Tetraspanin-CD63 receptor

Overview
NameTetraspanin-CD63 receptor
Smed IDSMED30014724
Length (bp)1235
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin-CD63 receptor (SMED30014724) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin-CD63 receptor (SMED30014724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin-CD63 receptor (SMED30014724) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin-CD63 receptor (SMED30014724) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30014724SMESG000041117.1 Contig54706newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014724SMESG000041117.1 Contig54706uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014724SMESG000041117.1 Contig24901newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014724SMESG000041117.1 Contig24901uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30014724SMESG000041117.1 dd_Smed_v6_1378_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30014724SMESG000041117.1 dd_Smed_v6_1378_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014724SMESG000041117.1 dd_Smed_v4_1378_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Zebrafish
Match: upk1a (uroplakin 1a [Source:ZFIN;Acc:ZDB-GENE-060421-2603])

HSP 1 Score: 47.7506 bits (112), Expect = 9.814e-6
Identity = 34/124 (27.42%), Postives = 58/124 (46.77%), Query Frame = 3
Query:  606 SNPTDR-ILVPLTNTIQNDIISKYRDMNSTEPQ--SMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKY 968
            ++ T+R  LV  +N ++  ++  Y D +ST+ Q  +M  N +     CCG    TD+    + YRQ   + +     ++PL CC  +Q    ++     C    TSS    GC+  +E  L +Y
Sbjct:  104 TSATNRDYLVGNSNLVKKQMLQYYAD-SSTQGQQITMTWNNVMTQVQCCGADGPTDWIQYNSTYRQLFGAAS-----LWPLGCCK-RQSSNFEVVDPIGCKAGVTSSMFTQGCFQYIESVLSRY 220          
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Xenopus
Match: ENSXETT00000012721.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:49362206:49376296:1 gene:ENSXETG00000005063.1 transcript:ENSXETT00000012721.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.673e-6
Identity = 24/100 (24.00%), Postives = 46/100 (46.00%), Query Frame = 3
Query:  672 YRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKYL 971
            Y+  N++E  S   N I I  +CCG+    D+ N ++F+    ++        +P +CC      +  +  R+ C++       + GC+  +   LKKY+
Sbjct:  125 YKGDNASEVFSQSWNTIMIALSCCGISGLNDFGNRSHFHEMYPSTP-------WPDACCRRDNPVSGKILDREKCMQNTPDFTNDQGCFMTIARGLKKYI 217          
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Match: A0A5J4NQS3 (Tetraspanin-18 OS=Paragonimus westermani OX=34504 GN=DEA37_0011636 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.108e-12
Identity = 48/132 (36.36%), Postives = 70/132 (53.03%), Query Frame = 3
Query:  582 IGVVAYYGSNPTDRILV-PLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIK--TQTSSKMNMGCYTRLEPDLKKY 968
            IGV+A+Y SN   R +V  LT  + N  +  YR  +S +P S L NV+  T NCCGV + +D+ NA +F R    S+ +   + +P+SCC     F I     D+C    T+ +S +  GC+  L P L  Y
Sbjct:   16 IGVLAFYYSN---RFMVFHLTQNLLNQTLLNYRSFDSNDPYSTLFNVLMPTFNCCGVTDGSDFENAHDFVRTVNVSE-QVITLSYPISCCKMDHQFQI---LNDTCPTYFTEQNSNIKRGCWQELYPHLVYY 140          
