HP domain-containing protein

Overview
NameHP domain-containing protein
Smed IDSMED30014645
Length (bp)5220
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HP domain-containing protein (SMED30014645) t-SNE clustered cells

Violin plots show distribution of expression levels for HP domain-containing protein (SMED30014645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HP domain-containing protein (SMED30014645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HP domain-containing protein (SMED30014645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014645SMESG000075965.1 PL04009A1F04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014645SMESG000075965.1 PL04009A1F04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30014645SMESG000075965.1 PL04009A1F04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014645SMESG000075965.1 Contig39374uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014645SMESG000075965.1 Contig39374newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30014645SMESG000075965.1 dd_Smed_v4_4193_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HP domain-containing protein vs. Ensembl Human
Match: SVIL (supervillin [Source:HGNC Symbol;Acc:HGNC:11480])

HSP 1 Score: 518.464 bits (1334), Expect = 8.158e-154
Identity = 317/936 (33.87%), Postives = 496/936 (52.99%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS---IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V  ++DFD IF      L S  ++  +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  KE+FS + L+    TE N        PYK LML+ +KGR++VQ RLVEP AS++N GDC+LLL+    F+W+GE ANVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R  +  +P +    +  P   D++  D+  +++M   +   I+DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G    TE    +YP    +V+ + P LQ  LY + QPALFL+ +   +++W+GWW ++  ++                      R R AS++ + +++V  +      K  A    +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    MT++++  L  WKQ   KK   LF
Sbjct:  894 PRSPVEMDEDFDVIFDPYAPKLTS--SVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNE-KNPGELAQHKEDP-RTDVKAYDVTRMVSMPQTTAGTILDGVNVGRG--YGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFAATEF---VYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGS-------------------ARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 1788          
BLAST of HP domain-containing protein vs. Ensembl Human
Match: SVIL (supervillin [Source:HGNC Symbol;Acc:HGNC:11480])

HSP 1 Score: 517.309 bits (1331), Expect = 1.449e-151
Identity = 316/934 (33.83%), Postives = 493/934 (52.78%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS---IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V  ++DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  KE+FS + L+    TE N        PYK LML+ +KGR++VQ RLVEP AS++N GDC+LLL+    F+W+GE ANVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R  +  +P +    +  P   D++  D+  +++M   +   I+DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G    TE    +YP    +V+ + P LQ  LY + QPALFL+ +   +++W+GWW ++  ++                      R R AS++ + +++V  +      K  A    +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    MT++++  L  WKQ   KK   LF
Sbjct: 1288 PRSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNE-KNPGELAQHKEDP-RTDVKAYDVTRMVSMPQTTAGTILDGVNVGRG--YGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFAATEF---VYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGS-------------------ARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 2182          
BLAST of HP domain-containing protein vs. Ensembl Human
Match: SVIL (supervillin [Source:HGNC Symbol;Acc:HGNC:11480])

HSP 1 Score: 517.309 bits (1331), Expect = 1.580e-151
Identity = 316/934 (33.83%), Postives = 493/934 (52.78%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS---IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V  ++DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  KE+FS + L+    TE N        PYK LML+ +KGR++VQ RLVEP AS++N GDC+LLL+    F+W+GE ANVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R  +  +P +    +  P   D++  D+  +++M   +   I+DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G    TE    +YP    +V+ + P LQ  LY + QPALFL+ +   +++W+GWW ++  ++                      R R AS++ + +++V  +      K  A    +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    MT++++  L  WKQ   KK   LF
Sbjct: 1320 PRSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNE-KNPGELAQHKEDP-RTDVKAYDVTRMVSMPQTTAGTILDGVNVGRG--YGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFAATEF---VYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGS-------------------ARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 2214          
BLAST of HP domain-containing protein vs. Ensembl Human
Match: SVIL (supervillin [Source:HGNC Symbol;Acc:HGNC:11480])

