Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30014684
Length (bp)750
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014684

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cement glandSMED30014684h1SMcG0005646 DN305069.1smed_ncbi_20240424PMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cement glandSMED30014684h1SMcG0005646 DN305069.1smed_ncbi_20240424PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30014684h1SMcG0005646 DN305069.1smed_ncbi_20240424PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cement glandSMED30014684h1SMcG0005646 DN305069.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
copulatory apparatusSMED30014684h1SMcG0005646 Contig874GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30014684h1SMcG0005646 Contig38624uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014684h1SMcG0005646 Contig38624newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
copulatory apparatusSMED30014684h1SMcG0005646 PL05007B1D03smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30014684h1SMcG0022486 Contig874GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp47F (gene:FBgn0033629 transcript:FBtr0088151)

HSP 1 Score: 51.6026 bits (122), Expect = 1.444e-7
Identity = 37/117 (31.62%), Postives = 65/117 (55.56%), Query Frame = 2
Query:  209 LLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDF------KVLPASCCPPK 541
            +++I++G I+ +++S+G +G + ES  +LI   + L ++ I+++   I  +  KK +E  +K  L     K SN+       D+I +K+ CCGV S  D+      K LP SCC P+
Sbjct:   54 IVLIVTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQE-SIKRSNSEDTMA-WDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQ 168          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 48.521 bits (114), Expect = 2.338e-6
Identity = 36/144 (25.00%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC 583
             ++II  G ++ I+  IG   T+ ES+  L    I L+++ + ++V  +L    + +VE  +   +   +N+ + T+   P R  D++ +++ CCG+ +  D++            +P SCC P V  C        + YP+GC
Sbjct:   54 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNSVPLSCCKPNVSNCTGSLLHPGDLYPEGC 197          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 48.521 bits (114), Expect = 2.338e-6
Identity = 36/144 (25.00%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC 583
             ++II  G ++ I+  IG   T+ ES+  L    I L+++ + ++V  +L    + +VE  +   +   +N+ + T+   P R  D++ +++ CCG+ +  D++            +P SCC P V  C        + YP+GC
Sbjct:   54 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNSVPLSCCKPNVSNCTGSLLHPGDLYPEGC 197          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 48.521 bits (114), Expect = 2.338e-6
Identity = 36/144 (25.00%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC 583
             ++II  G ++ I+  IG   T+ ES+  L    I L+++ + ++V  +L    + +VE  +   +   +N+ + T+   P R  D++ +++ CCG+ +  D++            +P SCC P V  C        + YP+GC
Sbjct:   54 AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSIQKVYNEYNGTNTDAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNSVPLSCCKPNVSNCTGSLLHPGDLYPEGC 197          
BLAST of Tetraspanin vs. TrEMBL
Match: B0VZ55 (Tetraspanin OS=Culex quinquefasciatus OX=7176 GN=6030957 PE=3 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 9.600e-6
Identity = 50/175 (28.57%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  170 HTQFGSNTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLY---VFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDF-----KVLPASCC-----PPKVKVCN------FKEAYPQGCFIALKKLVTSNVNYLIPI 637
            +  F  + L    +++I+ G  + +V+S+G YG + ES  +L    + LLI+++I++   I     K  ++ +++ QL      HNK+  T+      D ++KKM CCGV    D+     K +PASCC      P+ + C           Y QGC + LK+    N   LI +
Sbjct:   39 YQHFVEDKLMAPPVVLIVVGAFVFLVASLGCYGAIKESPKLLNTFAVFLLIVLLIEVAVAIAAIAFKSDLQNALERQLQKSIERHNKADMTAW-----DTVHKKMMCCGVQGPKDWYDNNNKTMPASCCKPDLIDPETEDCKNAPPLFMDRYYQQGCLMELKEHFDKNAVVLIAV 208          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 51.6026 bits (122), Expect = 1.432e-7
Identity = 40/152 (26.32%), Postives = 77/152 (50.66%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC-FIALKKL 604
             ++II  G ++ I+  IG   T+ ES+  L    I L+++ + ++V  +L    + +VE+ +   +   +N+ + T+   P R  D++ +++ CCG+ + LD++            +P SCC P V  C        + YP+GC  + +KKL
Sbjct:   55 AVVIIAVGGLLFIIGLIGCCATIRESRCGLATFVIILILVFVTEVVVVVLGYIYRAKVEEEVNHSIQKVYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESRNNSVPLSCCKPNVSNCTGSLSRPGDLYPEGCEALVVKKL 206          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 51.6026 bits (122), Expect = 1.554e-7
Identity = 40/152 (26.32%), Postives = 77/152 (50.66%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC-FIALKKL 604
             ++II  G ++ I+  IG   T+ ES+  L    I L+++ + ++V  +L    + +VE+ +   +   +N+ + T+   P R  D++ +++ CCG+ + LD++            +P SCC P V  C        + YP+GC  + +KKL
Sbjct:   56 AVVIIAVGGLLFIIGLIGCCATIRESRCGLATFVIILILVFVTEVVVVVLGYIYRAKVEEEVNHSIQKVYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESRNNSVPLSCCKPNVSNCTGSLSRPGDLYPEGCEALVVKKL 207          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan3a (tetraspanin 3 [Source:NCBI gene;Acc:103046031])