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Match: A0A4E0R873 (Tetraspanin-6 OS=Fasciola hepatica OX=6192 GN=D915_004328 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.398e-11
Identity = 64/249 (25.70%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  225 SCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVC--CCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIK--TQTSSKMNMGCYTRLEPDL 959
            +C  +  + +VN  +  +  +  + GALL WG  +  +    L   I  LI++   +  A+ V+ + +           +   I + ++ I     C  CC   + L V    L    +  I ++A+Y SN    ++  +   + N  + +YR  ++ EP S+L NV+    NCCG++N +D+ NA  F RQ    +N+   + +P  CC    +F         C K  T+ +S +N+GC+T +EP L
Sbjct:    3 NCTCRIILFVVNFAVGTVAFLGMIAGALLTWGKAFINE---QLTQAIGPLIERIYGQEMAADVMHISELVLRFTSPFGLVIFIICLIVTAICFFGFCGSCCNNGICLKVYIGLLCVMLVVEISLMAFYYSN--RPLMYDVAENMFNQSLVQYRSFSAEEPSSVLFNVMMPALNCCGIHNGSDFKNAIKFERQMLI-NNEVINLQYPYPCCKLDSNFK---PLYPDCPKTFTEENSNVNIGCWTAIEPYL 242          
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Match: A0A419PZD4 (Tetraspanin-6 (Fragment) OS=Clonorchis sinensis OX=79923 GN=Tspan6 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.162e-9
Identity = 63/252 (25.00%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  225 SCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKA--DASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTS--SKMNMGCYTRLEPDLKKY 968
            SC  +  +  VN  + ++G ++ + GALL WG     + I     Q   ++  +G K   +A+ +     +  +  G+I F  G I+  + V G +  CC +   + I +   +    L ++ +  YY    T   +  +   I    + +YR   S +P SML NV+    +CCG++N +D++ A +F RQ   +      I +P++CC     + I     ++C     S  S ++ GC+ +L P L  Y
Sbjct:    3 SCTCRIVLFSVNIAVGVVGFLIMLFGALLTWGRAVMEEQIRGFLKQ--AIVTLYGHKTAIEATELAQHALRITAPFGMIIFSFGTIIFLLCVFGCIGACCNSALCLKIYLGFLIFFTVLEIVALAFYYSRRST---VFNIVRRILKQSLLRYRSKESRDPHSMLFNVMMPPLHCCGLHNASDFDRAKDFDRQFNTTTGL-INITYPVTCCKMDSAYVIQ---DNTCPGRFDSNNSNIDRGCWEQLYPHLVYY 245          
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Match: A0A267EA85 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006964g2 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.431e-9
Identity = 61/255 (23.92%), Postives = 122/255 (47.84%), Query Frame = 3
Query:  198 CYQTIMCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTS----SKMNMGCYTRLE 950
            C+QT M +++ +L    SIV    +I+GI L ++G +L +G +  +K +     ++   +   G + + S  I  +     ++ ++  + G ++  + +IG+VA+C      + I I I  +     L  V+ YY +   D         +Q  I +KY   N+T  +++L NV  ++ +CCG+ N +D+ ++T + R    S      + +PL+CC         + +  +C+ T  +    S  N+GCY  ++
Sbjct:    2 CFQTFMKILTGIL----SIV---FLILGIALMIVGFILQFGKDVLVKYLEAYTNELNEYLKAAGAQFNVSDYIGYLPSITGNVPVVFIVMGAVMAVVGIIGLVAICKENKCALTIYIIILAVLIVGQLTLVIVYYAAR--DTFSARAREYMQQTIDTKYTGYNNTNMETVLWNVFHMSLSCCGINNGSDFLSSTTWPRYVNYSGKYYDSVAYPLTCC--------KLTNWTACLHTNHTDAAYSNWNIGCYNLID 239          
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Match: A0A1I8H2K6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.757e-9
Identity = 61/255 (23.92%), Postives = 122/255 (47.84%), Query Frame = 3