HSP 1 Score: 426.402 bits (1095), Expect = 1.150e-127
Identity = 255/738 (34.55%), Postives = 404/738 (54.74%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQ 4244
            P + V  ++DFD IF      L S  ++  +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  KE+FS + L+    TE N        PYK LML+ +KGR++VQ RLVEP AS++N GDC+LLL+    F+W+GE ANVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R  +  +P +    +  P   D++  D+  +++M   +   I+DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G    TE    +YP    +V+ + P LQ
Sbjct:  246 PRSPVEMDEDFDVIFDPYAPKLTS--SVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNE-KNPGELAQHKEDP-RTDVKAYDVTRMVSMPQTTAGTILDGVNVGRG--YGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFAATEF---VYPARAPSVVSSMPFLQ 961          
BLAST of HP domain-containing protein vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 101.679 bits (252), Expect = 6.183e-21
Identity = 129/557 (23.16%), Postives = 211/557 (37.88%), Query Frame = 3
Query: 2529 SINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNA---VQFWKCLHYDTVQIINP----PGDVSEDELYERMIQHTNMVYRVVENR-----LIPYDEYWGSPLKHKMLVDDQVFIFDFGTE--LYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHII------IDGK----SVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKD---RVTQIRVKQNHESPAFCRLFDGS-MVVHIG---KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSS 4106
            S N GDC++L    N+  W G  +N  E  KA ++   I                     DN+++  A   V          +Q++ P    P    +    +   +    +Y+V          +  DE   +P     L  +  FI D G +  +++W G +A+ + +   +  LK          S  I  +D                 P    V  L + GET LFK+ F +W +         P QT+                   L +S+ S+HI        D      S     +  + +DG        T   ++W I  +  V V P   GQF+  D+YII +NY    HG      R G ++   + WQG  ++  E  ASA+ T  LD++      Q RV Q  E      LF G  M+++ G   ++     P+ +RLF +R         VEV+ ++ +L     F+L   +    ++W G  AS   K+ A    + L A +PV            ++ +G EP  FW+ +G    +++S
Sbjct:  158 SFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIR--------------------DNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADE---NPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEER---KAALKTA--------SDFITKMD----------------YPKQTQVSVLPEGGETPLFKQFFKNWRD---------PDQTDG------------------LGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDG--------TGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYR---HG-----GRQGQII---YNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSA--AYLWVGTGASEAEKTGAQELLRVLRA-QPV------------QVAEGSEPDGFWEALGGKAAYRTS 603          

HSP 2 Score: 52.7582 bits (125), Expect = 6.894e-6
Identity = 63/233 (27.04%), Postives = 91/233 (39.06%), Query Frame = 3
Query: 3423 NIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDK---DRVTQIRVKQNHESPAFCRLFDGSMVVHIG------KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE----FKLEEIEQGKEPRTFWQDMG 4082
             +++W +     V VP    G FF+ DAY+I    +L          R GNL     +W G   S  E  A+A++T+ LD     R  Q R  Q  ES  F   F   +    G      K  +  +    RLF ++G     A  V V  ES +  D  +  L    GN    W G+          S  +++L A + V   I  NE     ++   E+G EP    Q +G
Sbjct:   16 GLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQL----------RNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDL----GNNIHQWCGS---------NSNRYERLKATQ-VSKGIRDNERSGRARVHVSEEGTEPEAMLQVLG 224          
BLAST of HP domain-containing protein vs. Ensembl Celegans
Match: viln-1 (VILliN related [Source:UniProtKB/TrEMBL;Acc:P91041])

HSP 1 Score: 144.436 bits (363), Expect = 1.981e-34
Identity = 148/645 (22.95%), Postives = 275/645 (42.64%), Query Frame = 3
Query: 2097 TEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDER--LSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNH---NEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEG--DLQPID--------IGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHG-RYTRNNR-----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYC 3968
            T   S+++P      EI   +D++L+       P+       R P +K   ++D  + +DER  L  V   E     ++    K    E+A+AA+   +   K   K           VSPY D+MLI V+G KNV VRLV P  SS++   C++++ ++++  + G  +N++E  KA++L   I    +LN +  S    IV      +++ +   +   + ++    N     S  E +E  +   N+V R+  +            L ++++   +V IFDFG+E+Y+W+G  ++  +    +   K L  +             P+ N      +A+      RP W +  ++ Q    TLFK KFSDWPET  ++    P    +++N  ++   D++ ++        +  +L        ++++ + + R      I D       VI+++  +W +       +    T  F S   Y++RW Y +   G R  +  +     TG    AF++W G  T+  +    AL   ++D+D   +IR+   +E   F  LFDG  +V     ++  KP   R +++ G    E    E+ + +  LR  + ++ +            +   P S  C + C
Sbjct:  112 TSGASSSLPK---ISEITASNDIDLDAISSKATPVLKTVTRPRAPNRK---KSDKSSTFDERIRLDAVKIDEEAFAVVEEEPEKLETQEQAIAAIQGAKQLLKSPTK-----------VSPYPDVMLIQVRGSKNVDVRLVAPAMSSVHEVACFVVVHQKHLMKYEGLYSNILEKTKASQLCIEILGKSDLNCTAES----IVTVTGASRSTLSKLLFCSENSESSSENNNYHQASSVEPFETTVAKLNLVLRIAGDNTAETCSR-RERLSYEIMKPSEVLIFDFGSEIYVWTGRYSNKVSSAYAQEYAKQLMKK-------------PVKNGKFILGDAESIDQDGRPEWTLSRKIHQGVLDTLFKAKFSDWPETREVLTTCKPRALISKKNPEVKTYEDVKVVNQDDEVADLVERMLQEQELDPILVLEDQEIDRK-----IHD-------VISEDRSLWVLRGEVLQSIEEF-TEHFDSRRCYVLRWKYRIQKSGVRRIKTGKEEERETGRSRIAFWYWLGEHTTPKQHGLCALRIKEIDRDNSPRIRIADGNEPALFLALFDGKFMVSSDISEM--KP--LRRYVVIGANSRETSLREIDDLNSPLRSHAAYIEVEK----------DILGPSSVVCGANC 694          

