SMED30014731

Overview
NameSMED30014731
Smed IDSMED30014731
Length (bp)928
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014731 (SMED30014731) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014731 (SMED30014731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014731 (SMED30014731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014731 (SMED30014731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014731

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30014731 dd_Smed_v4_5494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014731 dd_Smed_v4_5494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30014731 dd_Smed_v6_5494_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014731 dd_Smed_v4_5494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014731 dd_Smed_v4_5494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30014731 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 69.3218 bits (168), Expect = 1.380e-13
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L P K  P+  +N  LK ++ + +   +Y+      +T+ + + IK  +K   + RYK++V   +G    Q +    + +WD  SD F ++ + NSS+F   +VY +Y E
Sbjct:   62 VQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of SMED30014731 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 64.3142 bits (155), Expect = 1.046e-11
Identity = 31/118 (26.27%), Postives = 62/118 (52.54%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            +K+  +YR+EP KK     + + ++ ++   +  V+YD +  + ++  L D I   +K F   RYK ++  +   KT Q +  A +++WD + D ++   +E  S    + V+ LY+E
Sbjct:   81 LKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of SMED30014731 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 64.3142 bits (155), Expect = 1.046e-11
Identity = 31/118 (26.27%), Postives = 62/118 (52.54%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            +K+  +YR+EP KK     + + ++ ++   +  V+YD +  + ++  L D I   +K F   RYK ++  +   KT Q +  A +++WD + D ++   +E  S    + V+ LY+E
Sbjct:   81 LKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of SMED30014731 vs. Ensembl Human
Match: TCTEX1D4 (Tctex1 domain containing 4 [Source:HGNC Symbol;Acc:HGNC:32315])

HSP 1 Score: 61.6178 bits (148), Expect = 1.582e-10
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = -1
Query:  239 YDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 484
            Y S +AA + + LC+++   ++  S  RYK+V   +LG +  Q V    + +WD + D   + +Y N+S+F   +V+ LY E
Sbjct:  140 YSSDEAARLVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE 221          
BLAST of SMED30014731 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 52.7582 bits (125), Expect = 5.430e-8
Identity = 26/116 (22.41%), Postives = 59/116 (50.86%), Query Frame = -1
Query:  242 EPTYRLEPT--KKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 583
            E TY L P   ++     +   +  ++  ++A  +Y   +   +T+ L + IK+ +K    +RYK+VV  ++G +  + V  A +  WD+ +D++    + N S+F  ++ +  ++
Sbjct:   26 ENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFY 141          
BLAST of SMED30014731 vs. Ensembl Celegans
Match: dylt-2 (DYnein Light chain (Tctex type) [Source:UniProtKB/TrEMBL;Acc:Q18917])

HSP 1 Score: 54.299 bits (129), Expect = 3.747e-9
Identity = 28/111 (25.23%), Postives = 55/111 (49.55%), Query Frame = -1
Query:  242 RLEPTKKLPLKEINSSLKTLIHNKV-AFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 571
            R  P +K   K +   ++ ++  K+ A   Y+  +A L+++ +   I+  +K   + RYK V+  ++  +     T A + VWD   D +LT  Y   SI+  + V+ ++H
Sbjct:   12 RPTPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQLPRYKYVIQTMIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFH 122          
BLAST of SMED30014731 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0088875)

HSP 1 Score: 55.8398 bits (133), Expect = 4.037e-9
Identity = 33/120 (27.50%), Postives = 63/120 (52.50%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLI--HNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            +++ PTYRLE    L  + + + +K ++  H    ++ +      +  QV  +EIKN IK  + +RY+ +V   +G    Q +     F+WD+  D F+T++ E  S F   + ++LY++
Sbjct:   71 MRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQV-SEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of SMED30014731 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0339127)

HSP 1 Score: 55.8398 bits (133), Expect = 4.037e-9
Identity = 33/120 (27.50%), Postives = 63/120 (52.50%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLI--HNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            +++ PTYRLE    L  + + + +K ++  H    ++ +      +  QV  +EIKN IK  + +RY+ +V   +G    Q +     F+WD+  D F+T++ E  S F   + ++LY++
Sbjct:   71 MRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQV-SEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of SMED30014731 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0339126)

HSP 1 Score: 55.8398 bits (133), Expect = 4.037e-9
Identity = 33/120 (27.50%), Postives = 63/120 (52.50%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLI--HNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            +++ PTYRLE    L  + + + +K ++  H    ++ +      +  QV  +EIKN IK  + +RY+ +V   +G    Q +     F+WD+  D F+T++ E  S F   + ++LY++
Sbjct:   71 MRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQV-SEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of SMED30014731 vs. Ensembl Fly
Match: CG7276 (gene:FBgn0036499 transcript:FBtr0075546)

