE+ +  +    +N+  L+DE + QR + Y+DI NDP+ + DY +E DPK++ S KT RGPL    W            ++ + IMCAYKL   +FK+WG+QT++E  I  +   + + R  HRQ +CW D+WHGL++T +
Sbjct:    1 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYE---NGPG----------GIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTD-SWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRA-HRQAWCWQDEWHGLSITDI 249          
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 210.69 bits (535), Expect = 4.325e-58
Identity = 109/266 (40.98%), Postives = 168/266 (63.16%), Query Frame = 2
Query:   20 MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNE-TGGGEGIEVVKNEPFDSETNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERAWNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQREVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWE----------NTTLPIMCAYKLVTCDFKWWGLQTRVENVI--MNQEERIFRNFHRQIFCWMDKWHGLTMTHV 778
            M+IKE+RI +P+TVEEY IAQL+ + + SK+E TG G G+E+++NEP++   N P             GQ+T+KIY++   +PT+ R + PK++L + E AWNAYPY +T  + P  + DKF ++IE+ +  +    +N+  L+DE + QR + Y+DI NDP+ + DY +E DPK++ S KT RGPL    W            ++ + IMCAYKL   +FK+WG+QT++E  I  +   + + R  HRQ +CW D+WHGL++T +
Sbjct:    1 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYE---NGPG----------GIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTD-SWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRA-HRQAWCWQDEWHGLSITDI 249          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITPNB4.080e-9953.68phosphatidylinositol transfer protein beta [Source... [more]
PITPNB2.442e-9853.33phosphatidylinositol transfer protein beta [Source... [more]
PITPNB1.094e-9753.36phosphatidylinositol transfer protein beta [Source... [more]
PITPNA1.094e-9652.63phosphatidylinositol transfer protein alpha [Sourc... [more]
PITPNA2.376e-9652.28phosphatidylinositol transfer protein alpha [Sourc... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y54F10AR.14.178e-10754.87pep chromosome:WBcel235:III:2572031:2575723:-1 gen... [more]
Y71G12B.172.732e-6440.57pep chromosome:WBcel235:I:1667501:1669792:1 gene:W... [more]
pitp-15.235e-5538.63PhosphatidylInositol Transfer Protein family [Sou... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vib2.294e-11458.78gene:FBgn0267975 transcript:FBtr0083745[more]
vib2.294e-11458.78gene:FBgn0267975 transcript:FBtr0344554[more]
vib6.712e-11458.93gene:FBgn0267975 transcript:FBtr0310064[more]
rdgB3.255e-5239.51gene:FBgn0003218 transcript:FBtr0331716[more]
rdgB3.297e-5239.51gene:FBgn0003218 transcript:FBtr0340289[more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnab1.189e-9753.00phosphatidylinositol transfer protein, alpha b [So... [more]
pitpnaa8.103e-9752.28phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnaa8.103e-9752.28phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnaa8.103e-9752.28phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnab1.740e-9552.48phosphatidylinositol transfer protein, alpha b [So... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rho2.545e-9453.00rhodopsin [Source:Xenbase;Acc:XB-GENE-966887][more]
pitpna2.921e-9251.75phosphatidylinositol transfer protein alpha [Sourc... [more]
pitpnb1.543e-9049.65phosphatidylinositol transfer protein, beta [Sourc... [more]
pitpnb1.445e-8649.29phosphatidylinositol transfer protein, beta [Sourc... [more]
