Group XV phospholipase A2

Overview
NameGroup XV phospholipase A2
Smed IDSMED30014682
Length (bp)1340
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Group XV phospholipase A2 (SMED30014682) t-SNE clustered cells

Violin plots show distribution of expression levels for Group XV phospholipase A2 (SMED30014682) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Group XV phospholipase A2 (SMED30014682) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Group XV phospholipase A2 (SMED30014682) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014682

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014682SMESG000010284.1 dd_Smed_v4_3058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014682SMESG000010284.1 dd_Smed_v6_3058_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 206.068 bits (523), Expect = 2.972e-61
Identity = 124/376 (32.98%), Postives = 207/376 (55.05%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C    +S+ T W++L+   P  IDC I+ ++L Y+ ++ +T  P   +  +PGFGK  ++ +L   K+   SY++ ++  LV    YT   ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+  L  L    Q WK KYIR F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W PEK  V T   N+T+++  +  +       +    D     E    P V++HC+    VPT     Y S  FPD  PK    DGDGTV+L S + C  W+++Q  +V   ++   +H +M+ N  TL  + ++L
Sbjct:   39 PVVLVPGDLGNQLEAK-LDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 172.17 bits (435), Expect = 3.938e-48
Identity = 114/377 (30.24%), Postives = 194/377 (51.46%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIK-EDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  W C+   + F T W+DL  F P  +DC I+  ++ Y+ S+         +  +PGFGK  ++ YL + K    + Y + + + + NN Y  +  +R APYD+R  P + + ++ ++  L+EEM+     K V +IGHS G L LL  L    Q WK ++I  FIS+ AP+ GS+     + SG      ++S++KL++ +    +  +M P    WPE  + + T  FN+T ++        +    +  +    +      AP VEV+C+    +PT     Y  G FP + P  +  EDGD TV+  S  +C  W+ +Q Q V    +  ++H +MV +  TL+ ++ IL
Sbjct:   48 PVILVPGCLGNQLEAK-LDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSK---LAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMH-AAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLPTPRTYIYDHG-FPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLEHINAIL 418          
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 124.405 bits (311), Expect = 9.472e-32
Identity = 82/261 (31.42%), Postives = 142/261 (54.41%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSP--------------------NELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW 865
            PV+L PG  G+Q+ +K +++P +  + C    +S+ T W++L+   P  IDC I+ ++L Y+ ++ +T  P   +  +PGFGK  ++ +L   K+   SY++ ++  LV    YT   ++RGAPYD+R++P                    +E  P+FL ++ +IEEMY+      VV++ HS GN+  L  L    Q WK KYIR F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W
Sbjct:   39 PVVLVPGDLGNQLEAK-LDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAPTQWFRLQDPSHLTPAWLWPADENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTW 296          
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 114.005 bits (284), Expect = 9.390e-28
Identity = 62/199 (31.16%), Postives = 101/199 (50.75%), Query Frame = 2
Query:  674 QTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            Q WK KYIR F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W PEK  V T   N+T+++  +  +       +    D     E    P V++HC+    VPT     Y S  FPD  PK    DGDGTV+L S + C  W+++Q  +V   ++   +H +M+ N  TL  + ++L
Sbjct:  119 QAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 315          
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 111.694 bits (278), Expect = 1.539e-27
Identity = 72/235 (30.64%), Postives = 123/235 (52.34%), Query Frame = 2
Query:  227 CHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISE 925
            C+   + F T W+DL  F P  +DC I+  ++ Y+ S+         +  +PGFGK  ++ YL + K    + Y + + + + NN Y  +  +R APYD+R  P + + ++ ++  L+EEM+     K V +IGHS G L LL  L    Q WK ++I  FIS+ AP+ GS+     + SG      ++S++KL++ +    +  +M P    WPE  + + T  FN+T ++   
Sbjct:    2 CYRKTEDFFTIWLDLNMFLPLGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSK---LAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMH-AAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQR 232          
BLAST of Group XV phospholipase A2 vs. Ensembl Celegans
Match: M05B5.4 (pep chromosome:WBcel235:I:7188465:7190581:1 gene:WBGene00010872.1 transcript:M05B5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M05B5.4)

HSP 1 Score: 193.356 bits (490), Expect = 8.694e-57
Identity = 120/383 (31.33%), Postives = 198/383 (51.70%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGX-XXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATF--LVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQW-KTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQI 1276
            PV+L PG GGSQ+ S    +P +  + C      +   W++L+ FTP  IDC  + ++L ++ +T  +      +  + GFG  +++ +L   K     Y+ +I++ +V    Y    N+ GAP+D+RKSPNEL  + +++K LIE  Y   + + +V++GHS GN L L  L N + Q WK KYI +F+S++AP++GS+   +   SG+    +  ++    LR M+ ++ S  ++ P P  W P + +  T   N+TV NI E  +  N    +E Y           +P V VHCI    VPT     +  G FPD  P     DGDGTV+  S  +C  W       +VT +++ +  H  ++K+   ++ V K + Q+
Sbjct:   35 PVILVPGDGGSQLESNLTGKPSVVHYVCSKQTADYFDLWLNLQLFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATESVEWLDKSKASQGRYFFDIVDSMVSWG-YRRGKNVIGAPFDWRKSPNELNDYLIQLKSLIETTYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFASGYNMNYYRVILPPSSLRAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFFQDINYMVGWEQYKQAARLNGNLSSPGVPVHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMGDGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELVRKAIFQL 416          
BLAST of Group XV phospholipase A2 vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0332971)

HSP 1 Score: 194.126 bits (492), Expect = 7.484e-57
Identity = 125/381 (32.81%), Postives = 194/381 (50.92%), Query Frame = 2
Query:  143 ELHPVLLFPGLGGSQIVSKYVERPKMWP---CHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            +L PV+  PG GGSQ+ ++ + +P   P   C   +  +  W+DL+      + C I+ +KL YD  T +T      ET IPG+G  + + ++   KN   +Y+ +I NELVK   Y    N+ GAPYDFRK+PNE +  F+ +K L+E+ YE  NQ +V  I HS G+L+ L  L   +  WK KY++  IS++  ++GS  A +    G    +F +SA  L+  + T PS  +++P P  W P + + +T   N+T+  + E  K  +    +E   D   Y    D PNVE+HC+    + T   L Y+       TPK I   GDGTV+  SL  C  W       +    ++ V H  ++ N   LK +  ++ Q
Sbjct:   43 KLSPVIFVPGDGGSQMDAR-LNKPNS-PYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQQ 420          
BLAST of Group XV phospholipase A2 vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0081364)

HSP 1 Score: 194.126 bits (492), Expect = 7.484e-57
Identity = 125/381 (32.81%), Postives = 194/381 (50.92%), Query Frame = 2
Query:  143 ELHPVLLFPGLGGSQIVSKYVERPKMWP---CHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            +L PV+  PG GGSQ+ ++ + +P   P   C   +  +  W+DL+      + C I+ +KL YD  T +T      ET IPG+G  + + ++   KN   +Y+ +I NELVK   Y    N+ GAPYDFRK+PNE +  F+ +K L+E+ YE  NQ +V  I HS G+L+ L  L   +  WK KY++  IS++  ++GS  A +    G    +F +SA  L+  + T PS  +++P P  W P + + +T   N+T+  + E  K  +    +E   D   Y    D PNVE+HC+    + T   L Y+       TPK I   GDGTV+  SL  C  W       +    ++ V H  ++ N   LK +  ++ Q
Sbjct:   43 KLSPVIFVPGDGGSQMDAR-LNKPNS-PYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQQ 420          
BLAST of Group XV phospholipase A2 vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0330662)