Query:  198 CYQTIMCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTS----SKMNMGCYTRLE 950
            C+QT M +++ +L    SIV    +I+GI L ++G +L +G +  +K +     ++   +   G + + S  I  +     ++ ++  + G ++  + +IG+VA+C      + I I I  +     L  V+ YY +   D         +Q  I +KY   N+T  +++L NV  ++ +CCG+ N +D+ ++T + R    S      + +PL+CC         + +  +C+ T  +    S  N+GCY  ++
Sbjct:    2 CFQTFMKILTGIL----SIV---FLILGIALMIVGFILQFGKDVLVKYLEAYTNELNEYLKAAGAQFNVSDYIGYLPSITGNVPVVFIVMGAVMAVVGIIGLVAICKENKCALTIYIIILAVLIVGQLTLVIVYYAAR--DTFSARAREYMQQTIDTKYTGYNNTNMETVLWNVFHMSLSCCGINNGSDFLSSTTWPRYVNYSGKYYDSVAYPLTCC--------KLTNWTACLNTNHTDAAYSNWNIGCYNLID 239          
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Cavefish
Match: upk1a (uroplakin 1A [Source:NCBI gene;Acc:103022433])

HSP 1 Score: 47.3654 bits (111), Expect = 9.493e-6
Identity = 32/116 (27.59%), Postives = 56/116 (48.28%), Query Frame = 3
Query:  627 LVPLTNTIQNDIISKYRDMNSTEPQSML--INVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKY 968
            LV  +N ++  ++  Y + +ST+ + +    N +     CCG  +  D+    + +RQ   +    YP  +PL+CC     F  ++A    CI  QTS+    GC+T +E  L +Y
Sbjct:  115 LVGNSNVVKKQMLQYYAE-DSTKGREITKTWNKVMQDVECCGTDSPLDWVEYNSTFRQLYGT---TYP--WPLNCCKRLSSF--EVADSQGCIIGQTSTMFTRGCFTHIESVLSRY 222          
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Match: SMESG000041117.1 (SMESG000041117.1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.678e-158
Identity = 280/285 (98.25%), Postives = 283/285 (99.30%), Query Frame = 3
Query:  213 MCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKYLGYCFATXXXXXXXXXXXXXXXXXXXKCAAKLE 1067
            MCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLI+K GIK DASGVISLVQQNASSIGIIAFIAGCILIA+SVIGIVAVCCCTLKLILIVICIFLICFTLALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDL+KYLGYCFATIGITIGILVAAIIVTIILIKCAAKLE
Sbjct:    1 MCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIEKLGIKTDASGVISLVQQNASSIGIIAFIAGCILIALSVIGIVAVCCCTLKLILIVICIFLICFTLALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLRKYLGYCFATIGITIGILVAAIIVTIILIKCAAKLE 285          
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Match: SMESG000005510.1 (SMESG000005510.1)

HSP 1 Score: 127.872 bits (320), Expect = 7.398e-34
Identity = 88/265 (33.21%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  213 MCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQIQNLIDKFGIKADASGVIS---LVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQND---IISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKYLGYCFAT 989
            MC+++ ++K  + IV  ++++ G++L  +G +LLWGMN  +  IYDL   ++ L+    I  +A+G+ S   ++  N+++IG IAF  G + IAI+++G +++CCC  K  + VI   +    ++L+ +   YG+    +I     N ++ +   +I KY   N+T  +S++INVIQ  A+CCG+YNY+D++ A  +  +            FPLSCC+ ++   +++A    C  T TS  +  GCY+ ++P LKKYL Y F T
Sbjct:    1 MCLVTGIIKCILGIVIGIILVSGLILMGVGGVLLWGMNSIMPKIYDLSGHMKKLLQN--IHVNANGIKSFEEVISANSATIGAIAFSIGVLFIAIAILGYLSLCCCGAKCFIYVIIAIINALLVSLLVIAIVYGAQGNQKIF----NYVEKNLYKLIEKYEGYNATNVESLIINVIQTQAHCCGLYNYSDFDRAEKWVGRKLGFK-------FPLSCCESREMRYVNLA---ECKDTWTSPSLTKGCYSSIKPQLKKYLKYAFVT 249          