HSP 1 Score: 50.0618 bits (118), Expect = 2.988e-7
Identity = 32/114 (28.07%), Postives = 55/114 (48.25%), Query Frame = -1
Query:  242 YRLEPT--KKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKS-FSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 574
            Y + P   KK PL  I   +  ++  K+A   Y+  +A   T+ + D+I   +K   S  R+K VV+ +L  +T        + +WD  SDD++TF ++  S     +V+  Y 
Sbjct:   57 YNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYITFTFDGGSFICIAAVFGCYQ 170          
BLAST of SMED30014731 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0306611)

HSP 1 Score: 50.0618 bits (118), Expect = 3.688e-7
Identity = 35/118 (29.66%), Postives = 55/118 (46.61%), Query Frame = -1
Query:  242 EPT-YRLEPT--KKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFS-VERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 583
            +PT Y + P   +  PL  I S +  ++  K+    YD   A   T  + DE+   I S S V+RYK VV  +LG +     T   +  WD   D  ++  + N+S+F   +V+  Y 
Sbjct:   55 QPTAYSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFGTYQ 172          
BLAST of SMED30014731 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.855 bits (159), Expect = 1.316e-12
Identity = 31/118 (26.27%), Postives = 67/118 (56.78%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TYR+ P+++ P+  +   LK ++ + +   +Y++     +T+ + + +K  +K   + RYKI+V   +G    Q +    + +WD + D+F +  ++N+S+F A +V+ +Y E
Sbjct:   56 VQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of SMED30014731 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 65.855 bits (159), Expect = 1.316e-12
Identity = 31/118 (26.27%), Postives = 67/118 (56.78%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TYR+ P+++ P+  +   LK ++ + +   +Y++     +T+ + + +K  +K   + RYKI+V   +G    Q +    + +WD + D+F +  ++N+S+F A +V+ +Y E
Sbjct:   56 VQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of SMED30014731 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 59.6918 bits (143), Expect = 1.261e-10
Identity = 29/114 (25.44%), Postives = 58/114 (50.88%), Query Frame = -1
Query:  242 TYRLEPTKKLPLKE--INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 577
            TY + P  K   K       +  ++  ++  VQYD  +   +++ L D IK+ +K  + +RYK +V  ++G +  + V  A +  WD+ +D++    Y N S+F   + + +Y+
Sbjct:   36 TYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMNDSLFCVAAAFAVYY 149          
BLAST of SMED30014731 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 50.447 bits (119), Expect = 2.913e-7
Identity = 26/100 (26.00%), Postives = 50/100 (50.00%), Query Frame = -1
Query:  284 TYRLEPTKKLPLKE--INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYEN 577
            TY + P  K   K       +  ++  ++  VQYD  +   +++ L D IK+ +K  + +RYK +V  ++G +  + V  A +  WD+ +D++    Y N
Sbjct:   36 TYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMN 135          
BLAST of SMED30014731 vs. Ensembl Xenopus
Match: coq10b (coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252])

HSP 1 Score: 73.1738 bits (178), Expect = 5.033e-15
Identity = 34/115 (29.57%), Postives = 68/115 (59.13%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY+  PTK+ P+  +N+ LK ++ + +   +Y++     +T+ + + IK  +K   + RYKI+V   +G    Q +    + +WD ++D F +++++NSS+F   +VY +Y+E
Sbjct:   63 ENTYQTGPTKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of SMED30014731 vs. Ensembl Xenopus
Match: ENSXETT00000044463.1 (tctex1 domain-containing protein 1-like [Source:NCBI gene;Acc:100498184])

HSP 1 Score: 70.4774 bits (171), Expect = 1.020e-13
Identity = 38/158 (24.05%), Postives = 78/158 (49.37%), Query Frame = -1
Query:  239 VSLGSLINTRKLTKKFTMGFFSRKKLSSTRSLNFQDIV---KYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 703
            +SL  L+  +++T++       R+K +  R+ N   I    +  P     P  + P   +   ++  +  K+    YD    A +T+ LC++IK  ++  +  RYK++    +G K  +++    + +WDS SD+  + +Y+N ++F  + VY +Y E
Sbjct:   66 ISLKGLLAAQRITRELKNRAALRRK-TRVRTQNCSPITIINEQTPANSANPAHRFPNAHVKELIEEFLATKLKNESYDPSTCAALTKDLCEDIKKIVRRVTPPRYKLICSMAIGSKDREDIMVTSQCLWDSYSDNVTSCSYQNRTLFCVVLVYAVYFE 222          
BLAST of SMED30014731 vs. Ensembl Xenopus
Match: txnrd2 (thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GENE-5767949])