HSP 1 Score: 193.356 bits (490), Expect = 1.214e-56
Identity = 125/381 (32.81%), Postives = 194/381 (50.92%), Query Frame = 2
Query:  143 ELHPVLLFPGLGGSQIVSKYVERPKMWP---CHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            +L PV+  PG GGSQ+ ++ + +P   P   C   +  +  W+DL+      + C I+ +KL YD  T +T      ET IPG+G  + + ++   KN   +Y+ +I NELVK   Y    N+ GAPYDFRK+PNE +  F+ +K L+E+ YE  NQ +V  I HS G+L+ L  L   +  WK KY++  IS++  ++GS  A +    G    +F +SA  L+  + T PS  +++P P  W P + + +T   N+T+  + E  K  +    +E   D   Y    D PNVE+HC+    + T   L Y+       TPK I   GDGTV+  SL  C  W       +    ++ V H  ++ N   LK +  ++ Q
Sbjct:   43 KLSPVIFVPGDGGSQMDAR-LNKPNS-PYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQQ 420          
BLAST of Group XV phospholipase A2 vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0081365)

HSP 1 Score: 193.356 bits (490), Expect = 1.214e-56
Identity = 125/381 (32.81%), Postives = 194/381 (50.92%), Query Frame = 2
Query:  143 ELHPVLLFPGLGGSQIVSKYVERPKMWP---CHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            +L PV+  PG GGSQ+ ++ + +P   P   C   +  +  W+DL+      + C I+ +KL YD  T +T      ET IPG+G  + + ++   KN   +Y+ +I NELVK   Y    N+ GAPYDFRK+PNE +  F+ +K L+E+ YE  NQ +V  I HS G+L+ L  L   +  WK KY++  IS++  ++GS  A +    G    +F +SA  L+  + T PS  +++P P  W P + + +T   N+T+  + E  K  +    +E   D   Y    D PNVE+HC+    + T   L Y+       TPK I   GDGTV+  SL  C  W       +    ++ V H  ++ N   LK +  ++ Q
Sbjct:   43 KLSPVIFVPGDGGSQMDAR-LNKPNS-PYLICQKTHDWYNLWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQQ 420          
BLAST of Group XV phospholipase A2 vs. Ensembl Zebrafish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 204.142 bits (518), Expect = 4.514e-60
Identity = 124/376 (32.98%), Postives = 205/376 (54.52%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPI-VLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C+   + + T W++L+   P  IDC I+ ++L Y+ + H + PP   +  +PGFG+  ++ YL   K R    Y   I + + +  YT N ++RGAPYD+RK+PNE K +FLR++ +IEEM        VV+I HS GN+  L  LN+  Q WK +YI+ ++S+  P++G     + + +G  +   ++S LK+R  + T  S  +++PY   WP+  + V T    +TVQ+     K  +    +    D          P V VHC+    +PT    +Y +  FPD+ P  I  DGDGTV+L S + C +WK +Q Q V + ++   +H  M+ N  T+  + K+L
Sbjct:   96 PVVLIPGDLGNQLEAK-LDKPSVVHYICYKKTEDYFTLWLNLELLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPGFGETYSLEYLDPSK-RSVGMYFFTIVQSLVDWGYTRNDDVRGAPYDWRKAPNENKEYFLRLQQMIEEMAHKAG-GPVVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTLRVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQRFFKDIDYEDGWAMRQDTEPLVSALQPPGVPVHCLYGTGIPTPQGYNYTN--FPDTDPAVINGDGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKVL 466          
BLAST of Group XV phospholipase A2 vs. Ensembl Zebrafish
Match: lcat (lecithin-cholesterol acyltransferase [Source:ZFIN;Acc:ZDB-GENE-010716-3])

HSP 1 Score: 201.06 bits (510), Expect = 2.342e-59
Identity = 135/406 (33.25%), Postives = 218/406 (53.69%), Query Frame = 2
Query:   80 MLHSMPPFLLAFLIVIET-----IHCELHPVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKS-FLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRI-KEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            +LH    F L  +I   T     I+    P+++ PG  G+++ +K +++P +  W C+  ++  F  WIDL  F P  +DC I+ +++ Y+ +T  T      +  +PGFG+   I +L    N+ T Y++ ++  LV    Y  N  +RGAPYD+R +PNE + +F R+K+L+EEM++   Q  V ++GHS G+  +L  LN  +Q WK  YI+ FIS+ AP+ G+V   + + SG       VS +K+R+ +    +  +M+P    WP +   + T  FN+T Q+  +  K  N    +  ++D  N T    AP VEV+C+    +PT     Y   +FP++ P  I  +DGD TV   S+ +C +W  KQ Q V   + R + H DMV N  +L TV +IL
Sbjct:   20 LLHQTSGFWLFNVIFPPTAKPRVINNSTPPLIIVPGNLGNRLEAK-IDKPTLVHWMCYKKSEDWFPLWIDLNMFMPIGVDCWIDNIRIVYNRTTRKTSNAPGVDVRVPGFGQTHPIEFLD--LNKLTGYFHTMVQHLVSIG-YVRNETVRGAPYDWRIAPNEQEEYFSRLKNLVEEMHDEYKQ-PVYLLGHSMGSNYILYFLNQQTQDWKDHYIKGFISLGAPWGGAVKPLRVLASGENDGIPFVSNIKIREEQRMTTTNPWMIPSEETWPKDHTFISTPFFNYTNQDYMQFFKDINFEDGWYMWDDTRNLTAGLPAPGVEVYCLYGVGLPTPVTYIYDE-QFPNADPIDILYDDGDDTVDSRSMSLCKRWIGKQEQAVHVTEFRGMPHLDMVFNHKSLTTVQRIL 419          
BLAST of Group XV phospholipase A2 vs. Ensembl Xenopus
Match: PLA2G15 (phospholipase A2 group XV [Source:NCBI gene;Acc:100124780])

HSP 1 Score: 190.66 bits (483), Expect = 3.202e-55
Identity = 124/376 (32.98%), Postives = 206/376 (54.79%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPC-HSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C    N  F  W++L+   P  IDC I+ ++L Y+ ++ +T PP   +  +PGFG+  ++ +L   K    SY+  ++  LV    YT + N+RGAPYD+RK+PNE   +F+ ++ L+E M+E+  Q  VV++ HS GNL  L  LN  +Q WK KYI +F+++ AP+ G       + SG  +   ++S+L++R  + +  S  +++PY   WP EK  V T   N+T+++     +       +E   +        + P VEVHC+    V T     Y S  FPD  P  +   GDGTV+L S + C +W+ +Q Q+V+  ++   +H  M+ N  T+  V K+L
Sbjct:   60 PVVLVPGDLGNQLEAK-LDKPAVVHYMCSKKTNYYFTLWLNLELLLPVVIDCWIDNIRLVYNKTSKTTAPPEGVDIRVPGFGQTYSLEFLDPSKRSVGSYFYTLVQSLVDWG-YTRDENVRGAPYDWRKAPNENSDYFVALRKLVESMFES-YQSPVVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPWGGVSKTLHVLASGDNNRIPVISSLRIRDQQRSAVSTNWLLPYNNTWPQEKVFVRTPNKNYTIKDYRVFYEDIGFQDGWEMRQETEGLISSLNPPGVEVHCLYGTGVDTPDSFLYDS--FPDKDPTTVYGGGDGTVNLESALQCGKWRNQQRQKVSLVELPGNEHIAMLSNISTISYVKKVL 430          
BLAST of Group XV phospholipase A2 vs. Ensembl Xenopus
Match: fam53c (family with sequence similarity 53 member C [Source:Xenbase;Acc:XB-GENE-988933])