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Match: SMESG000056558.1 (SMESG000056558.1)

HSP 1 Score: 102.064 bits (253), Expect = 2.418e-24
Identity = 84/248 (33.87%), Postives = 135/248 (54.44%), Query Frame = 3
Query:  252 IVNSLLMIMGIVLFVIGALLLWGMNYFLKNIY-DLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQ-------ATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKYL 971
            +VN + MI+GIVL V G LL+   NY +  I   L+  +++L    G+  D + +I+ +     SI +I  I G IL  +S+IG+ +VCC +  LI+I + I    F + +I VV  Y +NP   +   + N +  ++I+KYR   +TEP+S L+N + I  NCCG   Y D+N++ NF R         + S   N  + +P+SCC +K DF     + + C++ QT +  + GC   L   +K+YL
Sbjct:   14 LVNIIYMIIGIVLAVAGILLVAAKNYVISFIVPTLETSLKSLKANGGMNVDTTAMINGILDYLVSISVILIIVGSILFVLSIIGMCSVCCKSQCLIIIYLSIISAVFAIQII-VVIIYAANP--EMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFK-DF--QFVNMNGCLQNQTDNNKDSGCTESLFNSIKEYL 255          
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Match: SMESG000056558.1 (SMESG000056558.1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.706e-23
Identity = 82/242 (33.88%), Postives = 131/242 (54.13%), Query Frame = 3
Query:  270 MIMGIVLFVIGALLLWGMNYFLKNIY-DLQAQIQNLIDKFGIKADASGVISLVQQNXXXXXXXXXXXXXXXXXXSVIGIVAVCCCTXXXXXXXXXXXXXXXXXALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQ-------ATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKYL 971
            MI+GIVL V G LL+   NY +  I   L+  +++L    G+  D + +I+ +     SI +I  I G IL  +S+IG+ +VCC +  LI+I + I    F + +I VV  Y +NP   +   + N +  ++I+KYR   +TEP+S L+N + I  NCCG   Y D+N++ NF R         + S   N  + +P+SCC +K DF     + + C++ QT +  + GC   L   +K+YL
Sbjct:    1 MIIGIVLAVAGILLVAAKNYVISFIVPTLETSLKSLKANGGMNVDTTAMINGILDYLVSISVILIIVGSILFVLSIIGMCSVCCKSQCLIIIYLSIISAVFAIQII-VVIIYAANP--EMSKKMINDLLKNMIAKYRGFTNTEPESFLVNFLNIFMNCCGATGYQDFNSSINFNRTFSGNFTYGSKSQTYNVYLYYPISCCKFK-DF--QFVNMNGCLQNQTDNNKDSGCTESLFNSIKEYL 236          
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Match: SMESG000056555.1 (SMESG000056555.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.412e-14
Identity = 42/138 (30.43%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  576 ALIGVVAYYGSNPTDRILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATA-------SDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLKKY 968
            A I V+  + ++PT      +   I  D+I KY    S  P+S LINV+ I  NCCG  NY D+N +  F R  +        ++  N  + +P+SCC +K+       +   CI+ + S+  + GC T L   ++ Y
Sbjct:  103 AQIIVIIIFAADPTKA--KSIVEGILKDMIIKYEGFFSANPESFLINVMNIGLNCCGAINYQDFNASVKFNRTYSGTFTYGGKTETYNVQLNYPISCCQFKE---FQFVNSRECIENKGSNNKDKGCVTSLFDSIQNY 235          
The following BLAST results are available for this feature:
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
upk1a9.814e-627.42uroplakin 1a [Source:ZFIN;Acc:ZDB-GENE-060421-2603... [more]
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000012721.15.673e-624.00pep primary_assembly:Xenopus_tropicalis_v9.1:2:493... [more]
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NQS31.108e-1236.36Tetraspanin-18 OS=Paragonimus westermani OX=34504 ... [more]