HSP 2 Score: 67.781 bits (164), Expect = 7.096e-11
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 3
Query: 4494 ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRER-PLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            A +VY G EP  F+ LF  WE+ E      +      +   +V+D+L      T+S E L+ER  LP  +   R+ESYL  +DF  +FK+ + +FY    WKQ++ +K V LF
Sbjct:  813 AKVVYKGAEPEQFKGLFMKWEMFE------VEDDKPSDPPRDVSDLLKER-CRTFSLEELKERTSLPAGMDMRRLESYLTDDDFMKVFKIERSEFYAQKTWKQNDARKRVGLF 918          
BLAST of HP domain-containing protein vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.267e-9
Identity = 113/574 (19.69%), Postives = 220/574 (38.33%), Query Frame = 3
Query: 2511 VEPTASSINIGD---CYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRV---VENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPE--------TSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTG-------NLLSAFFFWQGISTSITEKTASALWTIDLD-------KDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAH-FVEVVNESHSLRDRSVFLL------INANGNRG--FMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSF 4115
            +EP   S+   D   C+LL   + +++W G  + +  +NKA      + K    +  G S+  T  ++          +FW+ L   T     P G + E  + E  +     +Y+V   +    +P  E      K  ML    VF+ D  ++++LW G KA+   K  G+ L+  L                                RP++  V R  +  E+ +F+ KF+ W E        TS  ++ +   +   +++  +  DL  + +    +MS+  +                   + ++ + +   + +E + +     V +P    G F++ D Y+    Y +         +          +     +FWQG   S         +T  L        KD++  +R+ Q  E+  F   F    ++  G++ L K        LF +R    S  +  ++V  +++ L      +L      I  +G+RG  ++W G  + P+    A      L+       R + N+F++ E+++G+E   FW+ +G  KK+++  SF
Sbjct:  643 MEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNK---RDRKGKSEIETCRQA------RCPPEFWQAL---TGNPDKPQGAIVE-HVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQM---------------------------IDRPDYAQVYRETEGEESMMFRSKFAGWDEIVPVDYTRTSDSVQRVPDLKVIVKKDNMMRADLAALFLERQPSMSYEES-------------------EELMEDCNYDLELMESFVLEGKKFVKLPQKEFGIFYTMDCYVFLCRYAVMPEEDEEGEDEHDEDDKPEMDFKCVVYFWQGRDAS---NMGWLNFTFQLQPNFEEIFKDKLEVVRMYQQQENHKFLSHFKRKFLIKRGRRGLTKNLGGKWPELFQMRANGSSVCNRTIQVDCQANQLCSAFCHMLRIPFKEIEEDGHRGVVYVWMGKDSDPREHEFARQVASDLVV------RDDDNDFRIVEVQEGEENEEFWKVLGGKKKYETDSSF 1148          
BLAST of HP domain-containing protein vs. Ensembl Fly
Match: Svil (gene:FBgn0266696 transcript:FBtr0345108)