HSP 1 Score: 184.496 bits (467), Expect = 5.961e-53
Identity = 125/377 (33.16%), Postives = 202/377 (53.58%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIK-EDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K V++  +  W C+     + T W++L  F P  IDC I+ +++ Y+ +T         +  +PGFGK  ++ YL   K    + Y + + + + NN Y  +  +R APYD+R +PN  K +F ++K LIEEM    N+ SV +IGHS GNL LL  LN+  Q WK KY++ FIS+ AP+ G+V     ++SG      +VS +K+R+ +    +  +M+P    WPE  + + T   N+T +N  ++         +  + D     E    P VEV+CI    +PT     Y  G FP+     IK  DGD TV   S+ +C +W ++Q Q+V  +++  ++H +MV +  TL  ++ IL
Sbjct:   50 PVVLVPGCFGNQLEAK-VDKEDVVNWMCYRKTDDYFTIWLNLNMFLPLGIDCWIDNIRVVYNKTTRMASNAPGVDVHVPGFGKTYSVEYLDKSK---LAGYFHTLVQNLVNNGYVRDQTVRAAPYDWRIAPNGQKEYFEKLKSLIEEMSNKYNE-SVFIIGHSLGNLYLLYFLNHQPQEWKDKYVKGFISLGAPWGGAVKPLLVLMSGDNHGIPMVSNIKIREEQRMTTTNPWMLPTNLGWPESHVFISTPSRNYTYKNYRKLFHDIGFEDGWYMWEDTKGLLEGLPPPGVEVYCIYGTGIPTPETYIYGEG-FPNEPAIDIKYSDGDDTVHTRSMELCKRWISQQKQKVHIHELPGIQHLNMVFSNETLTLINDIL 420          
BLAST of Group XV phospholipase A2 vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 195.282 bits (495), Expect = 3.282e-57
Identity = 124/386 (32.12%), Postives = 205/386 (53.11%), Query Frame = 2
Query:  131 TIHCELHP-VLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            T+  + HP V+L PG  G+Q+ +K +++PK+  + C     S+ T         P  IDC I+ ++L Y+ ++ +T  P   +  +PGFG+  ++ +L   K    SY+  ++  LV    YT   ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+ +L  L    Q WK KYI  F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W  EK  V T   N+T+++     +       +    D     E    P VE+HC+    VPT     Y S  FPD  PK    DGDGTV+L S++ C  W+++Q  RV+  ++   +H +M+ N  TL  + ++L +
Sbjct:   31 TLPAQRHPPVVLVPGDLGNQLEAK-LDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYG-GPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYES--FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLE 411          
BLAST of Group XV phospholipase A2 vs. Ensembl Mouse
Match: Lcat (lecithin cholesterol acyltransferase [Source:MGI Symbol;Acc:MGI:96755])