A0A4E0R8737.398e-1125.70Tetraspanin-6 OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A419PZD41.162e-925.00Tetraspanin-6 (Fragment) OS=Clonorchis sinensis OX... [more]
A0A267EA852.431e-923.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2K62.757e-923.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
upk1a9.493e-627.59uroplakin 1A [Source:NCBI gene;Acc:103022433][more]
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin-CD63 receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041117.11.678e-15898.25SMESG000041117.1[more]
SMESG000005510.17.398e-3433.21SMESG000005510.1[more]
SMESG000056558.12.418e-2433.87SMESG000056558.1[more]
SMESG000056558.11.706e-2333.88SMESG000056558.1[more]
SMESG000056555.14.412e-1430.43SMESG000056555.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014724 ID=SMED30014724|Name=Tetraspanin-CD63 receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1235bp
CTGTTGTCATAAAAAAACGATTGTTTCACAGTCTACAGTTGATTTGAGAA
TAACAATTCAGCATTCAACCAATCAGATTGAAACATTGAGAAATATATTT
ATGCATGCCATTTGAGATATAATAAAGTCGATAATAAGATTTTTTTCAAT
TCATTTTTAACGATTAAGAGCAGATTCTTTGGATCGTATTTTAATCTTGC
TATCAAACGATAATGTGCGTCATATCATGCTTATTGAAATTTGCAATCAG
TATTGTCAACAGCCTGTTGATGATAATGGGAATTGTGCTGTTCGTTATTG
GGGCACTTTTGCTGTGGGGAATGAATTACTTTTTGAAGAACATTTATGAT
TTGCAGGCTCAGATTCAGAATTTAATTGACAAATTTGGTATCAAGGCAGA
TGCAAGTGGAGTTATTTCTCTCGTTCAGCAAAATGCCTCCTCTATTGGAA
TCATTGCTTTTATTGCCGGGTGTATTCTTATCGCCATTTCTGTCATTGGA
ATTGTCGCGGTTTGCTGTTGTACTTTGAAACTGATATTGATTGTGATCTG
TATATTCTTGATATGTTTTACACTGGCTTTGATAGGTGTCGTAGCATATT
ACGGATCCAATCCTACAGATCGGATATTGGTGCCTCTTACCAACACAATC
CAGAATGATATCATTAGTAAATATAGGGATATGAATTCAACAGAGCCACA
ATCAATGCTCATCAACGTGATTCAAATAACCGCCAATTGTTGTGGCGTAT
ACAATTATACGGATTACAACAATGCCACTAACTTTTACAGGCAGGCAACT
GCTTCTGACAACAAAAATTATCCCATTATATTCCCATTATCGTGCTGTGA
TTATAAACAGGATTTCACTATAGACATGGCTTCTCGTGACTCCTGCATCA
AAACCCAAACCTCTTCAAAGATGAATATGGGCTGTTATACGCGTTTGGAG
CCGGACTTGAAGAAATATTTGGGTTACTGCTTTGCAACAATTGGAATTAC
AATTGGTATCTTGGTTGCCGCAATAATTGTCACGATTATTTTGATCAAAT
GCGCTGCAAAATTGGAATAAACAAACAATTTTATTTTTTCTGATCTTATA
ACTGAATTTTATATTTATCAATTGATTTATGCGGTTCTGTAATTTGTTTT
TTCGTTTTAATTATTTAAAACAATATTTTTTATGTTTTGATAATTTAGCC
TTTTATTTGTATTGAAAGAGAACTTTCCAATGCGC
back to top

protein sequence of SMED30014724-orf-1

>SMED30014724-orf-1 ID=SMED30014724-orf-1|Name=SMED30014724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MCVISCLLKFAISIVNSLLMIMGIVLFVIGALLLWGMNYFLKNIYDLQAQ
IQNLIDKFGIKADASGVISLVQQNASSIGIIAFIAGCILIAISVIGIVAV
CCCTLKLILIVICIFLICFTLALIGVVAYYGSNPTDRILVPLTNTIQNDI
ISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDN
KNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDLK
KYLGYCFATIGITIGILVAAIIVTIILIKCAAKLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000419prepharyngeal region
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 8..279
e-value: 9.2E-22
score: 77.9
NoneNo IPR availablePANTHERPTHR19282:SF395TETRASPANIN-2Acoord: 7..273
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 7..273
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 148..230