Histone H4

Overview
NameHistone H4
Smed IDSMED30014692
Length (bp)464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H4 (SMED30014692) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H4 (SMED30014692) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H4 (SMED30014692) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H4 (SMED30014692) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014692

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30014692SMESG000036410.1 SmedASXL_002675SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30014692SMESG000036410.1 dd_Smed_v4_506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014692SMESG000036410.1 dd_Smed_v4_506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014692SMESG000036410.1 dd_Smed_v4_506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
ovarySMED30014692SMESG000036410.1 DN304066ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30014692SMESG000036410.1 DN304066ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
parenchymal cellSMED30014692SMESG000036410.1 dd_Smed_v6_506_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H4 vs. Ensembl Human
Match: H4C9 (H4 clustered histone 9 [Source:HGNC Symbol;Acc:HGNC:4793])

HSP 1 Score: 162.54 bits (410), Expect = 3.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.54 bits (410), Expect = 3.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.54 bits (410), Expect = 3.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.54 bits (410), Expect = 3.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C14 (H4 clustered histone 14 [Source:HGNC Symbol;Acc:HGNC:4794])

HSP 1 Score: 162.54 bits (410), Expect = 3.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-67 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.614 bits (405), Expect = 7.273e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-64 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.614 bits (405), Expect = 7.273e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-60 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.614 bits (405), Expect = 7.273e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-56 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.614 bits (405), Expect = 7.273e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-50 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.614 bits (405), Expect = 7.273e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33899 (gene:FBgn0053899 transcript:FBtr0091903)

HSP 1 Score: 162.54 bits (410), Expect = 1.993e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33897 (gene:FBgn0053897 transcript:FBtr0091901)

HSP 1 Score: 162.54 bits (410), Expect = 1.993e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0334029)

HSP 1 Score: 162.54 bits (410), Expect = 1.993e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0082962)

HSP 1 Score: 162.54 bits (410), Expect = 1.993e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0082963)

HSP 1 Score: 162.54 bits (410), Expect = 1.993e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.54 bits (410), Expect = 2.270e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.54 bits (410), Expect = 2.270e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: zgc:153409 (zgc:153409 [Source:ZFIN;Acc:ZDB-GENE-060929-224])

HSP 1 Score: 162.54 bits (410), Expect = 2.270e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.54 bits (410), Expect = 2.270e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.54 bits (410), Expect = 2.270e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: zbtb22 (zinc finger and BTB domain containing 22 [Source:Xenbase;Acc:XB-GENE-6458515])

HSP 1 Score: 162.54 bits (410), Expect = 3.234e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (histone H4 [Source:NCBI gene;Acc:101732638])

HSP 1 Score: 162.54 bits (410), Expect = 3.234e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (H4 clustered histone 1 [Source:NCBI gene;Acc:549623])

HSP 1 Score: 162.54 bits (410), Expect = 3.234e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: cpa1 (carboxypeptidase A1 [Source:Xenbase;Acc:XB-GENE-960032])

HSP 1 Score: 162.54 bits (410), Expect = 3.234e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (H4 clustered histone 1 [Source:NCBI gene;Acc:549623])

HSP 1 Score: 162.54 bits (410), Expect = 3.234e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c14 (H4 clustered histone 14 [Source:MGI Symbol;Acc:MGI:2140113])

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c9 (H4 clustered histone 9 [Source:MGI Symbol;Acc:MGI:2448432])

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4n (histone cluster 1, H4n [Source:MGI Symbol;Acc:MGI:4843992])

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4m (histone cluster 1, H4m [Source:MGI Symbol;Acc:MGI:2448441])

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c12 (H4 clustered histone 12 [Source:MGI Symbol;Acc:MGI:2448439])