HSP 1 Score: 186.422 bits (472), Expect = 1.122e-53
Identity = 117/377 (31.03%), Postives = 199/377 (52.79%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTP-KRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+++ +K +++P +  W C+   + F T W+D   F P  +DC I+  ++ Y+ S+         +  +PGFGK +++ Y+ + K    + Y + + + + NN Y  +  +R APYD+R +P++   ++ ++  L+EEMY     K V +IGHS G L +L  L    Q+WK  +I  FIS+ AP+ GS+ A + + SG      ++S +KL++ +    +  +M+P P +WPE  + + T  FN+TVQ+        +    +  +    +  ER  AP VEV+C+     PT     Y    FP   P   + EDGD TV+  S  +C QW+ +Q Q V    + +  H +MV +  TL+ ++ IL
Sbjct:   48 PVILVPGCLGNRLEAK-LDKPDVVNWMCYRKTEDFFTIWLDFNLFLPLGVDCWIDNTRIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDNK---LAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMY-AAYGKPVFLIGHSLGCLHVLHFLLRQPQSWKDHFIDGFISLGAPWGGSIKAMRILASGDNQGIPILSNIKLKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQDFERFFTDLHFEEGWHMFLQSRDLLERLPAPGVEVYCLYGVGRPTPHTYIYDH-NFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETDHLNMVFSNKTLEHINAIL 418          
BLAST of Group XV phospholipase A2 vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 62.003 bits (149), Expect = 1.630e-10
Identity = 41/132 (31.06%), Postives = 72/132 (54.55%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPN 538
            PV+L PG  G+Q+ +K +++PK+  + C     S+ T         P  IDC I+ ++L Y+ ++ +T  P   +  +PGFG+  ++ +L   K    SY+   + E +    YT   ++RGAPYD+R++P 
Sbjct:   39 PVVLVPGDLGNQLEAK-LDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYF-YTMVESLVGWGYTRGEDVRGAPYDWRRAPT 168          
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q8NCC3|PAG15_HUMAN (Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 1.427e-60
Identity = 124/376 (32.98%), Postives = 207/376 (55.05%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C    +S+ T W++L+   P  IDC I+ ++L Y+ ++ +T  P   +  +PGFGK  ++ +L   K+   SY++ ++  LV    YT   ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+  L  L    Q WK KYIR F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W PEK  V T   N+T+++  +  +       +    D     E    P V++HC+    VPT     Y S  FPD  PK    DGDGTV+L S + C  W+++Q  +V   ++   +H +M+ N  TL  + ++L
Sbjct:   39 PVVLVPGDLGNQLEAK-LDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVL 409          
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q8VEB4|PAG15_MOUSE (Phospholipase A2 group XV OS=Mus musculus OX=10090 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.296e-56
Identity = 124/386 (32.12%), Postives = 205/386 (53.11%), Query Frame = 2
Query:  131 TIHCELHP-VLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            T+  + HP V+L PG  G+Q+ +K +++PK+  + C     S+ T         P  IDC I+ ++L Y+ ++ +T  P   +  +PGFG+  ++ +L   K    SY+  ++  LV    YT   ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+ +L  L    Q WK KYI  F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W  EK  V T   N+T+++     +       +    D     E    P VE+HC+    VPT     Y S  FPD  PK    DGDGTV+L S++ C  W+++Q  RV+  ++   +H +M+ N  TL  + ++L +
Sbjct:   31 TLPAQRHPPVVLVPGDLGNQLEAK-LDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYG-GPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYES--FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLE 411          
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q675A5|PAG15_RAT (Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.818e-55
Identity = 120/378 (31.75%), Postives = 202/378 (53.44%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQ 1273
            PV+L PG  G+Q+ +K +++PK+  + C     S+ T         P  IDC I+ ++L Y+ ++ +T  P   +  +PGFG+  ++ +L   K    SY+  ++  LV    YT   ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+ +L  L    Q WK KYI+ F+S+ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W  EK  V T   N+T+++     +       +    D     E    P VE+HC+    VPT     Y +  FPD  PK    DGDGTV+L S++ C  W+++Q  +V+  ++   +H +M+ N  TL  + ++L +
Sbjct:   39 PVVLVPGDLGNQLEAK-LDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYG-GPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYEN--FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLE 411          
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q6XPZ3|PAG15_CANLF (Phospholipase A2 group XV OS=Canis lupus familiaris OX=9615 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.563e-53
Identity = 119/376 (31.65%), Postives = 198/376 (52.66%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C    +S+ T         P  IDC I+ ++L Y+ ++ +T  P   +  +PGFGK  ++ +L   K+   SY++ ++  LV    Y    ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+  L  L    Q WK KYI+ F+++ AP+ G     + + SG  +   ++  LK+R+ + +  S  +++PY   W PEK  V T   N+T+++  +  +       +    D     E    P V +HC+    VPT     Y S  FPD  PK    DGDGTV+L S + C  W+  Q  +V+   +   +H +M+ N  TL  + ++L
Sbjct:   35 PVVLVPGDLGNQLEAK-LDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWG-YIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYG-GPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYES--FPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVL 405          
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Match: sp|Q8WMP9|PAG15_BOVIN (Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 6.708e-53
Identity = 119/376 (31.65%), Postives = 196/376 (52.13%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLTWIDLKFFT-PFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C      + T         P  IDC I+ ++L Y+ ++H+T  P   +  +PGFG   ++ +L   K+   SY  + + E + +  Y    ++RGAPYD+R++PNE  P+FL ++ +IEEMY+      VV++ HS GN+ +L  L +  Q WK KYIR F+++  P+ G     + + SG  +   ++ +LK+R  + +  S  +++PY   W P+K  V T K N+T+Q+  +  +       +    D     E    P V +HC+    VPT    DY S  FPD  PK     GDGTV+L S + C  W+  Q Q V+   +   +H  M+ N  TL  + ++L
Sbjct:   34 PVVLVPGDMGNQLEAK-LDKPSVVHYVCSKRTDHYFTLWLNLELLLPVIIDCWIDNVRLIYNQTSHTTQFPEGVDVRVPGFGDTFSMEFLDPSKSSVGSY-LHTMVESLVSWGYERGKDVRGAPYDWRRAPNENGPYFLALRKMIEEMYQLYG-GPVVLVAHSMGNMYMLYFLQHQPQDWKDKYIRAFVALGPPWGGVPKTLRVLASGDNNRIPVIRSLKIRAQQRSAVSTTWLLPYSYTWSPQKVFVRTPKANYTLQDYRQFFQDIGFKDGWSMRQDTEGLVEATVPPGVRLHCLYGTGVPTPESFDYES--FPDRDPKIHYGTGDGTVNLQSALHCHTWRGLQKQEVSLQALPGNEHIAMLANTTTLAYLKRVL 404          
BLAST of Group XV phospholipase A2 vs. TrEMBL
Match: A0A1B6CCH8 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.30129 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.981e-72
Identity = 137/383 (35.77%), Postives = 212/383 (55.35%), Query Frame = 2
Query:  146 LHPVLLFPGLGGSQIVSKYVERPKM-WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGN 1285
            +HP++L PG GGSQ+ +K  +   + + C      +   W++L+   P  IDC ++ ++LEYD  T +T  P   E  IPGFG   ++ +L   K    +Y+  I + LV    Y  N++LRGAPYDFRK+PNE +  F+  K LIEE YE  N+ +V+++ HS G+ + L+ L   +Q WK +YIR  +++S P+ GSV A +    G     +++    LR M+ T PSL +++P    W   + ++ T   N+T+ ++ +     + P A+E + DV  YT    AP VEVHC+    V T   L Y+ GKFP   P  +  DGDGTV+L SL  C QWKT+Q Q V      K+ H D++ +   L+ +  +L ++  N
Sbjct:   39 IHPIILVPGDGGSQVDAKLNKSSVVHYICEKTTSDYFNIWLNLELLVPLVIDCWVDNMRLEYDNITRTTHNPPGVELRIPGFGDPFSVEWLDPTKVSAGAYFKTIGDALVSLG-YERNISLRGAPYDFRKAPNENQDFFVNFKKLIEETYEMNNKSNVILVAHSMGSPMCLQFLQKQTQAWKDEYIRALVTLSGPWGGSVKAIKVFTVGDDLGVYILKESWLRDMQITSPSLAWLLPLKSFWNSSETLIETDTKNYTIDDLQDYFFDIDYPLAWEMWKDVEPYTRDFTAPGVEVHCLHGVGVQTVDRLAYKKGKFPYGYPNFVYGDGDGTVNLRSLEGCLQWKTQQKQPVYHQTFSKMDHMDILSDGRILQYITSLLPKLARN 420          
BLAST of Group XV phospholipase A2 vs. TrEMBL
Match: A0A132A4C3 (Phosphatidylcholine-sterol acyltransferase-like protein OS=Sarcoptes scabiei OX=52283 GN=QR98_0043040 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.410e-69
Identity = 131/369 (35.50%), Postives = 211/369 (57.18%), Query Frame = 2
Query:  167 PGLGGSQIVSKY--VERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIK-EDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHK 1261
            PG GGSQ+ ++    E P  +     N  F  W++L+   PF IDC ++ +KL YD  T ST      E  +PGFG    I Y+   +   + Y+  ++  L++   Y   VN+RGAPYDFRK+PNEL+ + + +K LIEE YE  +Q+ V+++ HS G LL+LR  N   Q+WK +++++FI++ AP+ G+V + ++ +SG      +  +L +R  E T+PSL Y++P   ++    I++ T+   +T++N  ++ +  N P  +E +NDV N T   +AP VEV+CI      T   + Y   +FPD  P RI+  DGDGTV++ SL  C +W+ +Q Q V  Y I+ + H  ++ +   L  + K
Sbjct:   15 PGDGGSQLEARLNKTEVPHYFCVKQTNDYFSVWLNLELLVPFVIDCWVDNMKLIYDNKTRSTKDNVGVEIRVPGFGNTTTIEYVDTSRLPISEYFGLMVENLIEEFGYERGVNIRGAPYDFRKAPNELQDYLVSMKRLIEETYERNHQQRVMIVCHSMGCLLMLRFFNLQKQSWKNQFVQSFITLGAPWGGAVKSVKAFISGDNFGVIVAPSLTIRDDERTFPSLAYLLPNSNVFDSNLILVETRDRKYTIRNYDQLFRDINYPVGHEMWNDVKNLTYTLEAPGVEVYCIYGTGSDTMKKIIYERNRFPDEQPDRIEYGDGDGTVNIESLSACKRWQREQRQPVHHYPIKNLDHMKVLSDINILNNLKK 383          
BLAST of Group XV phospholipase A2 vs. TrEMBL
Match: E0VY54 (1-O-acylceramide synthase precursor, putative OS=Pediculus humanus subsp. corporis OX=121224 GN=8233030 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 5.100e-68
Identity = 139/410 (33.90%), Postives = 220/410 (53.66%), Query Frame = 2
Query:   80 MLHSMPPFLLAFLIVIETIH-CE---LHPVLLFPGLGGSQIVSK--------YVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDY-RSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            M + +   ++ F++++  I  C     +PV+L PG GGSQI +K        YV R K       +  F  W++L+   P  IDC ++ +KL YD +T +T+     ET IPGFG    + ++   K    +YY +I   LV    Y  ++N+RGAPYDFRK PNE + +F ++  L+EE Y     KSVV+I HS G  +   +L  ++Q WK KYI+  + +S  + G+V A +    G    T+++    +++M+ + PSL ++MP    W E  I++ T + N+TV N  +  K  N    +E + DV+ + +  + P VEVHC+  Y V TT  L Y +   FP + P  IK DGDGTV+  SL  C  W+T Q Q+V      K+ H ++++++  L  +  +L
Sbjct:    1 MFNLLNQCVIGFILIVLCIQLCSSSIRYPVILIPGDGGSQINAKLNKTTYVHYVCRTKT------SDYFNLWLNLELLVPVVIDCWVDNIKLRYDNNTRTTYNTEGVETEIPGFGNSSVVEWIDPSKASPGAYYKDIAQALVSKG-YVRDLNIRGAPYDFRKGPNENQDYFTKLIQLVEETYAMNGNKSVVLIAHSMGGPMAYSMLQKVNQKWKDKYIKALVGLSGAWGGAVKALKVYTVGDNLGTYVLKESIVKEMQISSPSLAWLMPSKLFWKENEILIQTFQKNYTVNNYEDFFKDINFEVGWEMFKDVSPFRDHFEPPGVEVHCLHGYGVDTTEKLVYTKPNDFPSNYPSLIKGDGDGTVNRRSLEACIHWQTMQSQKVFHVAFPKLNHMNILRDDNVLNYLFTVL 403          
BLAST of Group XV phospholipase A2 vs. TrEMBL
Match: A0A212EML1 (1-O-acylceramide synthase OS=Danaus plexippus plexippus OX=278856 GN=KGM_210892 PE=4 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.710e-67
Identity = 134/363 (36.91%), Postives = 210/363 (57.85%), Query Frame = 2
Query:  101 FLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQW-KTKQ 1174
            FLL F +  +       PV+L PG GGSQ+ +K V +  +  + C   +  F   W++L+   PF IDC I+ ++LEY+  T  T  P+  E  +PG+G  + + +L    +   +Y+N I + LVK   Y  NV+LRGAPYDFRK+PNE    F+++K L+E+ Y   N+ +V ++ HS G  + L+ L   SQ+WKT++IR  IS+S P+ G+V A +    G    + ++S   LR  + T+PSL +++P   LW P + +V T K+N+T+ ++ ++     +P A+E   D   Y+    AP VE+HCI  Y++ T   LDY+ G + D  P  +  DGDGTV+L SL  C +W KT++
Sbjct:   10 FLLTFSLFAQN-SLGFSPVILIPGDGGSQLEAK-VNKTNVVHYICAKTSNDFYNVWLNLELLVPFVIDCWIDNVRLEYNNVTRKTNNPQGVEIRVPGWGNPEPVEWLDPSHDSEGAYFNTIGDALVKMG-YVRNVSLRGAPYDFRKAPNENGEFFVKLKTLVEDTYAMNNKTAVTLLVHSMGGAMALQFLQLQSQSWKTQHIRRMISLSTPWGGAVKALKVFAIGDDLGSMMLSPSTLRAQQITYPSLAWLLPSTRLWGPHELLVTTDKYNYTINDLQKLFNDMELPNAWEMRRDTEKYSSDMAAPGVELHCIYGYNISTVERLDYKPGTWLDGKPNLVFGDGDGTVNLRSLSYCERWGKTRR 369          
BLAST of Group XV phospholipase A2 vs. TrEMBL
Match: A0A2R7WWA1 (Uncharacterized protein OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS013348 PE=4 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.837e-67
Identity = 135/391 (34.53%), Postives = 211/391 (53.96%), Query Frame = 2
Query:  119 IVIETIHCELHPVLLFPGLGGSQIVSKYVERPKM-WPCHSFNKSF-LTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGN 1285
            + + +I C+ + +   PG GGSQ+ +K  +   + + C    K F + W+D++   P+ IDC ++ +KL YD  T  TF     ET +PGFG    + YL   +   T  Y  +I + + +  YT  +NL GAP+DFRK P+EL   F  +  LIE  Y+      VV+I HS G  L +  L+  SQ WK KYI++ IS+S  Y+GSV A +    G     +L++  KL++++ T PS  ++MP+  +W +  +V T   N+++ NI +     + P  YE + +  ++      P VEVHC+    V T   L Y+S KFPD  P  I EDGDGTV+L SL  C QW  +Q Q V      K +H  ++K++   + ++ I+  I+G+
Sbjct:    3 VFLWSIVCDQYLLTGLPGDGGSQLEAKLNKTSTVHYYCDKTTKDFFIIWLDVQMLLPYIIDCWVDNIKLNYDTDTKKTFNQPGVETRVPGFGDPTKVEYLDPSRLAITGDYFKLIGQALVSLGYTGGINLHGAPFDFRKGPSELGEFFKNLTTLIETTYKNNGNSKVVLIAHSMGGPLSIIFLHRQSQAWKDKYIKSLISLSGAYAGSVKALKVFAIGDDLGVYLLNENKLKQVQVTMPSSAFLMPHDLIWGDDILVETATKNYSLNNIKDFFYDIDFPVGYEMFLNERSFNRDFSPPGVEVHCLYGQGVSTIKKLVYKSNKFPDD-PLFIYEDGDGTVNLRSLESCKQWIKQQKQPVHTQGFDKSEHMGILKDQ---RIINYIVQYISGH 389          
BLAST of Group XV phospholipase A2 vs. Ensembl Cavefish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 204.527 bits (519), Expect = 7.922e-61
Identity = 127/377 (33.69%), Postives = 206/377 (54.64%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTP-KRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ +K +++P +  + C+     + T W++L+   P  IDC I+ ++L Y+++TH T  P   +  +PGFG+   + YL   K R    Y   I + + +  YT + ++RGAPYD+RK+PNE K +FL+++ +IEEM E      VV+I HS GN+  L  LN+  Q WK KYI+ F+S+  P++G     + + SG  +   ++S LK+R  + T  S  ++ PY   WP   +++ T K N+TV +     K  N    +    D        +AP V VHC+    +PT     Y  G FPD+ P K +  +GDGTV++ S + C +WK++Q Q V   ++   +H  M+ N  T+  +  +L
Sbjct:   44 PVVLIPGDLGNQLEAK-LDKPSVVHYICYKKTDEYFTLWLNLELLVPVAIDCWIDNMRLIYNSTTHLTEAPPGVDVQVPGFGQTFGLEYLDPSK-RSVGIYFFTIVQAMVDWGYTRDEDVRGAPYDWRKAPNENKQYFLKLQQMIEEMAEKYG-GPVVLIAHSMGNMYTLYFLNHQPQAWKDKYIKAFVSLGPPWAGVAKTLRVMASGDNNRIPVISPLKIRTQQRTAVSTAWLFPYAHTWPSDMVLVSTPKANYTVSDYQRFFKDLNYKDGWSMREDTEPLVSALEAPGVAVHCLYGTGIPTAQ--SYIYGTFPDAEPTKVVNGEGDGTVNVLSAVQCKRWKSQQKQPVQLLELPGNEHVAMLLNITTVSYIKSVL 415          
BLAST of Group XV phospholipase A2 vs. Ensembl Cavefish
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:103041308])