HSP 1 Score: 68.5514 bits (166), Expect = 3.737e-13
Identity = 37/155 (23.87%), Postives = 80/155 (51.61%), Query Frame = -1
Query:  239 SLGSLINTRKLTKKFTMGFFSRKKLSSTRSLNFQDIVKYEP-TYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 700
            SL  L+  +++TK         K+  + +     +IV+ +P ++   P++K+ +  +   L++ +  ++  + Y+   A  + + + +E+K  +K     RYK +    LG +  +++    + +WDS SD ++   YENSS+F  ++VY +Y E
Sbjct:   50 SLSGLLAAQRMTKNL-------KEKRALKGAKKTEIVEPQPPSFASHPSEKIQVTAMKQVLESYLPERLGTITYNPASAPSLVKEVSEEVKGRVKRVLPTRYKALCVVTLGERGQEDIAVVSRCLWDSHSDSYVAHVYENSSLFCVVAVYAVYCE 197          
BLAST of SMED30014731 vs. Ensembl Xenopus
Match: ENSXETT00000021739.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:98753466:98754165:-1 gene:ENSXETG00000011363.1 transcript:ENSXETT00000021739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 9.198e-12
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = -1
Query:  239 SLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 613
             L  ++    E    L+P +    +E++  +K+++  ++   +YD+  +      L   +K  +KS   ERYK+V + +LG  +   + C  + VW  +SD +  F + N S+F    VY  Y+E
Sbjct:    7 GLGAEETQTMESALELQPRRIFSAEEVSKLIKSILEKQLQDSEYDATGSQQRALELVQLVKEAVKSLGYERYKLVCYIVLGPVSQGALCCCSRSVWSPTSDTYAEFVFRNQSLFALCIVYAGYYE 131          
BLAST of SMED30014731 vs. Ensembl Xenopus
Match: ENSXETT00000022071.1 (lysophosphatidic acid receptor 6-like [Source:Xenbase;Acc:XB-GENE-5721642])