pitpna1.777e-8347.65phosphatidylinositol transfer protein alpha [Sourc... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pitpna1.759e-9752.28phosphatidylinositol transfer protein, alpha [Sour... [more]
Pitpna7.126e-9752.63phosphatidylinositol transfer protein, alpha [Sour... [more]
Pitpnb1.028e-9652.80phosphatidylinositol transfer protein, beta [Sourc... [more]
Pitpnb1.236e-9653.71phosphatidylinositol transfer protein, beta [Sourc... [more]
Pitpna1.780e-9652.63phosphatidylinositol transfer protein, alpha [Sour... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TR36|PIPNB_BOVIN7.220e-9853.33Phosphatidylinositol transfer protein beta isoform... [more]
sp|P48739|PIPNB_HUMAN1.173e-9753.33Phosphatidylinositol transfer protein beta isoform... [more]
sp|P53812|PIPNB_RAT1.012e-9653.15Phosphatidylinositol transfer protein beta isoform... [more]
sp|Q2HJ54|PIPNA_BOVIN3.844e-9651.93Phosphatidylinositol transfer protein alpha isofor... [more]
sp|P53810|PIPNA_MOUSE4.985e-9652.63Phosphatidylinositol transfer protein alpha isofor... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KMP22.089e-13464.77Phosphatidylinositol transfer protein OS=Schistoso... [more]
A0A4Z2DUP55.805e-13465.12Phosphatidylinositol transfer protein alpha isofor... [more]
G4VIB55.246e-12963.12Phosphatidylinositol transfer protein OS=Schistoso... [more]
A0A4Z2DV074.886e-12865.92Phosphatidylinositol transfer protein alpha isofor... [more]
A0A075AIL51.317e-12565.93Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnb3.171e-8853.61phosphatidylinositol transfer protein, beta [Sourc... [more]
pitpnbl6.306e-8850.90phosphatidylinositol transfer protein, beta, like ... [more]
pitpnaa1.270e-8548.25phosphatidylinositol transfer protein, alpha a [So... [more]
ENSAMXT00000052719.18.849e-8351.32pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
pitpnab5.737e-8050.19phosphatidylinositol transfer protein, alpha b [So... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004160.17.041e-8851.05pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 g... [more]
ENSPMAT00000003232.17.744e-4838.26pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 ge... [more]
ENSPMAT00000002979.11.856e-3338.03pep scaffold:Pmarinus_7.0:GL478233:8948:23532:1 ge... [more]
PITPNC11.441e-1736.91phosphatidylinositol transfer protein cytoplasmic ... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432797.104e-8948.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433221.375e-7446.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418874.283e-5739.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479172.066e-5036.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479183.845e-1235.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnab2.508e-9253.99phosphatidylinositol transfer protein alpha isofor... [more]
ENSORLT00000014894.23.365e-9153.07phosphatidylinositol transfer protein beta [Source... [more]
ENSORLT00000012124.24.880e-8751.25phosphatidylinositol transfer protein alpha isofor... [more]
PITPNB8.232e-8551.38phosphatidylinositol transfer protein beta isoform... [more]
PITPNM24.122e-5238.75membrane-associated phosphatidylinositol transfer ... [more]
back to top
BLAST of Phosphatidylinositol transfer protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062807.10.000e+0100.00SMESG000062807.1[more]
SMESG000014949.11.353e-12562.45SMESG000014949.1[more]
SMESG000064206.13.710e-12560.57SMESG000064206.1[more]