HSP 1 Score: 186.422 bits (472), Expect = 9.781e-54
Identity = 121/379 (31.93%), Postives = 200/379 (52.77%), Query Frame = 2
Query:  146 LHPVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKS-FLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTP-KRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            L P+++ PG  G+++ +K +++P +  W C+  ++  F  WIDL  F P  +DC I+ +++ Y+ +T  T      E   PGFG+   + +L N K    + Y + + + + N  Y  N  +R APYD+R +PNE   +F ++K L+EEM++   Q  V ++GHS G+  +L  LN  SQ WK ++I++FIS+ AP+ G+V   + + SG      LVS +K+R+ +    +  +M+P    W  E   + T  FN+T Q+        +    +  + D  N T     P VEV+C     +PT     Y   +FP+S P   + +DGD TV   S+ +C +W  KQ Q V   + + + H D+V N   L T+ +IL
Sbjct:   44 LPPLIIVPGNLGNRLEAK-IDKPSLVHWLCYKKSEDWFPLWIDLNMFMPIGVDCWIDNMRIVYNRTTRKTSNAPGVEVRAPGFGQTYTVEFLDNNK---LAGYFHTMLQHLVNMGYVRNETVRAAPYDWRIAPNEQDEYFSQLKRLVEEMHDEYKQ-PVHLLGHSMGSNYILYFLNQQSQAWKDRFIKSFISLGAPWGGAVKPLRVLASGDNDGIPLVSNIKIREEQRMTTTNPWMIPSEEAWYKEHVFISTPFFNYTNQDYQRFFTDIHFEDGWHMWEDTRNLTAGLPTPGVEVYCFYGVGLPTPVTYIYDE-EFPNSDPIDFVYDDGDDTVDSRSMRMCQRWIGKQEQPVYVTEFKGLPHLDIVFNHNVLTTIQEIL 416          
BLAST of Group XV phospholipase A2 vs. Ensembl Sea Lamprey
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 182.57 bits (462), Expect = 4.002e-53
Identity = 119/385 (30.91%), Postives = 198/385 (51.43%), Query Frame = 2
Query:  140 CELHPVLL--FPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGF--KSATFLVSALKLRKMESTWPSLYYMMPYPGLWP-EKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKR-IKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            C  HP  L   PG  G+Q+ ++ +++P +  + C      + T W++L+   P  IDC I+ ++LEY+ +T +T  P   +  +P FGK   + +L +  N     Y + + E ++   Y  N ++RGAPYD+RK+PNE   +   +K++IEEMY T     VV++ HS GN  +   L   SQ WK K+I +F+++  P+ G+    + + SG    +   ++S LK+R  + T  S  +++PY   WP +K +V T K N+T ++  +       P  +    D  +Y   +  P V VHC+    V T     Y    FPD  P R I  DGDGTVSL S ++C +W  +Q Q V   ++   +H  M+     ++ +  ++
Sbjct:   45 CPSHPPTLSSVPGDLGNQLEAR-LDKPAVVHYLCTKKTDYYFTLWLNLELLVPLVIDCWIDNMRLEYNLTTRATSSPNGVQVRVPDFGKTFPVEFL-DPSNVSVGSYFHTLVEAMEGWGYKRNQDIRGAPYDWRKAPNENGEYLTNLKNMIEEMYAT-YWSPVVLVAHSMGNPYMRYFLGQQSQAWKDKFIHSFVALGPPWGGAAKTLRVLTSGTGDNNGIPVISTLKIRAQQRTAVSTSWLLPYNTSWPPDKVLVSTPKRNYTNRDYRDFYNDIGYPEGWLMRQDTESYLYGQPLPGVPVHCLYGTGVATPDSFVYDK-SFPDHDPTRVITADGDGTVSLASALLCREWAGRQPQPVLLRELPGAEHVSMLSRADLIQYIKGVI 425          
BLAST of Group XV phospholipase A2 vs. Ensembl Nematostella
Match: EDO33966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ2])