HSP 1 Score: 162.54 bits (410), Expect = 2.450e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt/SwissProt
Match: sp|Q28DR4|H4_XENTR (Histone H4 OS=Xenopus tropicalis OX=8364 GN=TGas006m08.1 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.713e-51
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt/SwissProt
Match: sp|P62799|H4_XENLA (Histone H4 OS=Xenopus laevis OX=8355 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.713e-51
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt/SwissProt
Match: sp|P62798|H4_XENBO (Histone H4 OS=Xenopus borealis OX=8354 PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.713e-51
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt/SwissProt
Match: sp|P62794|H4_URECA (Histone H4 OS=Urechis caupo OX=6431 PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.713e-51
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt/SwissProt
Match: sp|P62804|H4_RAT (Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.713e-51
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. TrEMBL
Match: E0VXR4 (Histone H4 OS=Pediculus humanus subsp. corporis OX=121224 GN=8231603 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.865e-50
Identity = 82/90 (91.11%), Postives = 86/90 (95.56%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG*SFCILLF 361
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  +  ++F
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGPKYSHVMF 111          
BLAST of Histone H4 vs. TrEMBL
Match: A0A0F8BYJ6 (Histone H4 OS=Larimichthys crocea OX=215358 GN=EH28_09091 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 5.641e-50
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. TrEMBL
Match: G5BSF6 (Histone H4 OS=Heterocephalus glaber OX=10181 GN=GW7_10007 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.348e-49
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   17 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 98          
BLAST of Histone H4 vs. TrEMBL
Match: A0A3P9L595 (Histone H4 OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.592e-49
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   16 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 97          
BLAST of Histone H4 vs. TrEMBL
Match: A0A3Q2P121 (Histone H4 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.885e-49
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   14 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 95          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000036719.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:21807:22190:1 gene:ENSAMXG00000036201.1 transcript:ENSAMXT00000036719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 1.254e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000032266.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10098617:10101488:1 gene:ENSAMXG00000042821.1 transcript:ENSAMXT00000032266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 1.578e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000025764.2 (histone H4 [Source:NCBI gene;Acc:111190747])

HSP 1 Score: 162.54 bits (410), Expect = 1.924e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000025592.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:172325:175033:-1 gene:ENSAMXG00000024866.2 transcript:ENSAMXT00000025592.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 2.108e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   20 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 101          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000043832.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:155578:160764:1 gene:ENSAMXG00000039753.1 transcript:ENSAMXT00000043832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 6.220e-52
Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEET GVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   27 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETHGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 108          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002372.1 (pep scaffold:Pmarinus_7.0:GL476925:46740:47638:1 gene:ENSPMAG00000002161.1 transcript:ENSPMAT00000002372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-38
Identity = 64/81 (79.01%), Postives = 68/81 (83.95%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 334
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002391.1 (pep scaffold:Pmarinus_7.0:GL476925:199603:200503:1 gene:ENSPMAG00000002178.1 transcript:ENSPMAT00000002391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-38
Identity = 64/81 (79.01%), Postives = 68/81 (83.95%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 334
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002392.1 (pep scaffold:Pmarinus_7.0:GL476925:215484:216380:1 gene:ENSPMAG00000002179.1 transcript:ENSPMAT00000002392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-38
Identity = 64/81 (79.01%), Postives = 68/81 (83.95%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 334
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002394.1 (pep scaffold:Pmarinus_7.0:GL476925:225178:226079:1 gene:ENSPMAG00000002180.1 transcript:ENSPMAT00000002394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-38
Identity = 64/81 (79.01%), Postives = 68/81 (83.95%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 334
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Yeast
Match: HHF2 (Histone H4; core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF1); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity [Source:SGD;Acc:S000004975])

HSP 1 Score: 151.369 bits (381), Expect = 6.096e-49
Identity = 73/82 (89.02%), Postives = 79/82 (96.34%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE++IRD+VTYTEHAKRKTVT++DVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Yeast
Match: HHF1 (Histone H4; core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF2); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity [Source:SGD;Acc:S000000213])

HSP 1 Score: 151.369 bits (381), Expect = 6.096e-49
Identity = 73/82 (89.02%), Postives = 79/82 (96.34%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE++IRD+VTYTEHAKRKTVT++DVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO40764 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.155 bits (409), Expect = 1.137e-52
Identity = 80/82 (97.56%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO27765 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.155 bits (409), Expect = 1.137e-52
Identity = 80/82 (97.56%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO38246 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.155 bits (409), Expect = 1.137e-52
Identity = 80/82 (97.56%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO30153 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.155 bits (409), Expect = 1.137e-52
Identity = 80/82 (97.56%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO46460 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.155 bits (409), Expect = 1.137e-52
Identity = 80/82 (97.56%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000014777.2 (pep primary_assembly:ASM223467v1:14:21234245:21236569:-1 gene:ENSORLG00000027210.1 transcript:ENSORLT00000014777.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 1.568e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000000211.2 (histone H4 [Source:NCBI gene;Acc:101170646])

HSP 1 Score: 162.54 bits (410), Expect = 1.912e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000042762.1 (histone H4 [Source:NCBI gene;Acc:101159884])

HSP 1 Score: 162.54 bits (410), Expect = 1.912e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000028618.1 (histone H4 [Source:NCBI gene;Acc:101168421])

HSP 1 Score: 162.54 bits (410), Expect = 1.912e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000043801.1 (histone H4 [Source:NCBI gene;Acc:101172305])

HSP 1 Score: 162.54 bits (410), Expect = 1.912e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000036410.1 (SMESG000036410.1)

