Charged multivesicular body protein 2a

Overview
NameCharged multivesicular body protein 2a
Smed IDSMED30014670
Length (bp)752
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Charged multivesicular body protein 2a (SMED30014670) t-SNE clustered cells

Violin plots show distribution of expression levels for Charged multivesicular body protein 2a (SMED30014670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Charged multivesicular body protein 2a (SMED30014670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Charged multivesicular body protein 2a (SMED30014670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014670SMESG000005024.1 Contig2278GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30014670SMESG000005024.1 dd_Smed_v4_1335_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 250.751 bits (639), Expect = 9.696e-84
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 250.751 bits (639), Expect = 9.696e-84
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 250.751 bits (639), Expect = 9.696e-84
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 234.187 bits (596), Expect = 4.078e-78
Identity = 111/151 (73.51%), Postives = 136/151 (90.07%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDAL 454
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAM 151          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Match: CHMP2A (charged multivesicular body protein 2A [Source:HGNC Symbol;Acc:HGNC:30216])

HSP 1 Score: 190.66 bits (483), Expect = 4.643e-60
Identity = 104/142 (73.24%), Postives = 126/142 (88.73%), Query Frame = 2
Query:  119 EKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSN 544
            EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LS+
Sbjct:    2 EKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSS 143          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Match: vps-2 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9U2F6])

HSP 1 Score: 256.144 bits (653), Expect = 5.268e-86
Identity = 130/185 (70.27%), Postives = 165/185 (89.19%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPS 556
            M+FLFG+RKTP +++R+NQRALNK IRELDRERAR+E +EKKVI DIK MAK+ QMD+VK+MAKDLVRTR Y+KKFI+MKANIQAVSLK+QTL+S +AMA AMKGVT+ MQ MN+ +NLPQ+QKIMMEFE++S IM+MKEE+M D IDDALG+ GDEEE++++VNQVLDELGI++ + ++ + PS
Sbjct:    1 MDFLFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKVIADIKNMAKKNQMDSVKVMAKDLVRTRRYIKKFIVMKANIQAVSLKVQTLKSQDAMASAMKGVTKAMQSMNRQLNLPQIQKIMMEFEKQSEIMDMKEEVMGDAIDDALGDAGDEEETDQIVNQVLDELGIQMGEEMAGL-PS 184          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Match: C01A2.4 (pep chromosome:WBcel235:I:13392118:13394001:1 gene:WBGene00007216.1 transcript:C01A2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01A2.4)

HSP 1 Score: 107.842 bits (268), Expect = 1.558e-28
Identity = 73/187 (39.04%), Postives = 110/187 (58.82%), Query Frame = 2
Query:   11 LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNID--PSKES 565
            +F K   P+++ R N+R L KT R+L+ +R +++  EK++  +IKK+A +G  DA + +AK LV+ RN   K I M A I  V  +   ++S   M  AM    +TM+ MN  M L ++   M EF+     M + EEMM DT+D  L   GD +E + +VNQVLDE+GIE+   L+N+   P+K S
Sbjct:    3 IFSK-PDPKELERANKRELRKTNRDLESDRRQMDRREKELEQEIKKLAAKGHNDAARHLAKQLVQLRNQKTKSIGMSARISGVQAQNSHMQSMAKMGSAMGTTVKTMKAMNAQMPLEKVAANMREFQMAQEKMGLTEEMMNDTLDSILDAPGDADEQDAIVNQVLDEIGIEMNSKLANVPALPTKVS 188          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 85.1149 bits (209), Expect = 5.728e-20
Identity = 49/146 (33.56%), Postives = 89/146 (60.96%), Query Frame = 2
Query:   11 LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDD 448
            LFGK+K P++ +RE QR + + +R LDR+   ++ EE+KV  +IK+ AK+G  D   I+AK ++++R  + K  + KA I +V + +Q   +T  MA +++  T  M+ M + + +P++ K M E   E   + + EEM+ +T++ 
Sbjct:    3 LFGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLES 148          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 85.1149 bits (209), Expect = 5.728e-20
Identity = 49/146 (33.56%), Postives = 89/146 (60.96%), Query Frame = 2
Query:   11 LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDD 448
            LFGK+K P++ +RE QR + + +R LDR+   ++ EE+KV  +IK+ AK+G  D   I+AK ++++R  + K  + KA I +V + +Q   +T  MA +++  T  M+ M + + +P++ K M E   E   + + EEM+ +T++ 
Sbjct:    3 LFGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLES 148          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Match: vps-24 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9GYK4])

HSP 1 Score: 85.1149 bits (209), Expect = 5.728e-20
Identity = 49/146 (33.56%), Postives = 89/146 (60.96%), Query Frame = 2
Query:   11 LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDD 448
            LFGK+K P++ +RE QR + + +R LDR+   ++ EE+KV  +IK+ AK+G  D   I+AK ++++R  + K  + KA I +V + +Q   +T  MA +++  T  M+ M + + +P++ K M E   E   + + EEM+ +T++ 
Sbjct:    3 LFGKKKDPKEEVRELQRKMRQEMRSLDRQVYSIQREEQKVTKEIKEAAKKGDKDVCLILAKSMIQSRKAISKIHVSKAQINSVIMCMQEQLATIRMAGSLQKSTEVMKSMQQLVKVPEIMKTMREMSAEMMKLGIIEEMIEETLES 148          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Match: Vps2 (gene:FBgn0039402 transcript:FBtr0084967)

HSP 1 Score: 236.113 bits (601), Expect = 7.506e-78
Identity = 122/191 (63.87%), Postives = 165/191 (86.39%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M++LFGK+ +P++M+R+NQRALNK +R+LDRER ++E +EKK+I DIKKMAK+GQMDAVKIMAKDLVRTR Y KKF+LMKANIQAVSLKIQTL+S N MAQAMKGVT+ MQ MN+ +NLPQ+QKI+ +FE++S +M+MKEEM+ D IDDA+ +EGDEEE++ +V+QVLDELG+++ + L ++  +  S+ +
Sbjct:    1 MDWLFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPSASGSLSI 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Match: CHMP2B (gene:FBgn0035589 transcript:FBtr0077166)