HSP 1 Score: 53.9138 bits (128), Expect = 1.129e-8
Identity = 32/120 (26.67%), Postives = 61/120 (50.83%), Query Frame = -1
Query:  242 EPTYRLEPT-----KKLPLKE-INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 583
            E TY + P      K  P+K+ I S LK  + +K    QY   +   +T+ L + IK+ +K    +RYK+VV  ++G +  + V  A +  WD+ +D++    + N  +F  ++ +  ++
Sbjct:    8 ENTYSIRPNFQHKFKSAPVKDCIRSVLKEELSDK----QYVPEEVPQLTRFLSETIKDRLKDMGFDRYKMVVQVVIGEQRGEGVKMAARCFWDADTDNYAEDVFMNEYLFCVVAAFGCFY 123          
BLAST of SMED30014731 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 72.4034 bits (176), Expect = 7.308e-15
Identity = 38/141 (26.95%), Postives = 71/141 (50.35%), Query Frame = -1
Query:  239 KFTMGFFSRKKLSSTRSLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 661
            K ++   S     S R  + +  V+ E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:   37 KHSLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 177          
BLAST of SMED30014731 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 69.707 bits (169), Expect = 1.715e-14
Identity = 33/115 (28.70%), Postives = 61/115 (53.04%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:    2 ENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of SMED30014731 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 69.707 bits (169), Expect = 1.715e-14
Identity = 33/115 (28.70%), Postives = 61/115 (53.04%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:    2 ENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of SMED30014731 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 70.8626 bits (172), Expect = 2.126e-14
Identity = 34/118 (28.81%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:   56 VRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of SMED30014731 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 70.8626 bits (172), Expect = 2.126e-14
Identity = 34/118 (28.81%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:   56 VRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of SMED30014731 vs. UniProt/SwissProt
Match: sp|A2VDD2|TC1DB_XENLA (Tctex1 domain-containing protein 1-B (Fragment) OS=Xenopus laevis OX=8355 GN=tctex1d1-b PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.091e-14
Identity = 34/115 (29.57%), Postives = 69/115 (60.00%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY++ PTK+ P+  +N+ LK ++ + +   +Y++     +T+ + + IK  +K   + RYKI+V   +G    Q +    + +WD ++D F +++++NSS+F   +VY +Y+E
Sbjct:   62 ENTYQMGPTKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 176          
BLAST of SMED30014731 vs. UniProt/SwissProt
Match: sp|Q3B8D7|TC1DA_XENLA (Tctex1 domain-containing protein 1-A OS=Xenopus laevis OX=8355 GN=tctex1d1-a PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.625e-14
Identity = 33/115 (28.70%), Postives = 68/115 (59.13%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY++ P K+ P+  +N+ LK ++ + +   +Y++     +T+ + + IK  +K   + RYKI+V   +G    Q +    + +WD ++D F +++++NSS+F   +VY +Y+E
Sbjct:   63 ENTYQIGPAKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of SMED30014731 vs. UniProt/SwissProt
Match: sp|Q9D5I4|TC1D1_MOUSE (Tctex1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tctex1d1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.487e-13
Identity = 34/118 (28.81%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L PTK  P+  +N  L+ ++   +   QYD      +T+ + + IK  +K   + RYK++V   +G +  Q +    + +W+  SD   ++ ++NS+ F   +VY +Y E
Sbjct:   56 VRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of SMED30014731 vs. UniProt/SwissProt
Match: sp|Q8N7M0|TC1D1_HUMAN (Tctex1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TCTEX1D1 PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 6.628e-13
Identity = 35/118 (29.66%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L P K  P+  +N  LK ++ + +   +Y+      +T+ + + IK  +K   + RYK++V   +G    Q +    + +WD  SD F ++ + NSS+F   +VY +Y E
Sbjct:   62 VQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of SMED30014731 vs. UniProt/SwissProt
Match: sp|Q8CDY7|TC1D4_MOUSE (Tctex1 domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tctex1d4 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.318e-12
Identity = 31/119 (26.05%), Postives = 61/119 (51.26%), Query Frame = -1
Query:  239 KYEPTYRLEPTKKLPLKEINS--SLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 589
            +  P+YRLEP      +   +  +L+  +  ++  V Y   +A  + Q LC++I   ++  ++ RYK+V + +LG +  Q V    + +WD+  D   +  + N S+F   +V+ +Y E
Sbjct:  101 RMAPSYRLEPAPGEHWEAAGAQRALEAALTTQLNGVCYCGSEAGKLVQALCEQIHTRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDAVHDGLASATFTNPSLFAVATVHAVYWE 219          
BLAST of SMED30014731 vs. TrEMBL
Match: A0A433TUB2 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_007059 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.576e-21
Identity = 52/154 (33.77%), Postives = 89/154 (57.79%), Query Frame = -1
Query:  239 SLGSLINTRKLTKKFTMGFFSRKKLSSTRSLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 700
            SL  L+ +R+  KK  MG    K+ S+    +    V YEPTYRLEP +K     +  ++K +I N++  ++Y+ R A  + ++L DE+K+ +K  + ERYKIVV  ++G K  Q V  + +  WD + D++++  ++N  +F   SV+ +Y E
Sbjct:    1 SLVGLMASRRFAKKL-MGRALEKRESTIG--DGPPPVNYEPTYRLEPKQKFNTARVLEAVKDVIDNRLQDMKYNKRIAPNMNRILGDEVKDRVKRMNFERYKIVVLVMIGEKKGQGVMVSSRCSWDDNRDNYVSHTFQNKHLFCTCSVFGVYQE 151          
BLAST of SMED30014731 vs. TrEMBL
Match: A0A433T9N5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013974 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.061e-19
Identity = 45/115 (39.13%), Postives = 69/115 (60.00%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            EPTYR+EP KK    ++ + LK  + N +    Y+S+    +T+VL DEIK   K+ +VERYK+VV  ++G +  Q V  + +  WDS  D + T+ ++N S+F   SVY +Y E
Sbjct:   85 EPTYRMEPNKKFCAPQVYALLKQTLENHLDGFTYNSKFTPTMTKVLSDEIKERTKAMNVERYKLVVSIVMGERKDQGVMISSRAAWDSKLDSYATYTFQNKSLFCTASVYGVYAE 199          
BLAST of SMED30014731 vs. TrEMBL
Match: A0A1S3HR02 (tctex1 domain-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106157382 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.261e-19
Identity = 45/154 (29.22%), Postives = 86/154 (55.84%), Query Frame = -1
Query:  239 SLGSLINTRKLTKKFTMGFFSRKKLSSTRSLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 700
            SL  ++  R+ T +       R+ +   R L  Q+    +PTYR+EP  K    ++  ++K ++  ++   +Y+ R    +T+VL +E+K  +K    +RYK+V    +G K SQ++    +  WD++ D++ T+N+ENS++F  ++VY +Y E
Sbjct:   56 SLMGILAARRFTNRL------RETVREKRQLREQN-ANLQPTYRMEPRNKFQPGKVERAIKDVVDQRLEGCKYNPRLCKTMTRVLSEEVKEKVKGLKFDRYKLVCLVTIGEKKSQQLMVTSRCTWDTNFDNYSTYNFENSNLFCTVTVYGIYAE 202          
BLAST of SMED30014731 vs. TrEMBL
Match: A0A433SZV2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_017530 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.989e-18
Identity = 42/117 (35.90%), Postives = 71/117 (60.68%), Query Frame = -1
Query:  239 KYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 589
            K EPTYR+EP K     ++ + LK  + N +    Y+++  + +T+VL DEIK   K+ ++ERYK+VV  ++G +  Q V  + +  WD+  D + T+ ++N+S+F   SVY +Y E
Sbjct:   84 KLEPTYRMEPKKTFNAPQVCALLKQTLENHLEDFTYNAKFTSTMTKVLSDEIKERTKALNIERYKLVVCVVMGERKEQGVMISSRAAWDARLDSYATYTFQNTSLFCTASVYGVYAE 200          
BLAST of SMED30014731 vs. TrEMBL
Match: K1QQE2 (Tctex1 domain-containing protein 2 OS=Crassostrea gigas OX=29159 GN=CGI_10024575 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.279e-16
Identity = 42/153 (27.45%), Postives = 86/153 (56.21%), Query Frame = -1
Query:  239 LGSLINTRKLTKKFTMGFFSRKKLSSTRSLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 697
            +G  +     TKKF   F  R++ SST ++  ++   YEPTYR+ P +K   + ++  +K L+ +K+  + Y  + +  +T++LC++IK  +K+ + ERYK++ +  LG      +    +  WD  +DD+ T+ +++  ++  + V+ +Y E
Sbjct:   66 MGHSLTGMLATKKFFKRFSKRERTSSTVTVPPKE---YEPTYRMVPKRKFNSQHVHEVIKKLVDDKLDKMIYSKKWSPNLTKILCNQIKEKVKTLNYERYKMICNVTLGENKGPGIMATSRCSWDHRTDDYATYTFQSKHLYCTVVVFGVYKE 215          
BLAST of SMED30014731 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 73.9442 bits (180), Expect = 1.355e-15
Identity = 36/118 (30.51%), Postives = 70/118 (59.32%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L P K+ P++ +   LK ++ + +  V+Y++     +T+ + + +K  +K   + RYKI+V   +G  T Q +    + +WD++SD F + +++NSS+F   +VY +Y E
Sbjct:   60 VQMENTYQLGPKKRFPVQTVKEILKDVLSSYLLEVKYEAELCRQMTKTISEVVKARVKDMMIPRYKIIVVISIGQLTGQNMHVGSRCLWDATSDTFCSNSFKNSSLFAIANVYAVYFE 177          
BLAST of SMED30014731 vs. Ensembl Cavefish
Match: ENSAMXT00000038759.1 (tctex1 domain-containing protein 1-A-like [Source:NCBI gene;Acc:103036543])