HSP 1 Score: 182.956 bits (463), Expect = 4.045e-53
Identity = 116/368 (31.52%), Postives = 181/368 (49.18%), Query Frame = 2
Query:  149 HPVLLFPGLGGSQIVSKYVERP--KMWPCH-SFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLW-PEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTE--RRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKN 1234
            +PV++ PG GGSQI +K + +P  K W CH +++  F  W+   F  P  IDC ++ ++L YD +T +       ET +PGFG  + I YL     R    Y   + + + +  Y    NLR APYDFR +P+    +++R++ LIE+ Y    +K V ++ HS G    L  LN  S  WK KYI+ ++++S  + G+    +   SG      LV+ L +R  + T  S  +M+P   LW  ++ +V T    +TV++  +  +    P       ++ N T    + APNV +HC+    V T     Y  G+FPD  P     DGDGTV+  SL  C  W  +Q   V       V H  ++ +
Sbjct:   34 NPVVIVPGTGGSQIEAK-LNKPTTKHWYCHNTWSDYFTLWLQESFLLPMFIDCWVDNMRLVYDPATKTVHNSPGVETRVPGFGDTNTIEYLDK---RNLIAYFAPLVKAMVSWGYERGKNLRAAPYDFRYAPDSQADYYIRLRQLIEDTYTQNGEKQVTLLSHSLGCPYTLVFLNQQSTAWKDKYIKQWVALSGVWGGTTQLVRLFASGDAFGIPLVNPLTVRVEQRTCSSNNFMLPSRELWRSDEVLVTTPDRKYTVRDFEDYFRDVGYPDGIPVRRNLENLTAPLLQHAPNVTLHCLHGSGVDTEESYTYGKGEFPDEQPTIRNGDGDGTVNARSLRACATWVNRQGYDVVVKDYAGVNHNGILSD 397          
BLAST of Group XV phospholipase A2 vs. Ensembl Nematostella
Match: EDO47377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN6])

HSP 1 Score: 171.785 bits (434), Expect = 5.004e-49
Identity = 111/386 (28.76%), Postives = 193/386 (50.00%), Query Frame = 2
Query:  101 FLLAFLIV---IETIHCELHPVLLFPGLGGSQIVSKYVER-PKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSG--FKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEK-PIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNE 1237
            F L++L++   +   +C+  P+LL PG GGS++ +K  +     + C   N  F  W+ L+   P  IDC  + ++L YD        P   +  +P FGK  ++AYL    +    Y+  +I+ LV    YT + NLR AP+DFR +P+     +   + L+E+M+  G  + V+V+ HS G       L+ + Q WK KY+  +++I   + G+    + + SG       F+++ LK+R    T+ S  +++P    W  K P++ T K N+++ N  E +   N P   +    +         PNV ++C+    VPT    +++ G+FPD+ PK    DGDGTV+  SL  C Q++  Q + V   +  K +H  ++ ++
Sbjct:    9 FTLSYLLLASLVSKTYCK-PPILLVPGDGGSRLDAKLNKTTAPHYVCKRINDWFHIWLSLEELLPEVIDCWSDDMRLVYDEKHKRMTSPPGVQIRVPDFGKTSSVAYLDPTIDHPGEYFAPLIDALVSIG-YTKDKNLRAAPFDFRYAPDSAGEFYAYFQALVEQMFMEGGGEPVLVVSHSLGVPYTKYFLDRIHQEWKDKYLHAWVTIGGAWGGAAKLFRIISSGTNLGFPDFILNPLKMRVGLRTYESTTFLLPSEKFWDVKEPVIFTPKKNYSLSNFEEFLDDLNFPLG-KTIKGLVPPVWSDHPPNVTLYCLYGTGVPTPRTFEFKEGQFPDTYPKTNFGDGDGTVNRKSLEGCFQYEKTQKRPVVTRQFPKAEHMAIIGDK 391          
BLAST of Group XV phospholipase A2 vs. Ensembl Medaka
Match: pla2g15 (phospholipase A2 group XV [Source:NCBI gene;Acc:101172239])

HSP 1 Score: 208.764 bits (530), Expect = 1.759e-62
Identity = 128/376 (34.04%), Postives = 202/376 (53.72%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKSFLT-WIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            PV+L PG  G+Q+ ++ + +P +  + C+    SF T W++L+   PF IDC I+ ++L Y+ +T ++  P      +PGFGK  ++ YL   K      Y   I + +    YT + ++RGAPYD+RK+PNE K +FL+++ +IEEM E      VV+I HS GN+  L  LN   Q WK KYI+ FI +  P++G     + + SG  +   ++S LK+R  + T  S  +++PY   W +  +++ T   N+TVQ+   + K       +    D          PNVEVHC+    + T+    Y S  FPD  P  +  DGDGTV+L S + C +W  +Q Q V   ++R  +H DM+ N  T+  + K+L
Sbjct:   45 PVVLIPGDLGNQLEAR-LNKPSVVHYICYKKTDSFFTLWLNLELLVPFAIDCWIDNIRLIYNRTTRTSEAPPGVFVRVPGFGKTFSLEYLDPSKQS-VGMYFFSIVQSMVEWGYTRDDDVRGAPYDWRKAPNENKEYFLKLQQMIEEMAEKAG-GPVVLIAHSMGNMYTLYFLNQQPQAWKDKYIKAFICLGPPWAGVAKTLRVIASGDNNRIPVISPLKIRTQQRTAVSTNWLLPYAHSWSKDQVLIRTPSVNYTVQDYRRLYKDIGFDDGWLMRQDTEPLVSDLLPPNVEVHCLYGSGINTSEAFHY-SNNFPDEEPTVVNGDGDGTVNLRSAIQCKRWVGQQKQPVFLKELRGNEHVDMLTNYTTVAYIKKVL 416          
BLAST of Group XV phospholipase A2 vs. Ensembl Medaka
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:101172491])

HSP 1 Score: 192.586 bits (488), Expect = 3.935e-56
Identity = 128/389 (32.90%), Postives = 205/389 (52.70%), Query Frame = 2
Query:  122 VIETIHCELHPVLLFPGLGGSQIVSKYVERPKM--WPCHSFNKS---FLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVL-TKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTP-KRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKIL 1267
            V ET +    P+++ PG  G+++ +K +++P +  W C  F KS   F  WIDL  F P  +DC I+ ++L Y+ +T  +      +  +PGFG+   I +L +Y N   + Y + + E + N  Y  N  +RGAPYD+R +PNE   +F+R++ L+EEMY    QK V ++GHS G   +L  LNN  Q WK  YIR FIS+ AP+ G+V   + + SG      ++S +KLR+ +    +  +M+P    WP+  + + T   N+T Q+   +    +    +  + D  N T     P VEV C+    +PT  V       FP++ P   +  DGD TV   S+ +C +W+ +Q + V   + R + H DMV +E  L  + +IL
Sbjct:   36 VKETSNNNTSPLIIVPGSLGNRLEAK-IDKPALVHWMC--FKKSDHWFPIWIDLNMFMPIGVDCWIDNIRLVYNKTTRRSSNSPGVQVRVPGFGETYTIEFL-DYNN--LAGYFHSMVEHLVNVGYVRNETVRGAPYDWRLAPNENSEYFIRLQELVEEMYNQ-YQKPVYLLGHSMGGHYVLYFLNNQPQAWKDTYIRGFISLGAPWGGAVKVLRVMTSGNNDGIPMLSNIKLREEQRMMTTNPWMLPSEDAWPKDHVFISTPSVNYTNQDYKRLFTDIDFENGWHMWEDTKNLTGALHPPGVEVWCMYGVGLPTP-VTHIYDEDFPNADPVDYVYADGDDTVDSFSMSLCKRWEGQQEKPVHVTEYRGLAHLDMVFHEKVLHQIQQIL 416          
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Match: SMESG000010284.1 (SMESG000010284.1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 399/403 (99.01%), Postives = 402/403 (99.75%), Query Frame = 2
Query:   80 MLHSMPPFLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGNC 1288
            MLHSMPPFLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCET+IPGFGKLDNIAYLSNYKNRWTSYYNNIINELVKNNNYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGNLLLLRLLNNLSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYR+GKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQ QRVTF+KIRKVKHFDMVKNEFTLKTVHKILCQINGNC
Sbjct:    1 MLHSMPPFLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETTIPGFGKLDNIAYLSNYKNRWTSYYNNIINELVKNNNYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGNLLLLRLLNNLSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRAGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQAQRVTFHKIRKVKHFDMVKNEFTLKTVHKILCQINGNC 403          
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Match: SMESG000010286.1 (SMESG000010286.1)