HSP 1 Score: 95.1301 bits (235), Expect = 1.384e-23
Identity = 71/185 (38.38%), Postives = 115/185 (62.16%), Query Frame = 2
Query:   11 LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKES 565
            +FGK+ T ++  REN R+L K  R+++RER ++E EE+K+  +I++ A  G  DA +I+AK LV  R    +       IQ++  + + + +  A+++AM    +TM  MNK M    + + + +F+  +  MEM +EM+ DT+DD L E GDEEES  +VN+VLDE+GIEI+  +S+I  +  S
Sbjct:    5 IFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRRNAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIALSEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDDMLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSS 189          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Match: Chmp1 (gene:FBgn0036805 transcript:FBtr0345383)

HSP 1 Score: 65.855 bits (159), Expect = 7.710e-13
Identity = 34/124 (27.42%), Postives = 70/124 (56.45%), Query Frame = 2
Query:  155 KQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEI 526
            ++G MD  +I A++ +R +N    ++ M A + AV+ ++Q+  +T  +  +M GV + M    K MNL ++  +M +FE +   ++++  +M  T+ D +     + + + L+ QV DE G+E+
Sbjct:   43 QKGNMDVARIHAENAIRQKNQAVNYLRMSARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTVTTSVPQGDVDNLLQQVADEAGLEL 166          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Match: Chmp1 (gene:FBgn0036805 transcript:FBtr0075092)

HSP 1 Score: 65.855 bits (159), Expect = 7.710e-13
Identity = 34/124 (27.42%), Postives = 70/124 (56.45%), Query Frame = 2
Query:  155 KQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEI 526
            ++G MD  +I A++ +R +N    ++ M A + AV+ ++Q+  +T  +  +M GV + M    K MNL ++  +M +FE +   ++++  +M  T+ D +     + + + L+ QV DE G+E+
Sbjct:   43 QKGNMDVARIHAENAIRQKNQAVNYLRMSARVDAVASRVQSALTTRKVTGSMAGVVKAMDAAMKGMNLEKISSLMEKFESQFEDLDVQSSVMEGTMSDTVTTSVPQGDVDNLLQQVADEAGLEL 166          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Match: Vps24 (gene:FBgn0037231 transcript:FBtr0078958)

HSP 1 Score: 63.929 bits (154), Expect = 6.225e-12
Identity = 49/170 (28.82%), Postives = 94/170 (55.29%), Query Frame = 2
Query:   11 LFGK--RKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDEL 514
            LFG+   K P++ ++E    + K   +LDR+   ++ EE+KV   +K+ A++   D   I+AK++V  R  + +    KA++ ++ ++++   ST  +A +++  T  +Q M   +  P+L  IM +  +E     + EEM+ +T+D     E  EEE+ K V++VL E+
Sbjct:    3 LFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQAAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDSLEESEELEEEASKEVDKVLWEI 172          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:798901])

HSP 1 Score: 258.84 bits (660), Expect = 3.710e-87
Identity = 138/191 (72.25%), Postives = 168/191 (87.96%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTPE+M+R+NQRALN+ +R+LDRER RLE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER+S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ ++D LSN+  +  S+ V
Sbjct:    1 MEFLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLSDELSNLPATGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Match: chmp2bb (charged multivesicular body protein 2Bb [Source:NCBI gene;Acc:405840])

HSP 1 Score: 113.235 bits (282), Expect = 2.804e-30
Identity = 74/185 (40.00%), Postives = 119/185 (64.32%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPS 556
            M  LF K+KT + +++E  + L  T R++ R+R  LE +EK++  +IKKMAK G  DA K++AK LV+ R    +   + + + ++S + + + S   MA AM   T+TMQ +NK M+  +  + +  F++E+  M+M EEMM DT+D+   + GDEEES+ +VNQVLDE+GIEI+  +++  PS
Sbjct:    1 MTSLF-KKKTVDDVIKEQNKELRGTQRQIARDRTALEKQEKQLEMEIKKMAKTGNRDACKVLAKQLVQVRKQKTRTYAVSSKVTSMSTQTKLMNSQMKMAGAMATTTKTMQAVNKKMDPKKTMQTLQNFQKETAKMDMTEEMMNDTLDEIFEDSGDEEESQDIVNQVLDEIGIEISGKMAHA-PS 183          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 103.219 bits (256), Expect = 1.579e-26
Identity = 68/176 (38.64%), Postives = 111/176 (63.07%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIA 529
            M  LF K+KT + +++E  + L  T R++ R+RA LE +E+++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  M M E+M+  T+D+   E  DEEE + +VNQVLDE+GIEI+
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEIS 175          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 103.219 bits (256), Expect = 1.579e-26
Identity = 68/176 (38.64%), Postives = 111/176 (63.07%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIA 529
            M  LF K+KT + +++E  + L  T R++ R+RA LE +E+++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  M M E+M+  T+D+   E  DEEE + +VNQVLDE+GIEI+
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEIS 175          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Match: chmp2ba (charged multivesicular body protein 2Ba [Source:ZFIN;Acc:ZDB-GENE-070628-3])

HSP 1 Score: 99.7525 bits (247), Expect = 3.145e-25
Identity = 65/176 (36.93%), Postives = 108/176 (61.36%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIA 529
            + F F  R   + +++E  + L  T R++ R+RA LE +E+++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  M M E+M+  T+D+   E  DEEE + +VNQVLDE+GIEI+
Sbjct:    1 LHFFFLPRPVTD-IIKEQSKELRGTQRQITRDRAALERQERQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKRMDPKKTLQTMQDFQKENMKMGMTEDMLNSTLDEIFDESADEEECQDIVNQVLDEIGIEIS 175          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Match: nelfa (negative elongation factor complex member A [Source:Xenbase;Acc:XB-GENE-988837])

HSP 1 Score: 256.529 bits (654), Expect = 3.817e-86
Identity = 137/191 (71.73%), Postives = 167/191 (87.43%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTPE+M+R+NQRALNK +RE+DRER +LE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFE++S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MEFLFGRRKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:NCBI gene;Acc:407966])

HSP 1 Score: 113.62 bits (283), Expect = 2.227e-30
Identity = 80/214 (37.38%), Postives = 122/214 (57.01%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGVRXXXXXXXXXXXTADGLPSPPSN 643
            M  LF K+KT + ++RE  + L  T R + R+RA LE +EK++  +IKKMAK G  DA +++AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M  F++E+  MEM EEM+ DT+DD      DEEES+ +VNQVLDE+GIEI+  ++   PS                   A GLPS  ++
Sbjct:    1 MASLF-KKKTVDDIIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKAGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDDEEESQDIVNQVLDEIGIEISGKMAKA-PS------------------AAKGLPSTSAS 194          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:NCBI gene;Acc:407966])