HSP 1 Score: 74.7146 bits (182), Expect = 1.379e-15
Identity = 34/112 (30.36%), Postives = 64/112 (57.14%), Query Frame = -1
Query:  239 YRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 574
            Y+  P ++ P +++ S +K+++  ++   QY SR +A + + L D IK   KS S ERYK++ +  +G     EVTC+ + VW  ++D F  + ++N  +F    ++ +Y E
Sbjct:   88 YQTAPHRRFPREQVRSVMKSIVEARLGEAQYTSRCSA-VARKLSDSIKEAAKSLSYERYKLISYVAIGQLRDSEVTCSSRGVWCPAADTFTEYTFKNDHLFALCVLFAVYQE 198          
BLAST of SMED30014731 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 63.1586 bits (152), Expect = 7.003e-12
Identity = 28/98 (28.57%), Postives = 53/98 (54.08%), Query Frame = -1
Query:  242 INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 535
            ++S ++ L+  ++    YDS ++A   Q L   I + +K   ++RYK+VV  ++G +  + V  A +  WD+ +D      Y N S+F   +V+ +YH
Sbjct:   47 VSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNDSLFCVAAVFGIYH 144          
BLAST of SMED30014731 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 54.299 bits (129), Expect = 4.720e-9
Identity = 26/106 (24.53%), Postives = 56/106 (52.83%), Query Frame = -1
Query:  263 YRLEPTKKLPLKE--INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAI 574
            + + PT++   +   ++S ++ L+  ++    YDS ++A   Q L   I + +K   ++RYK+VV  ++G +  + V  A +  WD+ +D      Y N S+ +++
Sbjct:    8 HSIRPTQQHRFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNVSLKISV 113          
BLAST of SMED30014731 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008035.1 (pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1 gene:ENSPMAG00000007269.1 transcript:ENSPMAT00000008035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 4.701e-9
Identity = 23/81 (28.40%), Postives = 44/81 (54.32%), Query Frame = -1
Query:  239 DSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 481
            D+   A +  +L +EIK   K  +  RYK++V   LG    ++V  A + +WD ++D F + +Y   + F   +++ +Y+E
Sbjct:   25 DAAACARLAPLLSEEIKARAKEQTPTRYKLIVSVTLGSWEREQVVVASRCLWDPAADAFASHHYRRGARFCVATIFGVYYE 105          
BLAST of SMED30014731 vs. Ensembl Nematostella
Match: EDO44328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 76.2554 bits (186), Expect = 2.333e-17
Identity = 37/119 (31.09%), Postives = 65/119 (54.62%), Query Frame = -1
Query:  239 IVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 595
            I K E TY++EP +  P  E+   +   + N +A  +Y    ++ ++Q+L   + + +KS  V+RYK+V    +G K+ Q +  A + +W S  D F + + EN S+F   +VY +Y E
Sbjct:    2 IQKLENTYQVEPKRVFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSEFDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of SMED30014731 vs. Ensembl Nematostella
Match: EDO29797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 76.2554 bits (186), Expect = 2.333e-17
Identity = 37/119 (31.09%), Postives = 65/119 (54.62%), Query Frame = -1
Query:  239 IVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 595
            I K E TY++EP +  P  E+   +   + N +A  +Y    ++ ++Q+L   + + +KS  V+RYK+V    +G K+ Q +  A + +W S  D F + + EN S+F   +VY +Y E
Sbjct:    2 IQKLENTYQVEPKRVFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSEFDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of SMED30014731 vs. Ensembl Nematostella
Match: EDO45441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB6])