HSP 1 Score: 431.795 bits (1109), Expect = 1.995e-128
Identity = 298/931 (32.01%), Postives = 471/931 (50.59%), Query Frame = 3
Query: 2175 LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCL--HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQ--GFNYDSCTINPLDPLP---NNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDI-------GNILNMSHP--STHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITD-NAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKK-------WKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGE-INLNYLSLPRNRIASEKLALLK-SVDSWLSQNKDK-------LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM-------TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++KR V+  + ++ ++RNPLK L  R DI +EY E  SG+AEREL+R ++++    A    EA+A L   EDF  + L R+ S  L + ++ P+K +ML+ VKGR +VQ RLVEP  +S+N GDC++L+    +F ++G  ANVIE +++ ++ + I + K+L  + + +   I+      K     QFW+ L    D    I   G   ED+++E  +  TN +Y   +  LIP +++WG   K  ML   +V +FDFG+ELY+W+G  A    K     L +  F      +Y  C +NPL+ +       N       + RP W ++G++ Q  ET LFKEKFSDWPE  R               + +E D     +       G  L+   P    +++++  ++GRG  +   +   +R F VITK+ + W I + N        + G F+S ++YI+RW Y+++       G+ +  +  G     +F WQG  +S  EK A+AL T++LDK++  Q+RV Q  E  AF RLF   M  H G K+Q  ++ S+ RL+ ++G +  E    EVV +S  LR RS  LLI+ +     +W G+ ++P +++ A    Q L+   P D   +     L E+E+G +     + +G+  +        KS+ SF+    IR +  S   GV    E+   L     H+    +P  Q+ LY + QP +FL+     L++W GWW L+      D   N D+     N N   +  NR  SE+ A L+ +VD W +++ +        +   +V+AGLEP +F+ LFP W    + + I        N+ED  TD   +  TM        Y  E L+ RPLPE V  +R+E YL  EDF+     ++ +F +L  WKQ + KKE  LF
Sbjct:  226 VSKRHVQGPKGRR-AARNPLKSLAAREDISSEYTEMRSGIAERELRRLKLESYGHNANLAAEAIAGLASVEDFKSVAL-RSSSIPLQQMWL-PHKPVMLLHVKGRTHVQTRLVEPVHTSLNRGDCFILVAGSQLFRYVGSFANVIEISRSKKICAAIVENKDLGCTATQE--VILTDGKYLKERQWRQFWQLLGKKEDDQSDIAECGHADEDDVFESSLIETNKIYEYQDEALIPLEKFWGCIPKVDMLDTRKVLVFDFGSELYVWNGKNAPSDAKRAAMRLAQEHFGAENSADYADCYLNPLNYVAIVGRRENTKYAKRCAQRPEWCVLGKITQNMETVLFKEKFSDWPEIER---------------EDLEKDYLSNGVHMVRALNGTALHKGEPYQEPNLVLEQANLGRGNFY--YDTDTMRHFDVITKSTDKWQIHEFNFDAANNRDDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTVELDKEKGAQMRVSQGDECTAFVRLFR-QMWQHRGRKEQCLERHSEWRLYQLQGNVSEETIIKEVVCQSSHLRSRSSMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKTVPKDL-FSAETANLTEVEEGSDDDQCKKALGLKDERNEYGSLLKSTKSFD--YQIRIFNFSSTQGVFKALELSDPLRCQDLHS---PYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPLE------DVKINTDERSSPTNENRAGV--NRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEPLAFKALFPDWTERPDVREI--------NEEDGRTDASISIATMLAQMTQTEYPLEVLKARPLPEGVEPTRLEVYLNAEDFQAALGCSRAEFEQLPIWKQTKLKKERGLF 1111          
BLAST of HP domain-containing protein vs. Ensembl Fly
Match: Svil (gene:FBgn0266696 transcript:FBtr0345107)