HSP 1 Score: 107.071 bits (266), Expect = 9.572e-28
Identity = 74/201 (36.82%), Postives = 114/201 (56.72%), Query Frame = 2
Query:   41 MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGVRXXXXXXXXXXXTADGLPSPPSN 643
            ++RE  + L  T R + R+RA LE +EK++  +IKKMAK G  DA +++AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M  F++E+  MEM EEM+ DT+DD      DEEES+ +VNQVLDE+GIEI+  ++   PS                   A GLPS  ++
Sbjct:   24 IIREQNKELRGTQRAITRDRAALEKQEKQLEMEIKKMAKAGNKDACRVLAKQLVQLRKQKTRTYAVSSKVTSMSTQTKVMSSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDASDDEEESQDIVNQVLDEIGIEISGKMAKA-PS------------------AAKGLPSTSAS 205          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Match: coq6 (coenzyme Q6 monooxygenase [Source:Xenbase;Acc:XB-GENE-945926])

HSP 1 Score: 60.8474 bits (146), Expect = 1.465e-10
Identity = 40/147 (27.21%), Postives = 82/147 (55.78%), Query Frame = 2
Query:   11 LFGK--RKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTID 445
            LFGK   + P+ ++ E    + K +R +DR+   ++ E++KV   IK+ AK+G  +A  I+AK++V ++  V K    KA++ +V + ++   +   ++ +++  T  M+ M   + +P++Q  M +  +E     + EEM+ DT +
Sbjct:    3 LFGKTQERPPKDLVNEWSLKIRKEMRVIDRQIRDIQREQEKVKRSIKESAKKGNREACVILAKEVVHSKKAVNKLYASKAHMNSVLMSMKNQLAVLRVSGSLQKSTEVMKAMQNLVKIPEIQATMRDLSKEMMKAGIIEEMLEDTFE 149          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Match: scube2 (signal peptide, CUB domain, EGF-like 2 [Source:Xenbase;Acc:XB-GENE-5945055])

HSP 1 Score: 58.9214 bits (141), Expect = 3.521e-10
Identity = 33/144 (22.92%), Postives = 81/144 (56.25%), Query Frame = 2
Query:  140 IKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            +KK  +Q  ++  ++ A++ +R +N    ++ M + + AV+ K+QT  +   + + M  VT+ + +   SM+L ++  +M +F+++   +++   +M D++  A+     +E+ + L+ Q+ +E G+E+ D L+ +     S+G
Sbjct:   28 VKKALQQKNVEVARVYAENAIRKKNEGLNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSSMDLQKVSAVMDKFDQQVQNLDVHTSVMEDSMSSAMTLTTPQEQVDNLIVQIAEENGLEVMDQLNQLPQGASSVG 171          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Match: Chmp2a (charged multivesicular body protein 2A [Source:MGI Symbol;Acc:MGI:1916203])

HSP 1 Score: 250.751 bits (639), Expect = 6.033e-84
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Match: Chmp2a (charged multivesicular body protein 2A [Source:MGI Symbol;Acc:MGI:1916203])

HSP 1 Score: 250.751 bits (639), Expect = 6.033e-84
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Match: Chmp2a (charged multivesicular body protein 2A [Source:MGI Symbol;Acc:MGI:1916203])

HSP 1 Score: 150.984 bits (380), Expect = 1.934e-45
Identity = 95/191 (49.74%), Postives = 123/191 (64.40%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDL++                                                  LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLLK--------------------------------------------------LPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 141          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Match: Chmp2b (charged multivesicular body protein 2B [Source:MGI Symbol;Acc:MGI:1916192])

HSP 1 Score: 108.997 bits (271), Expect = 1.291e-28
Identity = 73/189 (38.62%), Postives = 115/189 (60.85%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESI 568
            M  LF K+KT + +++E  R L  T R + R+RA LE +EK++  +IKKMAK G  +A +++AK LV  R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M  F++E+  MEM EEM+ DT+DD      DEEES+ +VNQVLDE+GIEI+  ++    +  S+
Sbjct:    1 MASLF-KKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSL 188          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Match: Chmp2b (charged multivesicular body protein 2B [Source:MGI Symbol;Acc:MGI:1916192])