HSP 1 Score: 75.8702 bits (185), Expect = 1.260e-16
Identity = 37/115 (32.17%), Postives = 64/115 (55.65%), Query Frame = -1
Query:  239 EPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 583
            E TY+  PTKK P   I + +K ++   +A V YD      +T+ + + +KN +K  SV+RYKI+    +G    Q +    + +WD++ D + T+ ++N S+F   +VY +Y E
Sbjct:   63 ENTYQTTPTKKFPEGNIRNIMKEVLIENLADVNYDPNTCRQLTKTISETLKNRVKELSVQRYKIICLVHIGQLGKQAMRIGSRCLWDANFDTYTTYEFKNGSLFGVATVYGVYFE 177          
BLAST of SMED30014731 vs. Ensembl Nematostella
Match: EDO33655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL9])

HSP 1 Score: 70.4774 bits (171), Expect = 2.524e-15
Identity = 34/116 (29.31%), Postives = 65/116 (56.03%), Query Frame = -1
Query:  239 YEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 586
            YE TY+++P    P+ ++   ++ ++   ++ V+Y+  KA    + + + IK  +K+  + RYK+VV A +G    QE+    + VW    D++ T +Y NSS+F   +VY ++ E
Sbjct:    1 YENTYKIDPDVSFPVAKVEEIIRGVLSETLSSVEYNVTKAKEKCKSISNSIKERVKALELPRYKLVVLAHVGGNQGQEIKVTSRCVWSHEFDNYATASYCNSSVFAQATVYGIFFE 116          
BLAST of SMED30014731 vs. Ensembl Nematostella
Match: EDO46891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP6])

HSP 1 Score: 67.781 bits (164), Expect = 3.138e-14
Identity = 34/119 (28.57%), Postives = 68/119 (57.14%), Query Frame = -1
Query:  239 KYEPTYRLEP--TKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 589
            KY  TYR  P  +KK  +K ++  +  ++  ++  V+Y + ++ +++  L +EIK+ +K    +RYKI+    +G    Q+V  A + +WD + D   + ++ N S+F + +V+ +YHE
Sbjct:   13 KYCNTYRTTPEESKKFRVKPVSDIINKVLSERLGQVKYSAERSRVLSVPLAEEIKSHVKRLGYQRYKIICVVHIGSLDGQDVRVASRCLWDENQDRAASGSFCNESLFASATVFGVYHE 131          
BLAST of SMED30014731 vs. Ensembl Medaka
Match: tctex1d2 (Tctex1 domain containing 2 [Source:NCBI gene;Acc:101160473])