HSP 1 Score: 162.925 bits (411), Expect = 8.350e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000070504.1 (SMESG000070504.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.412e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000070501.1 (SMESG000070501.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.412e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000054351.1 (SMESG000054351.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.412e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000048697.1 (SMESG000048697.1)

HSP 1 Score: 162.54 bits (410), Expect = 1.412e-52
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:   92 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 337
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN+IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
The following BLAST results are available for this feature:
BLAST of Histone H4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H4C93.568e-5298.78H4 clustered histone 9 [Source:HGNC Symbol;Acc:HGN... [more]
H4C153.568e-5298.78H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C153.568e-5298.78H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C153.568e-5298.78H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C143.568e-5298.78H4 clustered histone 14 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Histone H4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-677.273e-5297.56Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-647.273e-5297.56Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-607.273e-5297.56Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-567.273e-5297.56Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-507.273e-5297.56Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
back to top
BLAST of Histone H4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His4:CG338991.993e-5298.78gene:FBgn0053899 transcript:FBtr0091903[more]
His4:CG338971.993e-5298.78gene:FBgn0053897 transcript:FBtr0091901[more]
His4r1.993e-5298.78gene:FBgn0013981 transcript:FBtr0334029[more]
His4r1.993e-5298.78gene:FBgn0013981 transcript:FBtr0082962[more]
His4r1.993e-5298.78gene:FBgn0013981 transcript:FBtr0082963[more]
back to top
BLAST of Histone H4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hist1h4l2.270e-5298.78histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
hist1h4l2.270e-5298.78histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
zgc:1534092.270e-5298.78zgc:153409 [Source:ZFIN;Acc:ZDB-GENE-060929-224][more]
hist1h4l2.270e-5298.78histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
hist1h4l2.270e-5298.78histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
back to top
BLAST of Histone H4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb223.234e-5298.78zinc finger and BTB domain containing 22 [Source:X... [more]
hist1h4c3.234e-5298.78histone H4 [Source:NCBI gene;Acc:101732638][more]
hist1h4c3.234e-5298.78H4 clustered histone 1 [Source:NCBI gene;Acc:54962... [more]
cpa13.234e-5298.78carboxypeptidase A1 [Source:Xenbase;Acc:XB-GENE-96... [more]
hist1h4c3.234e-5298.78H4 clustered histone 1 [Source:NCBI gene;Acc:54962... [more]
back to top
BLAST of Histone H4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H4c142.450e-5298.78H4 clustered histone 14 [Source:MGI Symbol;Acc:MGI... [more]
H4c92.450e-5298.78H4 clustered histone 9 [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4n2.450e-5298.78histone cluster 1, H4n [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4m2.450e-5298.78histone cluster 1, H4m [Source:MGI Symbol;Acc:MGI:... [more]
H4c122.450e-5298.78H4 clustered histone 12 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Histone H4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DR4|H4_XENTR1.713e-5198.78Histone H4 OS=Xenopus tropicalis OX=8364 GN=TGas00... [more]
sp|P62799|H4_XENLA1.713e-5198.78Histone H4 OS=Xenopus laevis OX=8355 PE=1 SV=2[more]
sp|P62798|H4_XENBO1.713e-5198.78Histone H4 OS=Xenopus borealis OX=8354 PE=3 SV=2[more]
sp|P62794|H4_URECA1.713e-5198.78Histone H4 OS=Urechis caupo OX=6431 PE=3 SV=2[more]
sp|P62804|H4_RAT1.713e-5198.78Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 P... [more]
back to top
BLAST of Histone H4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E0VXR41.865e-5091.11Histone H4 OS=Pediculus humanus subsp. corporis OX... [more]
A0A0F8BYJ65.641e-5098.78Histone H4 OS=Larimichthys crocea OX=215358 GN=EH2... [more]
G5BSF61.348e-4998.78Histone H4 OS=Heterocephalus glaber OX=10181 GN=GW... [more]
A0A3P9L5951.592e-4998.78Histone H4 OS=Oryzias latipes OX=8090 PE=3 SV=1[more]
A0A3Q2P1211.885e-4998.78Histone H4 OS=Fundulus heteroclitus OX=8078 PE=3 S... [more]
back to top
BLAST of Histone H4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036719.11.254e-5298.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032266.11.578e-5298.78pep primary_assembly:Astyanax_mexicanus-2.0:21:100... [more]
ENSAMXT00000025764.21.924e-5298.78histone H4 [Source:NCBI gene;Acc:111190747][more]
ENSAMXT00000025592.22.108e-5298.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043832.16.220e-5297.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002372.13.734e-3879.01pep scaffold:Pmarinus_7.0:GL476925:46740:47638:1 g... [more]
ENSPMAT00000002391.13.734e-3879.01pep scaffold:Pmarinus_7.0:GL476925:199603:200503:1... [more]
ENSPMAT00000002392.13.734e-3879.01pep scaffold:Pmarinus_7.0:GL476925:215484:216380:1... [more]
ENSPMAT00000002394.13.734e-3879.01pep scaffold:Pmarinus_7.0:GL476925:225178:226079:1... [more]
back to top
BLAST of Histone H4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HHF26.096e-4989.02Histone H4; core histone protein required for chro... [more]
HHF16.096e-4989.02Histone H4; core histone protein required for chro... [more]
back to top
BLAST of Histone H4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407641.137e-5297.56Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO277651.137e-5297.56Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO382461.137e-5297.56Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO301531.137e-5297.56Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO464601.137e-5297.56Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
back to top
BLAST of Histone H4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000014777.21.568e-5298.78pep primary_assembly:ASM223467v1:14:21234245:21236... [more]
ENSORLT00000000211.21.912e-5298.78histone H4 [Source:NCBI gene;Acc:101170646][more]
ENSORLT00000042762.11.912e-5298.78histone H4 [Source:NCBI gene;Acc:101159884][more]
ENSORLT00000028618.11.912e-5298.78histone H4 [Source:NCBI gene;Acc:101168421][more]
ENSORLT00000043801.11.912e-5298.78histone H4 [Source:NCBI gene;Acc:101172305][more]
back to top
BLAST of Histone H4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036410.18.350e-53100.00SMESG000036410.1[more]
SMESG000070504.11.412e-5298.78SMESG000070504.1[more]
SMESG000070501.11.412e-5298.78SMESG000070501.1[more]
SMESG000054351.11.412e-5298.78SMESG000054351.1[more]
SMESG000048697.11.412e-5298.78SMESG000048697.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014692 ID=SMED30014692|Name=Histone H4|organism=Schmidtea mediterranea sexual|type=transcript|length=464bp
AAATCTATATAAATCTTATATGAGATAAATGTCAGGTCGAGGAAAAGGTG
GAAAAGGTCTTGGTAAAGGAGGTGCTAAGAGGCACAGAAAAGTATTGCGT
GATAATATTCAAGGAATCACTAAACCTGCAATTAGACGTTTAGCAAGAAG
AGGTGGCGTTAAACGAATATCTGGGCTGATTTATGAAGAAACACGAGGTG
TGCTGAAGGTTTTTCTGGAAAATATCATCCGCGATGCTGTCACATATACG
GAACACGCGAAGCGAAAAACCGTGACTGCAATGGATGTTGTTTATGCTTT
GAAACGTCAAGGTCGAACTCTTTATGGGTTCGGTGGATAATCATTTTGTA
TTTTATTATTTAATGTTGTAATTGCTATAATTGTTGCTAGTATTAATCTT
ATTTTAATAAATTATTTAACTGGATTTTAATTTAAATATGTCGGTTTTGT
AAATCCAATTTGTA
back to top