HSP 1 Score: 102.449 bits (254), Expect = 3.398e-26
Identity = 67/176 (38.07%), Postives = 107/176 (60.80%), Query Frame = 2
Query:   41 MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESI 568
            +++E  R L  T R + R+RA LE +EK++  +IKKMAK G  +A +++AK LV  R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M  F++E+  MEM EEM+ DT+DD      DEEES+ +VNQVLDE+GIEI+  ++    +  S+
Sbjct:    9 VIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSL 184          
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Match: sp|Q6DFS6|CHM2A_XENTR (Charged multivesicular body protein 2a OS=Xenopus tropicalis OX=8364 GN=chmp2a PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.022e-85
Identity = 137/191 (71.73%), Postives = 167/191 (87.43%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTPE+M+R+NQRALNK +RE+DRER +LE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFE++S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MEFLFGRRKTPEEMLRQNQRALNKAMREMDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Match: sp|Q6IP52|CHM2A_XENLA (Charged multivesicular body protein 2a OS=Xenopus laevis OX=8355 GN=chmp2a PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 5.287e-85
Identity = 136/191 (71.20%), Postives = 167/191 (87.43%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFE++S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MEFLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Match: sp|Q7ZW25|CHM2A_DANRE (Charged multivesicular body protein 2a OS=Danio rerio OX=7955 GN=chmp2a PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 6.366e-85
Identity = 137/191 (71.73%), Postives = 167/191 (87.43%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            ME LFG+RKTPE+M+R+NQRALN+ +R+LDRER RLE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER+S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ ++D LSN+  +  S+ V
Sbjct:    1 MESLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLTLSDELSNLPATGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Match: sp|Q9DB34|CHM2A_MOUSE (Charged multivesicular body protein 2a OS=Mus musculus OX=10090 GN=Chmp2a PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 4.220e-83
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Match: sp|O43633|CHM2A_HUMAN (Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 4.656e-83
Identity = 132/191 (69.11%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            M+ LFG+RKTPE+++R+NQRALN+ +RELDRER +LE +EKK+I DIKKMAKQGQMDAV+IMAKDLVRTR YV+KF+LM+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER++ IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ + D LSN+  +  S+ V
Sbjct:    1 MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Match: A0A1I8HQW9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 1.155e-90
Identity = 140/190 (73.68%), Postives = 170/190 (89.47%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            +EFLFG++KTPE+M+R+NQRALN+ +R+LDRE+ R+E +EKKVI DIKK+AKQGQMDAVKIMAKDLVRTRNYVKKFILM+ANIQA+SLKIQTLRSTN MAQAMKGVT+TMQRMNK+MNLPQLQ+IM +FE+ES IM+MKEEMM+D IDDA+G + DEEE+E +V +VLDELGIE+   L+ I P   +IG
Sbjct:    3 LEFLFGRKKTPEEMLRQNQRALNRAMRDLDREKNRMEQQEKKVIADIKKLAKQGQMDAVKIMAKDLVRTRNYVKKFILMRANIQAISLKIQTLRSTNQMAQAMKGVTKTMQRMNKTMNLPQLQQIMAQFEKESEIMDMKEEMMSDAIDDAIGGDEDEEETEAVVTKVLDELGIELTGELAGIGPGASTIG 192          
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Match: A0A267G1A6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026328g1 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.345e-90
Identity = 140/190 (73.68%), Postives = 170/190 (89.47%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            +EFLFG++KTPE+M+R+NQRALN+ +R+LDRE+ R+E +EKKVI DIKK+AKQGQMDAVKIMAKDLVRTRNYVKKFILM+ANIQA+SLKIQTLRSTN MAQAMKGVT+TMQRMNK+MNLPQLQ+IM +FE+ES IM+MKEEMM+D IDDA+G + DEEE+E +V +VLDELGIE+   L+ I P   +IG
Sbjct:    2 LEFLFGRKKTPEEMLRQNQRALNRAMRDLDREKNRMEQQEKKVIADIKKLAKQGQMDAVKIMAKDLVRTRNYVKKFILMRANIQAISLKIQTLRSTNQMAQAMKGVTKTMQRMNKTMNLPQLQQIMAQFEKESEIMDMKEEMMSDAIDDAIGGDEDEEETEAVVTKVLDELGIELTGELAGIGPGASTIG 191          
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Match: A0A1I7YSN5 (Uncharacterized protein OS=Steinernema glaseri OX=37863 PE=4 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 9.265e-88
Identity = 137/191 (71.73%), Postives = 170/191 (89.01%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTP++++R+NQRALNK +RELDRERAR+E +EKKVI DIKKMAK GQMD+VK+MAKDLVRTR YVKKFI+MKANIQAVSLK+QTL+S +AMAQAMKGVT+ MQ MNK +NLPQ+QKIMMEFER+S IM+MKEEMM+D IDDA+ +EGDEEE++ +VNQVLDELGI++ + L+N+  +  +I  
Sbjct:    1 MEFLFGRRKTPQELLRQNQRALNKAMRELDRERARMEMQEKKVIADIKKMAKMGQMDSVKVMAKDLVRTRRYVKKFIMMKANIQAVSLKVQTLKSQDAMAQAMKGVTKAMQSMNKQLNLPQIQKIMMEFERQSEIMDMKEEMMSDAIDDAMADEGDEEETDAIVNQVLDELGIQMNEELANLPNAAGTIAA 191          
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Match: A0A1I8HTX5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 2.567e-87
Identity = 135/191 (70.68%), Postives = 166/191 (86.91%), Query Frame = 2
Query:    2 MEF-LFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            M F LFG++KTPE+M+R+NQRALN+ +R+LDRER RLE +EKKVI D+KK+AKQGQMDAVKIMAKDLVRTR+Y+KKFI+M+ANIQA+SLKIQTLRSTN MAQAMKGVT TMQRMN+SMNLPQLQ+IM +FE+ES +M+MKEE+M+D IDDA+G   DEE S+ +V +VLDELGIE+   L+ I P   +IG
Sbjct:    1 MPFSLFGRKKTPEEMLRQNQRALNRAMRDLDRERGRLEQQEKKVIADMKKLAKQGQMDAVKIMAKDLVRTRSYIKKFIMMRANIQAISLKIQTLRSTNQMAQAMKGVTLTMQRMNQSMNLPQLQQIMAQFEKESEMMDMKEEVMSDAIDDAIGNTDDEEASDAVVTKVLDELGIEMTGQLAGIGPGSSTIG 191          
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Match: A0A4U8UQ12 (Uncharacterized protein OS=Steinernema carpocapsae OX=34508 GN=L596_002350 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 5.382e-87
Identity = 135/182 (74.18%), Postives = 167/182 (91.76%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNI 547
            MEFLFG+RKTP++++R+NQRALNK +RELDRER+R+E +EKKVI DIKKMAK GQMD+VK+MAKDLVRTR YVKKFI+MKANIQAVSLK+QTL+S +AMAQAMKGVT+ MQ MNK +NLPQ+QKIMMEFER+S IM+MKEEMM D IDDA+ +EGDEEE++ +VNQVLDELGI++++ L+N+
Sbjct:    1 MEFLFGRRKTPQELLRQNQRALNKAMRELDRERSRMEMQEKKVIADIKKMAKMGQMDSVKVMAKDLVRTRRYVKKFIMMKANIQAVSLKVQTLKSQDAMAQAMKGVTKAMQSMNKQLNLPQIQKIMMEFERQSEIMDMKEEMMGDAIDDAMADEGDEEETDAIVNQVLDELGIQMSEELANL 182          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:103027439])

HSP 1 Score: 256.529 bits (654), Expect = 2.645e-86
Identity = 137/191 (71.73%), Postives = 167/191 (87.43%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFG+RKTPE+M+R+NQRALN+ +R+LDRER RLE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+M+ANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFER+S IM+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ ++D LS +  +  S+ V
Sbjct:    1 MEFLFGRRKTPEEMLRQNQRALNRAMRDLDRERQRLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFERQSEIMDMKEEMMNDAIDDAMGDEDDEEESDAVVSQVLDELGLNLSDELSGLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Match: chmp2bb (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103024321])