HSP 1 Score: 376.711 bits (966), Expect = 4.253e-128
Identity = 194/384 (50.52%), Postives = 262/384 (68.23%), Query Frame = 2
Query:  134 IHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGN 1285
            +   LHPVLL PG GGS + +KY+E+PK  PC++ NK+FL WID  +F P TI C+INLLKLEY+    +T   + CE   PGFG +D I YL+  K +   Y+  I+ EL + +NY  N NLRGAPYDFRK+PNE+K +F  VK+LIE+M+E    KSVV+IGHS GNLL+L L+N ++Q WK KYIRTFISISAP++GS++  Q++LSG+  + F ++ LKLRKMESTWPS YYM+P   +WP+ PIVLTKK NFT  ++ E+  LS + ++  H++D   Y   +  P VE HCIIS    T   L+Y   +FP+S P+    +GDGTV LHSLMICP WK KQ + VT   I  V H  +++N+ T++ +  I+ +IN N
Sbjct:   14 VKGHLHPVLLVPGWGGSHVTAKYIEKPKELPCNAINKTFLLWIDPLYFLPPTIHCVINLLKLEYNPINRTTNSQKFCEIYSPGFGTVDTIEYLTACKIKIAIYFAAIVKELTEKHNYKVNDNLRGAPYDFRKAPNEMKNYFFNVKNLIEKMHEKARGKSVVLIGHSLGNLLILELMNQMTQNWKDKYIRTFISISAPFAGSMIPVQAILSGYSGSAFFLNDLKLRKMESTWPSFYYMLPKSKMWPDGPIVLTKKRNFTANDLRELFVLSGIKYSPNHFDDQKKYLSIQPPPKVETHCIISTGEKTPLTLNYLGKQFPESQPENTFGNGDGTVPLHSLMICPLWKKKQSKTVTLNVINGVSHSKILRNKETIRVLRNIMRKINHN 397          
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Match: SMESG000010287.1 (SMESG000010287.1)

HSP 1 Score: 298.901 bits (764), Expect = 1.036e-97
Identity = 160/395 (40.51%), Postives = 238/395 (60.25%), Query Frame = 2
Query:  101 FLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGN 1285
             +L FL       C+ HP+LL PG GGSQ+   +++ P  + C   NK FL W++  F  P ++DC +  ++LEY++++  T+ P  CE   PGFG L+ I YLS+ + + TSYY  II ELV + NYT + ++RG PYDFRKSPN +      +K LIE MY       V++IGHS GNL L  +LN++SQ WK KYI+TFISIS PY G++ A ++ LSG      +++ +++RK +++WPS Y++MP PGLW  + IV TKK  +T   I++++K S +P A + Y D          P   VHCI + +  T  +LDY+   FPD  P     +GDGTV+L SL +C  W   Q + VT + +  V H +++++E T++ +  I+  IN N
Sbjct:    5 LILVFLFCFNEFWCK-HPILLVPGDGGSQLYGYFLKTPLHYVCGRQNKWFLLWLNPYFMLPISLDCFVETIRLEYNSTSRRTYSPDCCEVYAPGFGTLEPIEYLSSIRIKKTSYYYYIIKELVDSLNYTPDADIRGVPYDFRKSPNHMGQLKRDMKSLIENMYTENGNLPVILIGHSLGNLYLNLILNSVSQEWKNKYIKTFISISGPYHGAIDALRTALSGNNEHIPIINPIRVRKAQASWPSTYFLMPTPGLWSNQTIVATKKGYYTTNTIADLLKASGIPNAVDLYKDTIQIQNDLHPPRTSVHCIYTNNYKTPVLLDYQLVNFPDDQPSIKYGNGDGTVNLESLEVCSNWNRSQTEPVTTFIVPDVSHLEILRDERTIRYLTSIIENINKN 398          
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Match: SMESG000010287.1 (SMESG000010287.1)