HSP 1 Score: 49.6766 bits (117), Expect = 6.055e-7
Identity = 38/152 (25.00%), Postives = 70/152 (46.05%), Query Frame = 2
Query:  206 GLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR--DHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVCNFK-----EAYPQGC-FIALKKL 604
             ++II  G ++ I+  IG   T+ ES+                       +AT++++V  SI++     +N+ + T+   P R  D++ +++ CCG+ + LD++            +P SCC P V  C        + YP+GC  + +KKL
Sbjct:   55 AVVIIAVGGLLFIIGLIGCCATIRESR---------------------CGLATVEEEVNHSIQK----VYNEYNGTNSDAPSRAIDYVQRQLHCCGITNYLDWRNTSWFNESRNNSVPLSCCKPNVSNCTGSLSRPGDLYPEGCEALVVKKL 181          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 50.447 bits (119), Expect = 9.412e-8
Identity = 43/163 (26.38%), Postives = 77/163 (47.24%), Query Frame = 2
Query:  209 LLIILSGFIMLIVSSIGIYGTVSESK----PXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDFK-----------VLPASCCPPKVKVC--NFK---EAYPQGCFIALKKLVTSNVNYLIPI 637
            L+++  G  + +V  +G   TV ESK       I L +   + ++  ++       +K +VE++I +    ++   SNT  A    D++  ++KCCGV + LD+K            +P SCC   V  C  N K   + Y +GC   ++K V   +NY++ +
Sbjct:   57 LVVVAVGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNGTDSNT--ASRAIDYVQHQLKCCGVKNYLDWKDRPWFNHTGNNSVPISCCRSNVTHCDGNIKHPGDIYNEGCEAMVEKTVKDILNYVMRV 217          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000024581.1 (SMESG000024581.1)

HSP 1 Score: 284.648 bits (727), Expect = 2.347e-97
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 2
Query:   62 MNLTLKFYKXXXXXXXXXXXXXXXXXXXXXXXXXXXHTQFGSNTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDFKVLPASCCPPKVKVCNFKEAYPQGCFIALKKLVTSNVNYLIPIEXXXXXXXXXXXXXXXXXXRMIQQK 712
            MNLTLKFYKIFLILLNALFLVFALVLIVGGSIIIGSHTQFGSNTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPILIGLGITLLIMIIIQIVTCILIATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDFKVLPASCCPPKVKVCNFKEAYPQGCFIALKKLVTSNVNYLIPIEIISLLLKVLGIIIIVKYIRMIQQK
Sbjct:    1 MNLTLKFYKIFLILLNALFLVFALVLIVGGSIIIGSHTQFGSNTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPILIGLGITLLIMIIIQIVTCILIATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDFKVLPASCCPPKVKVCNFKEAYPQGCFIALKKLVTSNVNYLIPIEIISLLLKVLGIIIIVKYIRMIQQK 217          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000063435.1 (SMESG000063435.1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.923e-7
Identity = 48/156 (30.77%), Postives = 80/156 (51.28%), Query Frame = 2
Query:  170 HTQFGSNTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHN--KSSNTSGAFPIRDHINKKMKCCGVVSKLDF-KVLPASCCPPKVKVCNFKEAYPQGCFIALKKLVTSNVNYL 628
             TQ   ++  +  + II++G ++ IV+ +G  G + ESK +LI  G+ L++++I QI   I +   +  V   I +Q+    N  K++N + A  + D   +  +CCGV S  D+ K +P SCC     VCN   A+   C  A+   V S +  L
Sbjct:   40 STQLLGSSFSNAPIAIIVAGVVIFIVAFLGCCGAIQESKVMLIIFGVCLIVLLIAQIALSIAVYVYRSNVSTIIGKQMNDAVNIYKTTNDTAARALVDSTQQLFQCCGVNSTSDWGKTVPNSCCQNN-TVCNADTAFKTNCINAMVSKVQSQIGIL 194          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000009559.1 (SMESG000009559.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.872e-7
Identity = 46/153 (30.07%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  185 SNTLFHLG----LLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQLYVFHNKSSNTSGAFPIR----DHINKKMKCCGVVSKLDFKV----LPASCCPPKVKVCNFKEAYPQGCFIALKKLV 607
            SNTL +      + +I+ G ++ ++S +G+    SESK +L   G+ L++++I+Q    I+    + ++E SIK  L     K+        +     D I   +KCCGV S  D+++    +P SCCP K+  CN   AY  GC  ++K  +
Sbjct:   13 SNTLSNWQSGAPVFVIIVGVLVSLISVLGMAAACSESKCLLATFGMILILILILQFAAAIMAFMARSKMESSIKGLLEKALKKAYTKEKTGKVNTLFFDRIQDDLKCCGVTSVHDYEMIQKPIPESCCPNKIS-CNNNTAYNNGCSNSMKSAI 164          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019857.1 (SMESG000019857.1)