HSP 1 Score: 118.627 bits (296), Expect = 1.743e-32
Identity = 78/185 (42.16%), Postives = 119/185 (64.32%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPS 556
            M  LF K+KT + +++E  + L  T R++ R+RA LE +EK++  +IKKMAK G  DA KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M  F++E+  MEM EEMM DT+DD   + GDEEES+ +VNQVLDE+GIEI+  +++  PS
Sbjct:    1 MASLF-KKKTVDDVIKEQTKELRGTQRQITRDRAALEKQEKQLEMEIKKMAKSGNKDACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKLMHSQMKMAGAMGTTAKTMQAVNKKMDPQKTMQTMQNFQKETAKMEMTEEMMNDTLDDLFEDSGDEEESQDIVNQVLDEIGIEISGKMAHA-PS 183          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 110.923 bits (276), Expect = 3.339e-29
Identity = 73/183 (39.89%), Postives = 117/183 (63.93%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNID 550
            M  LF K+KT + +++E  + L  T R++ R+RA LE +EK++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  MEM E+M+ DT+D+   E GDEEE + +VNQVLDE+GIEI+  +  +D
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKVKKLD 182          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 110.923 bits (276), Expect = 3.339e-29
Identity = 73/183 (39.89%), Postives = 117/183 (63.93%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNID 550
            M  LF K+KT + +++E  + L  T R++ R+RA LE +EK++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  MEM E+M+ DT+D+   E GDEEE + +VNQVLDE+GIEI+  +  +D
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKVKKLD 182          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Match: chmp2ba (charged multivesicular body protein 2b [Source:NCBI gene;Acc:103032982])

HSP 1 Score: 109.383 bits (272), Expect = 5.442e-29
Identity = 74/189 (39.15%), Postives = 119/189 (62.96%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESI 568
            M  LF K+KT + +++E  + L  T R++ R+RA LE +EK++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  + M +F++E+  MEM E+M+ DT+D+   E GDEEE + +VNQVLDE+GIEI+  +     + +SI
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQMEMEIKKMAKTGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQTVNKKMDPKKTLQTMQDFQKENLKMEMTEDMINDTLDEIFNESGDEEECQDIVNQVLDEIGIEISGKMVKAPSAGKSI 188          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Sea Lamprey
Match: chmp3 (charged multivesicular body protein 3 [Source:NCBI gene;Acc:406621])

HSP 1 Score: 70.4774 bits (171), Expect = 5.776e-15
Identity = 47/147 (31.97%), Postives = 80/147 (54.42%), Query Frame = 2
Query:   11 LFGKR--KTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTID 445
            LFGK   K P +M+ E    L K +R +DR+   ++ EE+KV   +K  AK+ + +   I+AK+L+R+R  + K    KA + +V + ++   S   M+ A++  T  M+ M   + +P++Q  M E  +E     + EEMM DT +
Sbjct:    5 LFGKSSDKPPREMVNEWSTQLRKEMRGIDRQIRSIQREEEKVKRSLKDAAKKNEREVCVILAKELIRSRRAISKLHASKAQMNSVIMTMKNQLSLQKMSGALQRSTEVMKAMQSLVRVPEIQAAMRELSKEMMKAGIIEEMMDDTFE 151          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Yeast
Match: DID4 (Class E Vps protein of the ESCRT-III complex; required for sorting of integral membrane proteins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthesized vacuolar enzymes to the vacuole, involved in endocytosis [Source:SGD;Acc:S000001485])

HSP 1 Score: 171.4 bits (433), Expect = 1.501e-53
Identity = 87/180 (48.33%), Postives = 140/180 (77.78%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDAL-XXXXXXXXXXKLVNQVLDELGIEIADTL 538
             E++FGK  TP++ +++NQRAL +T REL+RE+ +LE ++KK++++IKK AK GQ+ A K+ AKDLVRTRNY++KF  MKA +QA+SL+IQ +RS++ M ++M   T  +  MN++MNLPQLQ+I MEFE++S++M  ++E M + ID+ +  E  ++EE++++VN+VLDE+G+++   L
Sbjct:    4 FEWVFGKNVTPQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFEKQSDLMGQRQEFMDEAIDNVMGDEVDEDEEADEIVNKVLDEIGVDLNSQL 183          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Yeast
Match: VPS24 (One of four subunits of the ESCRT-III complex; forms an endosomal sorting complex required for transport III (ESCRT-III) subcomplex with Did4p; involved in the sorting of transmembrane proteins into the multivesicular body (MVB) pathway [Source:SGD;Acc:S000001524])

HSP 1 Score: 50.447 bits (119), Expect = 3.741e-8
Identity = 38/138 (27.54%), Postives = 74/138 (53.62%), Query Frame = 2
Query:   41 MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDAL 454
            ++R+N R + K++REL      L+N+ +++I   KK AK+  +  V++ AK+L +      +    +A + +V +KI      N ++  M      M+ +N  + LPQL+  M+E E+E     MK  ++++ +DD +
Sbjct:   23 VLRKNGRNIEKSLREL----TVLQNKTQQLI---KKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKEL----MKSGIISEMVDDTM 149          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Nematostella
Match: EDO43581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY62])

HSP 1 Score: 253.062 bits (645), Expect = 2.397e-85
Identity = 132/190 (69.47%), Postives = 165/190 (86.84%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            +EFLFG++KTPE+M+++NQRALN+ +R+LDRER+++E +EKK+INDIKKMAK GQMDAV+IMAKDLVRTR YVKKFILMKANIQAVSLKIQTLRS NAMAQAMKGVT+ M  MN+ + LP++QKIMMEFE++S IM+MKEEMM D IDD +G+E D+EESEKLV QV DELG+++ D LS +  +   +G
Sbjct:    3 LEFLFGRKKTPEEMLKQNQRALNRAMRDLDRERSKMEQQEKKIINDIKKMAKMGQMDAVRIMAKDLVRTRRYVKKFILMKANIQAVSLKIQTLRSNNAMAQAMKGVTKAMATMNRQLKLPEIQKIMMEFEKQSEIMDMKEEMMNDAIDDVIGDEEDDEESEKLVQQVFDELGLQLTDELSGLPVTASGVG 192          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Nematostella
Match: EDO42022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L3])