HSP 1 Score: 431.795 bits (1109), Expect = 5.558e-128
Identity = 298/931 (32.01%), Postives = 471/931 (50.59%), Query Frame = 3
Query: 2175 LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCL--HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQ--GFNYDSCTINPLDPLP---NNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDI-------GNILNMSHP--STHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITD-NAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKK-------WKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGE-INLNYLSLPRNRIASEKLALLK-SVDSWLSQNKDK-------LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM-------TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++KR V+  + ++ ++RNPLK L  R DI +EY E  SG+AEREL+R ++++    A    EA+A L   EDF  + L R+ S  L + ++ P+K +ML+ VKGR +VQ RLVEP  +S+N GDC++L+    +F ++G  ANVIE +++ ++ + I + K+L  + + +   I+      K     QFW+ L    D    I   G   ED+++E  +  TN +Y   +  LIP +++WG   K  ML   +V +FDFG+ELY+W+G  A    K     L +  F      +Y  C +NPL+ +       N       + RP W ++G++ Q  ET LFKEKFSDWPE  R               + +E D     +       G  L+   P    +++++  ++GRG  +   +   +R F VITK+ + W I + N        + G F+S ++YI+RW Y+++       G+ +  +  G     +F WQG  +S  EK A+AL T++LDK++  Q+RV Q  E  AF RLF   M  H G K+Q  ++ S+ RL+ ++G +  E    EVV +S  LR RS  LLI+ +     +W G+ ++P +++ A    Q L+   P D   +     L E+E+G +     + +G+  +        KS+ SF+    IR +  S   GV    E+   L     H+    +P  Q+ LY + QP +FL+     L++W GWW L+      D   N D+     N N   +  NR  SE+ A L+ +VD W +++ +        +   +V+AGLEP +F+ LFP W    + + I        N+ED  TD   +  TM        Y  E L+ RPLPE V  +R+E YL  EDF+     ++ +F +L  WKQ + KKE  LF
Sbjct:  271 VSKRHVQGPKGRR-AARNPLKSLAAREDISSEYTEMRSGIAERELRRLKLESYGHNANLAAEAIAGLASVEDFKSVAL-RSSSIPLQQMWL-PHKPVMLLHVKGRTHVQTRLVEPVHTSLNRGDCFILVAGSQLFRYVGSFANVIEISRSKKICAAIVENKDLGCTATQE--VILTDGKYLKERQWRQFWQLLGKKEDDQSDIAECGHADEDDVFESSLIETNKIYEYQDEALIPLEKFWGCIPKVDMLDTRKVLVFDFGSELYVWNGKNAPSDAKRAAMRLAQEHFGAENSADYADCYLNPLNYVAIVGRRENTKYAKRCAQRPEWCVLGKITQNMETVLFKEKFSDWPEIER---------------EDLEKDYLSNGVHMVRALNGTALHKGEPYQEPNLVLEQANLGRGNFY--YDTDTMRHFDVITKSTDKWQIHEFNFDAANNRDDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTVELDKEKGAQMRVSQGDECTAFVRLFR-QMWQHRGRKEQCLERHSEWRLYQLQGNVSEETIIKEVVCQSSHLRSRSSMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKTVPKDL-FSAETANLTEVEEGSDDDQCKKALGLKDERNEYGSLLKSTKSFD--YQIRIFNFSSTQGVFKALELSDPLRCQDLHS---PYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPLE------DVKINTDERSSPTNENRAGV--NRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEPLAFKALFPDWTERPDVREI--------NEEDGRTDASISIATMLAQMTQTEYPLEVLKARPLPEGVEPTRLEVYLNAEDFQAALGCSRAEFEQLPIWKQTKLKKERGLF 1156          
BLAST of HP domain-containing protein vs. Ensembl Fly
Match: Svil (gene:FBgn0266696 transcript:FBtr0345106)