HSP 1 Score: 45.8246 bits (107), Expect = 8.548e-6
Identity = 38/137 (27.74%), Postives = 65/137 (47.45%), Query Frame = 2
Query:  188 NTLFHLGLLIILSGFIMLIVSSIGIYGTVSESKPXXXXXXXXXXXXXXXXXXXXXXXATMKKQVEKSIKEQL-YVFHNKSSNTSGAFPIRDHINKKMKCCGVVSKLDFK-VLPASCCPPKVKVCNFKEAYPQGCFIA 592
            N++  +  ++I  GFI L V+ +G  GT+ ++  IL+     L  M++ ++   I     + Q+  ++K  L  V  N+++       + D +  K  CCG+    D+   LP+SCC P    C    A P GC  A
Sbjct:   53 NSMAPIPFILIALGFIFLAVTVVGFLGTIMKNWIILVTYAGLLGSMVLTEVGAAITCGVFQTQMYSTVKLGLKNVIANQTA-------VMDSVQNKFGCCGINGYQDYNGTLPSSCC-PSTNACTAGLAAPTGCLSA 181          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tsp47F1.444e-731.62gene:FBgn0033629 transcript:FBtr0088151[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tspan3a2.338e-625.00tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan3a2.338e-625.00tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan3a2.338e-625.00tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
B0VZ559.600e-628.57Tetraspanin OS=Culex quinquefasciatus OX=7176 GN=6... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tspan3a1.432e-726.32tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
tspan3a1.554e-726.32tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
tspan3a6.055e-725.00tetraspanin 3 [Source:NCBI gene;Acc:103046031][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tspan3a9.412e-826.38tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024581.12.347e-97100.00SMESG000024581.1[more]
SMESG000063435.11.923e-730.77SMESG000063435.1[more]
SMESG000009559.15.872e-730.07SMESG000009559.1[more]
SMESG000019857.18.548e-627.74SMESG000019857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014684 ID=SMED30014684|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=750bp
CGATCTTAAAAAGGAGAATTTCCAGCCAATCAGTTAATCTCACCGAAAAG
CACATTGTGAAATGAATCTCACTCTAAAGTTTTACAAAATATTTCTGATA
CTGTTAAATGCATTATTTTTGGTCTTTGCATTGGTACTAATTGTAGGCGG
GTCAATAATAATAGGGTCCCATACGCAATTTGGAAGCAATACTTTGTTTC
ATCTTGGCCTTCTCATTATTCTTTCTGGATTTATTATGCTAATCGTTTCT
TCCATCGGTATCTACGGTACGGTATCTGAGAGTAAACCGATTTTGATTGG
GTTGGGTATCACGCTGCTGATCATGATCATCATCCAGATTGTGACATGCA
TCCTAATAGCTACGATGAAGAAACAAGTCGAAAAATCTATAAAAGAACAG
TTGTACGTATTCCACAATAAGTCTTCCAATACATCCGGAGCATTTCCGAT
CCGCGACCACATTAATAAAAAGATGAAATGCTGCGGCGTGGTTTCAAAAC
TCGATTTCAAAGTTCTGCCGGCCAGCTGCTGTCCACCAAAAGTAAAAGTC
TGTAACTTCAAGGAAGCCTATCCGCAGGGATGCTTCATAGCTTTAAAGAA
ACTAGTGACAAGCAATGTGAATTATTTGATCCCGATTGAAATTATAAGTC
TTCTCTTGAAGGTCTTGGGAATCATCATTATTGTAAAGTACATTCGTATG
ATTCAGCAGAAGTAATTGAAAGTTGCTGATTATACATATAAATTTTGGCA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000224cement gland
PLANA:0000231vitelline gland
PLANA:0000232copulatory apparatus
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 45..71
score: 22.7
coord: 10..33
score: 22.7
coord: 72..100
score: 23.04
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..217
e-value: 4.5E-25
score: 85.8
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 100..184
e-value: 3.9E-7
score: 31.8
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 103..185
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 9..206
e-value: 1.4E-23
score: 83.8
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 7..209
NoneNo IPR availablePANTHERPTHR19282:SF273TETRASPANINcoord: 7..209
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 100..185
e-value: 3.10706E-9
score: 50.5807
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 10..32