HSP 1 Score: 123.635 bits (309), Expect = 5.930e-35
Identity = 75/171 (43.86%), Postives = 111/171 (64.91%), Query Frame = 2
Query:   32 PEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSN 544
            P++ MR+ +R LN+T REL R++  LE +EK++  +IKK+A+QG   A   +AK L++ R    K + + + I  +  + Q ++ST  MA AM   ++ M  MNK M+   LQK +  FERES  M+M EEMM +T+D  L E GDEEE + +VNQVLDELGIE+A  +++
Sbjct:    7 PKEQMRQQKRQLNRTQRELARDKNALERQEKQLEAEIKKLARQGNKQAATALAKQLLQLRKQKNKNMSVSSKITGIGYQAQAMQSTATMAGAMSKTSQAMGAMNKQMDPASLQKTLQNFERESAKMDMNEEMMGETLDSVLDESGDEEEQDAIVNQVLDELGIEMAGKMAS 177          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Nematostella
Match: EDO34240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPW3])

HSP 1 Score: 81.6481 bits (200), Expect = 3.119e-19
Identity = 53/146 (36.30%), Postives = 86/146 (58.90%), Query Frame = 2
Query:   11 LFGK--RKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTI 442
            LFG+  +KTP++ +RE    + K  R+LDR+   ++NEE KV   IK  AK+G  D   I+AK+++++R  V K    KA + +V ++++   +T  MA AM+  T  M  M K + LP++++ MME  +E     + EEM+ DT 
Sbjct:    3 LFGQTPKKTPKEQVREWCATVRKENRQLDRQIRAIQNEEMKVKRSIKDAAKRGDKDVCNILAKEIIQSRKAVNKMYSSKAQLNSVEMQMKNQLATLRMAGAMEKSTEVMSMMQKLVKLPEIRQTMMELSKEMMKAGIIEEMVEDTF 148          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Nematostella
Match: EDO41077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5F7])

HSP 1 Score: 58.151 bits (139), Expect = 2.028e-10
Identity = 33/124 (26.61%), Postives = 68/124 (54.84%), Query Frame = 2
Query:  155 KQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEI 526
            ++G M+  KI  ++ +R +N    F+ M + I AV+ ++QT  +   +  +M GV ++M    KSMNL ++  +M +FE++   ++++   M + +         + + + L+ QV DE G+E+
Sbjct:   42 QKGNMEGAKIHGENAIRQKNQSLNFMRMSSRIDAVAQRVQTAVTMKQVTSSMGGVVKSMDAALKSMNLEKVSALMDKFEKQFEDLDVQSAAMDNAMSSTTTLTVPQGQVDSLMQQVADEAGLEL 165          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:101157403])

HSP 1 Score: 254.988 bits (650), Expect = 1.064e-85
Identity = 136/191 (71.20%), Postives = 168/191 (87.96%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGV 574
            MEFLFGKRKTPE+M+R+NQRALN+ +R+LDRER +LE +EKK+I DIKKMAKQGQMDAVKIMAKDLVRTR YVKKFI+MKANIQAVSLKIQTL+S N+MAQAMKGVT+ M  MN+ + LPQ+QKIMMEFE++S +M+MKEEMM D IDDA+G+E DEEES+ +V+QVLDELG+ ++D LS++  +  S+ V
Sbjct:    1 MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAKQGQMDAVKIMAKDLVRTRRYVKKFIMMKANIQAVSLKIQTLKSNNSMAQAMKGVTKAMATMNRQLKLPQIQKIMMEFEKQSELMDMKEEMMNDAIDDAMGDEDDEEESDAIVSQVLDELGLNLSDELSSLPSTGGSLSV 191          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Match: chmp2ba (charged multivesicular body protein 2B [Source:NCBI gene;Acc:101166263])

HSP 1 Score: 106.686 bits (265), Expect = 6.604e-28
Identity = 73/176 (41.48%), Postives = 114/176 (64.77%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIA 529
            M  LF K+KT + +++E  + L  T R++ R+RA LE +EK++  +IKKMAK G  +A KI+AK LV+ R    +   + + + ++S + + + S   MA AM    +TMQ +NK M+  +  K M +F++E+  M M E+M+ DT+D+   E GDEEESE +V+QVLDE+GIEI+
Sbjct:    1 MASLF-KKKTVDDIIKEQSKELRGTQRQITRDRAALEKQEKQLELEIKKMAKSGNREACKILAKQLVQLRKQKNRTYAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLKTMQDFQKENMKMGMTEDMINDTLDEIFDESGDEEESEDIVSQVLDEIGIEIS 175          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Match: chmp2a (charged multivesicular body protein 2A [Source:NCBI gene;Acc:101157403])

HSP 1 Score: 93.5893 bits (231), Expect = 1.989e-23
Identity = 43/56 (76.79%), Postives = 52/56 (92.86%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQM 169
            MEFLFGKRKTPE+M+R+NQRALN+ +R+LDRER +LE +EKK+I DIKKMAKQGQM
Sbjct:    1 MEFLFGKRKTPEEMLRQNQRALNRAMRDLDRERMKLEQQEKKIIADIKKMAKQGQM 56          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Match: chmp3 (charged multivesicular body protein 3 [Source:NCBI gene;Acc:101156859])

HSP 1 Score: 68.5514 bits (166), Expect = 1.300e-13
Identity = 44/146 (30.14%), Postives = 81/146 (55.48%), Query Frame = 2
Query:   11 LFGKR--KTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTI 442
            LFG+   K P+ ++ E  + + K +R +DR+   ++ EE+KV   IK  AK+GQ D   I+AK++++++  + K    KA + +V L ++   S   +A +++  T  M+ M   + +P++Q  M E  +E     + EEM+ DT 
Sbjct:    3 LFGRTPDKPPKDLVNEWSQKIRKEMRVIDRQIRDIQREEEKVKRSIKDAAKKGQKDVCVILAKEMIQSKRAISKLYASKAQMNSVLLSMRNQLSVVRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTF 148          
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Match: chmp1a (charged multivesicular body protein 1A [Source:NCBI gene;Acc:101169448])

HSP 1 Score: 63.5438 bits (153), Expect = 5.711e-12
Identity = 35/144 (24.31%), Postives = 82/144 (56.94%), Query Frame = 2
Query:  140 IKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIG 571
            +KK  +Q  ++  ++ A++ +R +N    ++ M + + AV+ K+QT  +   +A+ M  VT+ + +   SM+L ++  +M +FE +   +++   +M D++  A+     +E+ + L++Q+ +E G+E+ D L+ +     S+G
Sbjct:   33 VKKALQQKNVECARVYAENAIRKKNEGLNWLRMASRVDAVASKVQTAVTMKGVAKNMGQVTKALDKALNSMDLQKVSAVMDKFETQVQNLDVHTSVMEDSMSSAMTLTTPQEQVDDLIHQIAEEGGLEVMDQLNQLPAGASSLG 176          
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Match: SMESG000005024.1 (SMESG000005024.1)