SMESG000004877.11.155e-6040.98SMESG000004877.1[more]
SMESG000004877.14.325e-5840.98SMESG000004877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014734 ID=SMED30014734|Name=Phosphatidylinositol transfer protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1719bp
GGTTTAATACATTTTCGCTATGATTATTAAAGAATTTCGAATAATTTTAC
CAATGACAGTGGAAGAATATCATATTGCTCAGTTATGGAGTGTAGCTGAA
ATGTCGAAAAACGAAACCGGTGGCGGTGAAGGAATAGAAGTGGTGAAAAA
TGAACCATTCGATTCGGAAACGAATGCACCTGAAACTCCGCTGAGAAAAG
ATTCATCACAATACAATAAAGGGCAATTCACTTATAAAATCTATTATTTA
GAACAAAAGGTCCCAACATTTATTCGATATTTAGCTCCGAAAAACTCATT
GGAAATTGTCGAACGAGCATGGAATGCTTATCCGTATTGTCGAACAATTC
TTGAAAATCCCAATTACATGGCCGATAAGTTTTTTATCAAAATCGAAAGT
ATGCATGTTCAGAATGATTACCAAATTGAAAACATTCATGAACTCAGTGA
TGAACTATTAGCCCAAAGAGAAGTCGTCTATATCGACATAGCTAATGATC
CTGTGGATAATGTTGATTATGTTCAAGAATCAGATCCGAAACTTTTTCAG
TCTCAGAAAACTGGAAGAGGACCTTTGCTGGGCCTGAAGTGGTGGGAGAA
TACGACATTGCCGATTATGTGTGCCTATAAATTGGTCACCTGTGACTTCA
AATGGTGGGGACTGCAAACTCGGGTTGAAAATGTCATCATGAATCAAGAA
GAAAGAATTTTCAGAAATTTCCATCGTCAAATCTTCTGCTGGATGGATAA
ATGGCATGGGTTGACCATGACTCACGTGAGACAGCTTGAAGAGGCTACGA
AGCGAGAGCTTGATGAACAACGAAGTAGAGGAGAAGTAAGAGGCACCATG
GCAAACAACAGTTAGAAGCATTTCAATTATTCCACAATTTAGCCTCAAAG
AAACAGTTGATCTCTACATAAATATTAATAGTTATATATTATTGTCTCGT
GCGCTTATCGCTGGTTAGAATAGCCGCTATTATTATTTAATATTAATATG
TGATTTTTATGAATTGGCACCAGATCTGAACTTTAAGCTCTAAATTTTTA
TTGTTTTTATTGATGCATAATATTTATATTGTTACTGATAAAGATCTGGC
AACTTGTATTCTGATTACTGCTTGAGTGATTATTGTTAACTAATTTTGTT
TGTTATCTTTTCGTTGTAGTCCATTGAGTGCTTTTGGTGAGCATGATACA
TTATCTATCAATTATTCGCGTTTTACGACATTTGAGATTTTAGGGGAATT
TTATTTTCTCTTTATGACAGTCCTTTGTGGAATTCCTCATTGTTGGTTCA
TCATTCCACATTATTAGGTTACTTGTGATATTTGTTATACACGTTTCTAT
TAGCTTCAATAATTATCTTTTCTATGTTGTTGACATATCTTATTTTCTGT
TTTTTATTTTGTTCTAGTTTTGTTTTTGTGATTGCTCTTGTTCATATTTA
GTTCCTTAGATTGCAAACGTAGAATATACTCTAATGAACAGAAATTGGTT
TTTTGGATCATTGGCTAAAGAACTCGACATGAAGGGTTCCTGATGATGCT
ATTATGTTGATAGTGATCTATTCGAATTGCTATGATTATTAATAAATTTT
GTGTACTGTTTATTGGTTGCATTTATTGTTCCGCTCCAGCAAAAGACCGA
AATATTTCTTTGGGTTACCTGATTTTGTGTTAGCACTGATGAACCGAAAT
CATTTGAAATAAGATTCCA
back to top

protein sequence of SMED30014734-orf-1

>SMED30014734-orf-1 ID=SMED30014734-orf-1|Name=SMED30014734-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MIIKEFRIILPMTVEEYHIAQLWSVAEMSKNETGGGEGIEVVKNEPFDSE
TNAPETPLRKDSSQYNKGQFTYKIYYLEQKVPTFIRYLAPKNSLEIVERA
WNAYPYCRTILENPNYMADKFFIKIESMHVQNDYQIENIHELSDELLAQR
EVVYIDIANDPVDNVDYVQESDPKLFQSQKTGRGPLLGLKWWENTTLPIM
CAYKLVTCDFKWWGLQTRVENVIMNQEERIFRNFHRQIFCWMDKWHGLTM
THVRQLEEATKRELDEQRSRGEVRGTMANNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005548phospholipid transporter activity
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001666PI_transfer
IPR023393START-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001666Phosphatidylinositol transfer proteinPRINTSPR00391PITRANSFERcoord: 16..35
score: 62.08
coord: 230..249
score: 59.17
coord: 210..225
score: 57.81
IPR001666Phosphatidylinositol transfer proteinPFAMPF02121IP_transcoord: 1..261
e-value: 1.1E-108
score: 362.5
IPR001666Phosphatidylinositol transfer proteinPANTHERPTHR10658PHOSPHATIDYLINOSITOL TRANSFER PROTEINcoord: 1..278
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 1..281
e-value: 5.4E-116
score: 388.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 37..63
NoneNo IPR availablePANTHERPTHR10658:SF58VIBRATOR, ISOFORM Bcoord: 1..278
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 1..276