HSP 1 Score: 56.225 bits (134), Expect = 1.463e-9
Identity = 24/94 (25.53%), Postives = 52/94 (55.32%), Query Frame = -1
Query:  242 LKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYH 523
            +  ++  +++ V+Y+  K       L D I++ +KS  +++YKI+V  ++G +  Q V    +F WD+ +D++    + N S+F   +V+  Y+
Sbjct:   49 VHEIVRERLSGVKYEPEKIPETCSSLADCIRDKVKSLGIDKYKIIVQVMIGEQRGQGVKMCSRFFWDADTDNYAEDVFMNDSLFCVAAVFGCYY 142          
BLAST of SMED30014731 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.020e-14
Identity = 32/118 (27.12%), Postives = 67/118 (56.78%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L P +K P+++I +  K +I + +A  +Y+ +    +++ + + ++N IK   ++RYK+V    +G +     T   + +WD S D F  + ++N S+F   +++ +Y E
Sbjct:   58 VRVENTYQLGPDQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGIYQE 175          
BLAST of SMED30014731 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.793e-14
Identity = 32/118 (27.12%), Postives = 67/118 (56.78%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            V+ E TY+L P +K P+++I +  K +I + +A  +Y+ +    +++ + + ++N IK   ++RYK+V    +G +     T   + +WD S D F  + ++N S+F   +++ +Y E
Sbjct:   70 VRVENTYQLGPDQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGIYQE 187          
BLAST of SMED30014731 vs. Planmine SMEST
Match: SMESG000021852.1 (SMESG000021852.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.231e-12
Identity = 34/121 (28.10%), Postives = 69/121 (57.02%), Query Frame = -1
Query:  239 VKYEPTYRLEPT--KKLPLKEINSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWDS-SSDDFLTFNYENSSIFLAISVYFLYHE 592
            ++YE TYR+ P   +K  +K I   ++ ++ + ++ V+YDS+    +++++ D IK  ++     R+K+V   ++G K+   V  A + +W+S + DD    +++  SIF   +V+ LY E
Sbjct:   63 IQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVLIGDKSGANVCIASRCLWNSENGDDVAQASFDGGSIFAIGTVFGLYFE 183          
BLAST of SMED30014731 vs. Planmine SMEST
Match: SMESG000017994.1 (SMESG000017994.1)

HSP 1 Score: 62.7734 bits (151), Expect = 9.723e-12
Identity = 41/125 (32.80%), Postives = 65/125 (52.00%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKK---LPLKE---INSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVW-DSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            ++YE TYR++   K   L  K    +   LK ++HN     +YD   A  +T++L ++IK  +K     RYK VV  +LG K S  +    + +W D S D F   +Y N +I+   +VY +Y+E
Sbjct:   57 IQYENTYRMDANPKETFLSHKAKSILTDELKRVLHN----YKYDPNNANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of SMED30014731 vs. Planmine SMEST
Match: SMESG000018052.1 (SMESG000018052.1)