HSP 1 Score: 378.252 bits (970), Expect = 2.340e-134
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 2
Query:    2 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGVRXXXXXXXXXXXTADGLPSPPSN 643
            MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSN
Sbjct:    1 MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSN 214          
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Match: SMESG000005024.1 (SMESG000005024.1)

HSP 1 Score: 349.747 bits (896), Expect = 2.710e-123
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 2
Query:   41 MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKESIGVRXXXXXXXXXXXTADGLPSPPSN 643
            MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSN
Sbjct:    1 MMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAANKAATADGLPSPPSN 201          
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Match: SMESG000066797.1 (SMESG000066797.1)

HSP 1 Score: 135.961 bits (341), Expect = 9.742e-40
Identity = 84/166 (50.60%), Postives = 110/166 (66.27%), Query Frame = 2
Query:   44 MRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLS 541
            MRENQR+L K IREL+RE+ + E +EKK+I DIKK AK GQ ++VKIMAKDLVR R Y KKF++MKANIQA+S +                  R M            QK++MEFE+ES +ME+K+EMM D +DD + E  DEE+ +K++NQV DELGIE+   L+
Sbjct:    1 MRENQRSLKKVIRELEREQKKCETDEKKLITDIKKAAKIGQEESVKIMAKDLVRNRAYGKKFMIMKANIQAISYE------------------RAM------------QKVLMEFEKESAVMEIKDEMMNDALDDVM-EADDEEDMDKIINQVFDELGIEMNSKLA 135          
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Match: SMESG000054476.1 (SMESG000054476.1)