protein sequence of SMED30014692-orf-1

>SMED30014692-orf-1 ID=SMED30014692-orf-1|Name=SMED30014692-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKVFLENIIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007268chemical synaptic transmission
GO:0007411axon guidance
GO:0007420brain development
GO:0009416response to light stimulus
GO:0006352DNA-templated transcription, initiation
GO:0006334nucleosome assembly
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0045202synapse
GO:0000786nucleosome
GO:0005634nucleus
GO:0000788nuclear nucleosome
GO:0005694chromosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035425CENP-T/H4_C
IPR001951Histone_H4
IPR004823TAF_TATA-bd
IPR009072Histone-fold
IPR019809Histone_H4_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0042393histone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001951Histone H4PRINTSPR00623HISTONEH4coord: 89..100
score: 97.79
coord: 5..16
score: 95.59
coord: 77..89
score: 92.76
coord: 20..39
score: 93.38
coord: 62..76
score: 88.63
coord: 40..60
score: 93.56
IPR001951Histone H4SMARTSM00417h44coord: 16..90
e-value: 4.2E-29
score: 112.7
IPR001951Histone H4CDDcd00076H4coord: 18..101
e-value: 1.0229E-43
score: 135.321
IPR004823TATA box binding protein associated factor (TAF)SMARTSM00803TAF_clscoord: 28..93
e-value: 0.007
score: 17.8
IPR035425CENP-T/Histone H4, histone foldPFAMPF15511CENP-T_Ccoord: 35..96
e-value: 2.4E-8
score: 34.0
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..103
e-value: 8.7E-61
score: 204.4
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 3..102
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR10484:SF171coord: 1..103
NoneNo IPR availablePANTHERPTHR10484HISTONE H4coord: 1..103
IPR019809Histone H4, conserved sitePROSITEPS00047HISTONE_H4coord: 15..19