HSP 1 Score: 60.077 bits (144), Expect = 9.278e-11
Identity = 40/125 (32.00%), Postives = 65/125 (52.00%), Query Frame = -1
Query:  239 VKYEPTYRLEPTKK-----LPLKEI-NSSLKTLIHNKVAFVQYDSRKAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVW-DSSSDDFLTFNYENSSIFLAISVYFLYHE 592
            ++YE TYR++   K       +K I    LK ++H+     +YD   A  +T++L ++IK  +K     RYK VV  +LG K S  +    + +W D S D F   +Y N +I+   +VY +Y+E
Sbjct:   57 IQYENTYRMDADPKETFLSHKVKSILTDELKRVLHD----YKYDPNSANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
The following BLAST results are available for this feature:
BLAST of SMED30014731 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTEX1D11.380e-1329.66Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
TCTE31.046e-1126.27t-complex-associated-testis-expressed 3 [Source:HG... [more]
TCTE31.046e-1126.27t-complex-associated-testis-expressed 3 [Source:HG... [more]
TCTEX1D41.582e-1031.71Tctex1 domain containing 4 [Source:HGNC Symbol;Acc... [more]
TCTEX1D25.430e-822.41Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dylt-23.747e-925.23DYnein Light chain (Tctex type) [Source:UniProtKB... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG147634.037e-927.50gene:FBgn0033243 transcript:FBtr0088875[more]
CG147634.037e-927.50gene:FBgn0033243 transcript:FBtr0339127[more]
CG147634.037e-927.50gene:FBgn0033243 transcript:FBtr0339126[more]
CG72762.988e-728.07gene:FBgn0036499 transcript:FBtr0075546[more]
CG53593.688e-729.66gene:FBgn0037773 transcript:FBtr0306611[more]
back to top
BLAST of SMED30014731 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d11.316e-1226.27Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d11.316e-1226.27Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d21.261e-1025.44Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d22.913e-726.00Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b5.033e-1529.57coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252][more]
ENSXETT00000044463.11.020e-1324.05tctex1 domain-containing protein 1-like [Source:NC... [more]
txnrd23.737e-1323.87thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000021739.19.198e-1225.60pep primary_assembly:Xenopus_tropicalis_v9.1:4:987... [more]
ENSXETT00000022071.11.129e-826.67lysophosphatidic acid receptor 6-like [Source:Xenb... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d17.308e-1526.95Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.715e-1428.70Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.715e-1428.70Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d12.126e-1428.81Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d12.126e-1428.81Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SMED30014731 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2VDD2|TC1DB_XENLA1.091e-1429.57Tctex1 domain-containing protein 1-B (Fragment) OS... [more]
sp|Q3B8D7|TC1DA_XENLA4.625e-1428.70Tctex1 domain-containing protein 1-A OS=Xenopus la... [more]
sp|Q9D5I4|TC1D1_MOUSE1.487e-1328.81Tctex1 domain-containing protein 1 OS=Mus musculus... [more]
sp|Q8N7M0|TC1D1_HUMAN6.628e-1329.66Tctex1 domain-containing protein 1 OS=Homo sapiens... [more]
sp|Q8CDY7|TC1D4_MOUSE3.318e-1226.05Tctex1 domain-containing protein 4 OS=Mus musculus... [more]
back to top
BLAST of SMED30014731 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433TUB22.576e-2133.77Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A433T9N51.061e-1939.13Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3HR024.261e-1929.22tctex1 domain-containing protein 1-like OS=Lingula... [more]
A0A433SZV21.989e-1835.90Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1QQE22.279e-1627.45Tctex1 domain-containing protein 2 OS=Crassostrea ... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tctex1d11.355e-1530.51Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000038759.11.379e-1530.36tctex1 domain-containing protein 1-A-like [Source:... [more]
tctex1d27.003e-1228.57Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d24.720e-924.53Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008035.14.701e-928.40pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014731 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443282.333e-1731.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297972.333e-1731.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454411.260e-1632.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336552.524e-1529.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468913.138e-1428.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30014731 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d21.463e-925.53Tctex1 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SMED30014731 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040148.12.020e-1427.12SMESG000040148.1[more]
SMESG000040148.12.793e-1427.12SMESG000040148.1[more]
SMESG000021852.12.231e-1228.10SMESG000021852.1[more]
SMESG000017994.19.723e-1232.80SMESG000017994.1[more]
SMESG000018052.19.278e-1132.00SMESG000018052.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014731 ID=SMED30014731|Name=SMED30014731|organism=Schmidtea mediterranea sexual|type=transcript|length=928bp
TTTGGTTAGAAATCACATAAAAATAACAAAATGAAAATGAGGAATATTTA
AACTCAGAGTCTATAGATAGCATACATCTGACGACCTATAATAATTTTTC
ATAGAGATCACAGAGAGTCAAGATCCATATTTTACGCACAAATGACCTAG
GTTTTCGTAGAAATCTCTAATTCACATTAAAAACACTCATTTATATGAAA
TAAAGTCATAAACCAGATTAGAGAATGTAAGTATTTCATTCATGATAAAG
AAAATACACTGATATAGCCAAAAATATTGAGGAATTTTCGTAGTTAAAAG
TAAGAAAATCATCTGATGATGAATCCCAAACAAATTTTCCAGCGCAAGTT
ACCTCTTGGCTGGTTTTGCAACCCAAAATAGCATGGACCACAATTTTGTA
TCGTTCAACAGAAAATGACTTGATATCATTTTTTATTTCATCGCAGAGGA
CCTGTGTGATAAGAGCAGCCTTTCTAGAATCATACTGCACAAACGCCACT
TTATTATGGATCAGTGTTTTGAGACTTGAATTAATTTCTTTTAAAGGAAG
CTTTTTGGTTGGTTCCAAACGATATGTGGGCTCATACTTAACAATGTCTT
GAAAATTCAAAGAGCGGGTGCTTGATAACTTTTTCCGAGAGAAAAAACCC
ATCGTAAACTTTTTTGTTAACTTCCGAGTATTTATCAAGCTTCCAAGTGA
TACATATCCAGGACTGCTTTGCGATCCGACGGATTCCGAAGTGCTGACTT
TACGGAAAACGCTATCTGGCATATTATGAAATAATGTAAATATTGAAATT
GTCGGTACTTGATATAGTCAATTAATGGATACATTTAGTCTCTATTATAA
ACTCTATCACAAGGCTCCGGCATATCATTAATGGAGGCCGTGAGACCAAA
CCAATTAAGCATTCAACCGAAATGTAAA
back to top

protein sequence of SMED30014731-orf-1

>SMED30014731-orf-1 ID=SMED30014731-orf-1|Name=SMED30014731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MPDSVFRKVSTSESVGSQSSPGYVSLGSLINTRKLTKKFTMGFFSRKKLS
STRSLNFQDIVKYEPTYRLEPTKKLPLKEINSSLKTLIHNKVAFVQYDSR
KAALITQVLCDEIKNDIKSFSVERYKIVVHAILGCKTSQEVTCAGKFVWD
SSSDDFLTFNYENSSIFLAISVYFLYHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 78..176
e-value: 9.8E-16
score: 59.5
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 83..176
e-value: 6.4E-17
score: 61.7
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 37..178
NoneNo IPR availablePANTHERPTHR21255:SF44TCTEX1 DOMAIN-CONTAINING PROTEIN 1coord: 37..178