HSP 1 Score: 103.219 bits (256), Expect = 8.783e-27
Identity = 71/190 (37.37%), Postives = 116/190 (61.05%), Query Frame = 2
Query:   14 FGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNIDPSKES--IGVR 577
            F K+  P++ MR  +R   K  R+L+R++  LE EEKK+  +IKK+AKQG      ++AK L++ R    + + M   + +++ + + ++S   +A AMK   +TM  MNK M   ++ K++  FE+E+  + M EEMM +T+DD   EEG+EEE   ++N+VLDE+GIEI   +S   P+  S  +GV+
Sbjct:    3 FWKKPDPKEQMRTTERENKKVQRDLNRDKNHLEMEEKKLEAEIKKLAKQGNKQGATVLAKQLIQLRKQKNRNMEMNMKVGSITNQAKVMQSNIKLADAMKTTGKTMANMNKVMKPEEMAKMLKNFEQENMKLGMTEEMMNETLDDIFNEEGNEEEEAMVINKVLDEIGIEINSKVSEA-PAAHSGRLGVK 191          
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Match: SMESG000060068.1 (SMESG000060068.1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.654e-11
Identity = 38/156 (24.36%), Postives = 88/156 (56.41%), Query Frame = 2
Query:   80 RELDRERARLENEEKKVINDIKKMAKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMAQAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDALXXXXXXXXXXKLVNQVLDELGIEIADTLSNI 547
            +++DR   + E ++K     +KK   Q  ++  KI A++ +R +N    ++ + + + AVS +IQT  +   +   ++ VT+ +++   SM+L ++ +IM +FE +   ++++   + + + +A+     E++   L+ QV +E G+EI + LS++
Sbjct:   21 KQIDRFAKKAEKDQKIEQGKVKKALLQKNVEGAKIYAENAIRKKNECLNYMRLSSKLDAVSSRIQTAMTMKQVMHGIQNVTKDLEKAMASMDLEKIDRIMSKFESQFEDLDVRTSTIENAMGNAVTLSAPEDQVNSLIKQVAEENGLEIMNDLSDL 176          
The following BLAST results are available for this feature:
BLAST of Charged multivesicular body protein 2a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHMP2A9.696e-8469.11charged multivesicular body protein 2A [Source:HGN... [more]
CHMP2A9.696e-8469.11charged multivesicular body protein 2A [Source:HGN... [more]
CHMP2A9.696e-8469.11charged multivesicular body protein 2A [Source:HGN... [more]
CHMP2A4.078e-7873.51charged multivesicular body protein 2A [Source:HGN... [more]
CHMP2A4.643e-6073.24charged multivesicular body protein 2A [Source:HGN... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps-25.268e-8670.27Related to yeast Vacuolar Protein Sorting factor ... [more]
C01A2.41.558e-2839.04pep chromosome:WBcel235:I:13392118:13394001:1 gene... [more]
vps-245.728e-2033.56Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-245.728e-2033.56Related to yeast Vacuolar Protein Sorting factor ... [more]
vps-245.728e-2033.56Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vps27.506e-7863.87gene:FBgn0039402 transcript:FBtr0084967[more]
CHMP2B1.384e-2338.38gene:FBgn0035589 transcript:FBtr0077166[more]
Chmp17.710e-1327.42gene:FBgn0036805 transcript:FBtr0345383[more]
Chmp17.710e-1327.42gene:FBgn0036805 transcript:FBtr0075092[more]
Vps246.225e-1228.82gene:FBgn0037231 transcript:FBtr0078958[more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp2a3.710e-8772.25charged multivesicular body protein 2A [Source:NCB... [more]
chmp2bb2.804e-3040.00charged multivesicular body protein 2Bb [Source:NC... [more]
chmp2ba1.579e-2638.64charged multivesicular body protein 2Ba [Source:ZF... [more]
chmp2ba1.579e-2638.64charged multivesicular body protein 2Ba [Source:ZF... [more]
chmp2ba3.145e-2536.93charged multivesicular body protein 2Ba [Source:ZF... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nelfa3.817e-8671.73negative elongation factor complex member A [Sourc... [more]
chmp2b2.227e-3037.38charged multivesicular body protein 2B [Source:NCB... [more]
chmp2b9.572e-2836.82charged multivesicular body protein 2B [Source:NCB... [more]
coq61.465e-1027.21coenzyme Q6 monooxygenase [Source:Xenbase;Acc:XB-G... [more]
scube23.521e-1022.92signal peptide, CUB domain, EGF-like 2 [Source:Xen... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chmp2a6.033e-8469.11charged multivesicular body protein 2A [Source:MGI... [more]
Chmp2a6.033e-8469.11charged multivesicular body protein 2A [Source:MGI... [more]
Chmp2a1.934e-4549.74charged multivesicular body protein 2A [Source:MGI... [more]
Chmp2b1.291e-2838.62charged multivesicular body protein 2B [Source:MGI... [more]
Chmp2b3.398e-2638.07charged multivesicular body protein 2B [Source:MGI... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DFS6|CHM2A_XENTR2.022e-8571.73Charged multivesicular body protein 2a OS=Xenopus ... [more]
sp|Q6IP52|CHM2A_XENLA5.287e-8571.20Charged multivesicular body protein 2a OS=Xenopus ... [more]
sp|Q7ZW25|CHM2A_DANRE6.366e-8571.73Charged multivesicular body protein 2a OS=Danio re... [more]
sp|Q9DB34|CHM2A_MOUSE4.220e-8369.11Charged multivesicular body protein 2a OS=Mus musc... [more]
sp|O43633|CHM2A_HUMAN4.656e-8369.11Charged multivesicular body protein 2a OS=Homo sap... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HQW91.155e-9073.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G1A61.345e-9073.68Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I7YSN59.265e-8871.73Uncharacterized protein OS=Steinernema glaseri OX=... [more]
A0A1I8HTX52.567e-8770.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4U8UQ125.382e-8774.18Uncharacterized protein OS=Steinernema carpocapsae... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp2a2.645e-8671.73charged multivesicular body protein 2A [Source:NCB... [more]
chmp2bb1.743e-3242.16charged multivesicular body protein 2b [Source:NCB... [more]
chmp2ba3.339e-2939.89charged multivesicular body protein 2b [Source:NCB... [more]
chmp2ba3.339e-2939.89charged multivesicular body protein 2b [Source:NCB... [more]
chmp2ba5.442e-2939.15charged multivesicular body protein 2b [Source:NCB... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chmp35.776e-1531.97charged multivesicular body protein 3 [Source:NCBI... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DID41.501e-5348.33Class E Vps protein of the ESCRT-III complex; requ... [more]
VPS243.741e-827.54One of four subunits of the ESCRT-III complex; for... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO435812.397e-8569.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420225.930e-3543.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342403.119e-1936.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410772.028e-1026.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp2a1.064e-8571.20charged multivesicular body protein 2A [Source:NCB... [more]
chmp2ba6.604e-2841.48charged multivesicular body protein 2B [Source:NCB... [more]
chmp2a1.989e-2376.79charged multivesicular body protein 2A [Source:NCB... [more]
chmp31.300e-1330.14charged multivesicular body protein 3 [Source:NCBI... [more]
chmp1a5.711e-1224.31charged multivesicular body protein 1A [Source:NCB... [more]
back to top
BLAST of Charged multivesicular body protein 2a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005024.12.340e-134100.00SMESG000005024.1[more]
SMESG000005024.12.710e-123100.00SMESG000005024.1[more]
SMESG000066797.19.742e-4050.60SMESG000066797.1[more]
SMESG000054476.18.783e-2737.37SMESG000054476.1[more]
SMESG000060068.14.654e-1124.36SMESG000060068.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014670 ID=SMED30014670|Name=Charged multivesicular body protein 2a|organism=Schmidtea mediterranea sexual|type=transcript|length=752bp
AATGGAATTTTTATTTGGCAAACGAAAAACTCCTGAACAGATGATGCGGG
AGAATCAAAGAGCATTAAATAAAACTATTCGTGAATTAGATCGCGAAAGG
GCTAGACTAGAAAACGAAGAAAAAAAAGTTATTAATGATATAAAGAAGAT
GGCTAAACAAGGACAAATGGATGCTGTTAAAATAATGGCTAAAGATTTAG
TAAGAACCAGAAATTATGTGAAGAAATTCATATTAATGAAAGCAAATATT
CAAGCAGTATCTCTAAAAATTCAAACATTGAGGTCAACAAACGCAATGGC
TCAAGCTATGAAAGGAGTTACTCGAACCATGCAAAGAATGAACAAATCAA
TGAACTTACCACAGTTACAGAAAATTATGATGGAATTTGAACGCGAATCA
AATATTATGGAAATGAAAGAAGAAATGATGACAGACACAATTGATGATGC
ACTGGGTGAGGAAGGCGATGAAGAGGAATCGGAAAAATTAGTCAATCAAG
TACTGGATGAACTGGGAATAGAAATTGCAGATACTCTTTCAAATATTGAT
CCTTCTAAAGAGTCAATTGGTGTTCGGAACAAAAATCCACCAGCTGCAAA
CAAAGCAGCAACAGCTGATGGATTACCATCACCACCATCTAACGCCGGCG
ATGATGATGATTTAGAAGCCAGACTTGCAAGATTAAAGAGAAACTAAATT
CTAAATTTAGATAAAATTGATCAAACAATGAAGCTATAATTTTTTATCAT
AC
back to top

protein sequence of SMED30014670-orf-1

>SMED30014670-orf-1 ID=SMED30014670-orf-1|Name=SMED30014670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
MEFLFGKRKTPEQMMRENQRALNKTIRELDRERARLENEEKKVINDIKKM
AKQGQMDAVKIMAKDLVRTRNYVKKFILMKANIQAVSLKIQTLRSTNAMA
QAMKGVTRTMQRMNKSMNLPQLQKIMMEFERESNIMEMKEEMMTDTIDDA
LGEEGDEEESEKLVNQVLDELGIEIADTLSNIDPSKESIGVRNKNPPAAN
KAATADGLPSPPSNAGDDDDLEARLARLKRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR005024Snf7_fam
Vocabulary: biological process
TermDefinition
GO:0007034vacuolar transport
GO:0006810transport
GO:0010458exit from mitosis
GO:0015031protein transport
GO:0031468nuclear envelope reassembly
Vocabulary: cellular component
TermDefinition
GO:0005635nuclear envelope
GO:0005737cytoplasm
GO:0005768endosome
GO:0016020membrane
GO:0031902late endosome membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 218..231
NoneNo IPR availableCOILSCoilCoilcoord: 12..53
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 184..231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..231
NoneNo IPR availablePANTHERPTHR10476CHARGED MULTIVESICULAR BODY PROTEINcoord: 4..230
NoneNo IPR availablePANTHERPTHR10476:SF4CHARGED MULTIVESICULAR BODY PROTEIN 2Acoord: 4..230
IPR005024Snf7 familyPFAMPF03357Snf7coord: 17..183
e-value: 8.0E-43
score: 146.0