HSP 1 Score: 299.671 bits (766), Expect = 2.271e-97
Identity = 160/395 (40.51%), Postives = 238/395 (60.25%), Query Frame = 2
Query:  101 FLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQINGN 1285
             +L FL       C+ HP+LL PG GGSQ+   +++ P  + C   NK FL W++  F  P ++DC +  ++LEY++++  T+ P  CE   PGFG L+ I YLS+ + + TSYY  II ELV + NYT + ++RG PYDFRKSPN +      +K LIE MY       V++IGHS GNL L  +LN++SQ WK KYI+TFISIS PY G++ A ++ LSG      +++ +++RK +++WPS Y++MP PGLW  + IV TKK  +T   I++++K S +P A + Y D          P   VHCI + +  T  +LDY+   FPD  P     +GDGTV+L SL +C  W   Q + VT + +  V H +++++E T++ +  I+  IN N
Sbjct:   49 LILVFLFCFNEFWCK-HPILLVPGDGGSQLYGYFLKTPLHYVCGRQNKWFLLWLNPYFMLPISLDCFVETIRLEYNSTSRRTYSPDCCEVYAPGFGTLEPIEYLSSIRIKKTSYYYYIIKELVDSLNYTPDADIRGVPYDFRKSPNHMGQLKRDMKSLIENMYTENGNLPVILIGHSLGNLYLNLILNSVSQEWKNKYIKTFISISGPYHGAIDALRTALSGNNEHIPIINPIRVRKAQASWPSTYFLMPTPGLWSNQTIVATKKGYYTTNTIADLLKASGIPNAVDLYKDTIQIQNDLHPPRTSVHCIYTNNYKTPVLLDYQLVNFPDDQPSIKYGNGDGTVNLESLEVCSNWNRSQTEPVTTFIVPDVSHLEILRDERTIRYLTSIIENINKN 442          
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 194.897 bits (494), Expect = 2.251e-57
Identity = 123/380 (32.37%), Postives = 204/380 (53.68%), Query Frame = 2
Query:  152 PVLLFPGLGGSQIVSKYVERPKMWPCHSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIPGFGKLDNIAYLSNYKNRWTSYYXXXXXXXXXXXXYTANVNLRGAPYDFRKSPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGXXXXXXXXXXXSQTWKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWPSLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVTNYTERRDAPNV--EVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTVSLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKN-EFTLKTVHKILCQING 1282
            P++L PG GGS+  S    R        F    L W++ ++    ++  + N+ KLEY+ + H T   +  +   PG+G  + I  L    +  T+Y++N+++ LV +  Y  N  +RGAPYDFRK+PNE +     +K LIE+ Y     + VV++GHS G+L  L     ++ +WK +YIR F+S+S P  G+V A     SG +S     S +  R+M+ ++PS  +++P P ++ ++P ++T   N++  +  ++ K  ++P+    YND  N  +  + P    E++CI SY +PTT  L +++  FPD  P+    DGD TV++ SL IC +WK      V ++ I+   H  +V   EF LK    +  Q NG
Sbjct:   35 PIILIPGDGGSRAYSNVDYR-------IFTTKVLVWVNFEYMVFPSL--LRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSG-ESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA--FPDGQPQFTTGDGDYTVNIQSLKICEKWKN-----VNYFTIKGADHMQIVSTPEFMLKLKQILYRQPNG 397          
The following BLAST results are available for this feature:
BLAST of Group XV phospholipase A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLA2G152.972e-6132.98phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT3.938e-4830.24lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
PLA2G159.472e-3231.42phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
PLA2G159.390e-2831.16phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT1.539e-2730.64lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M05B5.48.694e-5731.33pep chromosome:WBcel235:I:7188465:7190581:1 gene:W... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG188587.484e-5732.81gene:FBgn0042175 transcript:FBtr0332971[more]
CG188587.484e-5732.81gene:FBgn0042175 transcript:FBtr0081364[more]
CG316831.214e-5632.81gene:FBgn0051683 transcript:FBtr0330662[more]
CG316831.214e-5632.81gene:FBgn0051683 transcript:FBtr0081365[more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g154.514e-6032.98phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat2.342e-5933.25lecithin-cholesterol acyltransferase [Source:ZFIN;... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PLA2G153.202e-5532.98phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
fam53c5.961e-5333.16family with sequence similarity 53 member C [Sourc... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pla2g153.282e-5732.12phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
Lcat1.122e-5331.03lecithin cholesterol acyltransferase [Source:MGI S... [more]
Pla2g151.630e-1031.06phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Group XV phospholipase A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NCC3|PAG15_HUMAN1.427e-6032.98Phospholipase A2 group XV OS=Homo sapiens OX=9606 ... [more]
sp|Q8VEB4|PAG15_MOUSE2.296e-5632.12Phospholipase A2 group XV OS=Mus musculus OX=10090... [more]
sp|Q675A5|PAG15_RAT3.818e-5531.75Phospholipase A2 group XV OS=Rattus norvegicus OX=... [more]
sp|Q6XPZ3|PAG15_CANLF2.563e-5331.65Phospholipase A2 group XV OS=Canis lupus familiari... [more]
sp|Q8WMP9|PAG15_BOVIN6.708e-5331.65Phospholipase A2 group XV OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Group XV phospholipase A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6CCH83.981e-7235.77Uncharacterized protein OS=Clastoptera arizonana O... [more]
A0A132A4C31.410e-6935.50Phosphatidylcholine-sterol acyltransferase-like pr... [more]
E0VY545.100e-6833.901-O-acylceramide synthase precursor, putative OS=P... [more]
A0A212EML11.710e-6736.911-O-acylceramide synthase OS=Danaus plexippus plex... [more]
A0A2R7WWA11.837e-6734.53Uncharacterized protein OS=Oncopeltus fasciatus OX... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g157.922e-6133.69phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat9.781e-5431.93lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pla2g154.002e-5330.91phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO339664.045e-5331.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473775.004e-4928.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g151.759e-6234.04phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
lcat3.935e-5632.90lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Group XV phospholipase A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010284.10.000e+099.01SMESG000010284.1[more]
SMESG000010286.14.253e-12850.52SMESG000010286.1[more]
SMESG000010287.11.036e-9740.51SMESG000010287.1[more]
SMESG000010287.12.271e-9740.51SMESG000010287.1[more]
SMESG000037748.12.251e-5732.37SMESG000037748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014682 ID=SMED30014682|Name=Group XV phospholipase A2|organism=Schmidtea mediterranea sexual|type=transcript|length=1340bp
ACAAAATGGTCACTGCCTTGTTATTTATGTATTCTAGTTTAAATAATTGA
CGGTAGCTCTTTGACCTATTTCTATACAAATGTTACATTCTATGCCTCCA
TTTTTATTAGCATTTCTCATTGTTATAGAAACAATCCACTGCGAACTGCA
TCCCGTCTTACTTTTTCCGGGATTAGGAGGATCGCAGATAGTATCAAAAT
ATGTAGAAAGACCGAAAATGTGGCCATGCCATTCATTCAACAAATCGTTC
TTAACTTGGATTGATTTGAAATTTTTCACCCCTTTCACCATTGACTGTAT
TATAAATCTCCTCAAATTAGAATACGATGCTTCAACACATTCGACTTTTC
CACCAAGAAACTGTGAAACCTCAATTCCGGGATTCGGCAAGTTGGACAAT
ATTGCATATTTGTCGAATTATAAAAATCGATGGACCTCATATTACAATAA
CATCATTAATGAATTGGTAAAGAATAACAATTACACAGCAAACGTCAACC
TTCGTGGAGCTCCGTATGATTTCAGGAAGAGTCCAAATGAGCTGAAGCCT
CATTTTCTCAGAGTAAAACATTTGATTGAAGAAATGTACGAAACTGGAAA
CCAGAAATCTGTCGTCGTCATTGGTCATAGTTACGGGAATCTTCTCTTAT
TGAGATTGTTGAATAACTTGTCACAAACGTGGAAAACAAAATACATTCGA
ACATTTATAAGCATTAGTGCACCTTATTCCGGTTCTGTGATGGCTGCTCA
AAGTGTCTTGTCGGGATTCAAGTCAGCTACATTTTTGGTTAGTGCTTTGA
AACTTCGAAAAATGGAAAGCACTTGGCCAAGTCTTTATTATATGATGCCA
TATCCCGGACTGTGGCCAGAAAAACCAATCGTTTTGACTAAGAAATTTAA
TTTTACCGTTCAAAATATTTCGGAAATGATAAAATTATCAAATGTTCCTT
TTGCTTATGAGCATTATAATGACGTTACTAATTACACTGAGAGACGCGAC
GCTCCTAATGTTGAGGTCCATTGTATCATTAGCTATGACGTCCCAACTAC
TGGAGTTCTTGATTATCGGTCAGGAAAGTTTCCTGATTCAACACCGAAAA
GGATTAAAGAGGATGGCGATGGAACCGTTTCATTGCACTCATTGATGATC
TGTCCCCAGTGGAAGACCAAGCAAGTCCAAAGAGTGACATTTTATAAAAT
TAGAAAAGTCAAACATTTTGACATGGTCAAGAATGAATTCACCTTGAAAA
CTGTGCACAAGATTTTGTGCCAAATAAATGGCAACTGTTGATAAATATAA
ACTTTTCTGTAATTGCTTAAATAAAATTATTCTTGTAAAA
back to top

protein sequence of SMED30014682-orf-1

>SMED30014682-orf-1 ID=SMED30014682-orf-1|Name=SMED30014682-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=404bp
MLHSMPPFLLAFLIVIETIHCELHPVLLFPGLGGSQIVSKYVERPKMWPC
HSFNKSFLTWIDLKFFTPFTIDCIINLLKLEYDASTHSTFPPRNCETSIP
GFGKLDNIAYLSNYKNRWTSYYNNIINELVKNNNYTANVNLRGAPYDFRK
SPNELKPHFLRVKHLIEEMYETGNQKSVVVIGHSYGNLLLLRLLNNLSQT
WKTKYIRTFISISAPYSGSVMAAQSVLSGFKSATFLVSALKLRKMESTWP
SLYYMMPYPGLWPEKPIVLTKKFNFTVQNISEMIKLSNVPFAYEHYNDVT
NYTERRDAPNVEVHCIISYDVPTTGVLDYRSGKFPDSTPKRIKEDGDGTV
SLHSLMICPQWKTKQVQRVTFYKIRKVKHFDMVKNEFTLKTVHKILCQIN
GNC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR003386LACT/PDAT_acylTrfase
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0008374O-acyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003386Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferasePFAMPF02450LCATcoord: 59..286
e-value: 2.0E-40
score: 139.2
coord: 303..384
e-value: 6.5E-7
score: 28.9
NoneNo IPR availablePANTHERPTHR11440:SF47GROUP XV PHOSPHOLIPASE A2coord: 22..397
NoneNo IPR availablePANTHERPTHR11440LECITHIN-CHOLESTEROL ACYLTRANSFERASE-RELATEDcoord: 22..397
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.76
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 24..385