HSP 1 Score: 431.795 bits (1109), Expect = 5.558e-128
Identity = 298/931 (32.01%), Postives = 471/931 (50.59%), Query Frame = 3
Query: 2175 LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCL--HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQ--GFNYDSCTINPLDPLP---NNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDI-------GNILNMSHP--STHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITD-NAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKK-------WKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGE-INLNYLSLPRNRIASEKLALLK-SVDSWLSQNKDK-------LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM-------TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++KR V+  + ++ ++RNPLK L  R DI +EY E  SG+AEREL+R ++++    A    EA+A L   EDF  + L R+ S  L + ++ P+K +ML+ VKGR +VQ RLVEP  +S+N GDC++L+    +F ++G  ANVIE +++ ++ + I + K+L  + + +   I+      K     QFW+ L    D    I   G   ED+++E  +  TN +Y   +  LIP +++WG   K  ML   +V +FDFG+ELY+W+G  A    K     L +  F      +Y  C +NPL+ +       N       + RP W ++G++ Q  ET LFKEKFSDWPE  R               + +E D     +       G  L+   P    +++++  ++GRG  +   +   +R F VITK+ + W I + N        + G F+S ++YI+RW Y+++       G+ +  +  G     +F WQG  +S  EK A+AL T++LDK++  Q+RV Q  E  AF RLF   M  H G K+Q  ++ S+ RL+ ++G +  E    EVV +S  LR RS  LLI+ +     +W G+ ++P +++ A    Q L+   P D   +     L E+E+G +     + +G+  +        KS+ SF+    IR +  S   GV    E+   L     H+    +P  Q+ LY + QP +FL+     L++W GWW L+      D   N D+     N N   +  NR  SE+ A L+ +VD W +++ +        +   +V+AGLEP +F+ LFP W    + + I        N+ED  TD   +  TM        Y  E L+ RPLPE V  +R+E YL  EDF+     ++ +F +L  WKQ + KKE  LF
Sbjct:  271 VSKRHVQGPKGRR-AARNPLKSLAAREDISSEYTEMRSGIAERELRRLKLESYGHNANLAAEAIAGLASVEDFKSVAL-RSSSIPLQQMWL-PHKPVMLLHVKGRTHVQTRLVEPVHTSLNRGDCFILVAGSQLFRYVGSFANVIEISRSKKICAAIVENKDLGCTATQE--VILTDGKYLKERQWRQFWQLLGKKEDDQSDIAECGHADEDDVFESSLIETNKIYEYQDEALIPLEKFWGCIPKVDMLDTRKVLVFDFGSELYVWNGKNAPSDAKRAAMRLAQEHFGAENSADYADCYLNPLNYVAIVGRRENTKYAKRCAQRPEWCVLGKITQNMETVLFKEKFSDWPEIER---------------EDLEKDYLSNGVHMVRALNGTALHKGEPYQEPNLVLEQANLGRGNFY--YDTDTMRHFDVITKSTDKWQIHEFNFDAANNRDDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTVELDKEKGAQMRVSQGDECTAFVRLFR-QMWQHRGRKEQCLERHSEWRLYQLQGNVSEETIIKEVVCQSSHLRSRSSMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKTVPKDL-FSAETANLTEVEEGSDDDQCKKALGLKDERNEYGSLLKSTKSFD--YQIRIFNFSSTQGVFKALELSDPLRCQDLHS---PYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPLE------DVKINTDERSSPTNENRAGV--NRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEPLAFKALFPDWTERPDVREI--------NEEDGRTDASISIATMLAQMTQTEYPLEVLKARPLPEGVEPTRLEVYLNAEDFQAALGCSRAEFEQLPIWKQTKLKKERGLF 1156          
BLAST of HP domain-containing protein vs. Ensembl Fly
Match: Svil (gene:FBgn0266696 transcript:FBtr0345105)

HSP 1 Score: 433.335 bits (1113), Expect = 5.995e-126
Identity = 298/931 (32.01%), Postives = 471/931 (50.59%), Query Frame = 3
Query: 2175 LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCL--HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQ--GFNYDSCTINPLDPLP---NNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDI-------GNILNMSHP--STHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITD-NAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKK-------WKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGE-INLNYLSLPRNRIASEKLALLK-SVDSWLSQNKDK-------LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM-------TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++KR V+  + ++ ++RNPLK L  R DI +EY E  SG+AEREL+R ++++    A    EA+A L   EDF  + L R+ S  L + ++ P+K +ML+ VKGR +VQ RLVEP  +S+N GDC++L+    +F ++G  ANVIE +++ ++ + I + K+L  + + +   I+      K     QFW+ L    D    I   G   ED+++E  +  TN +Y   +  LIP +++WG   K  ML   +V +FDFG+ELY+W+G  A    K     L +  F      +Y  C +NPL+ +       N       + RP W ++G++ Q  ET LFKEKFSDWPE  R               + +E D     +       G  L+   P    +++++  ++GRG  +   +   +R F VITK+ + W I + N        + G F+S ++YI+RW Y+++       G+ +  +  G     +F WQG  +S  EK A+AL T++LDK++  Q+RV Q  E  AF RLF   M  H G K+Q  ++ S+ RL+ ++G +  E    EVV +S  LR RS  LLI+ +     +W G+ ++P +++ A    Q L+   P D   +     L E+E+G +     + +G+  +        KS+ SF+    IR +  S   GV    E+   L     H+    +P  Q+ LY + QP +FL+     L++W GWW L+      D   N D+     N N   +  NR  SE+ A L+ +VD W +++ +        +   +V+AGLEP +F+ LFP W    + + I        N+ED  TD   +  TM        Y  E L+ RPLPE V  +R+E YL  EDF+     ++ +F +L  WKQ + KKE  LF
Sbjct:  629 VSKRHVQGPKGRR-AARNPLKSLAAREDISSEYTEMRSGIAERELRRLKLESYGHNANLAAEAIAGLASVEDFKSVAL-RSSSIPLQQMWL-PHKPVMLLHVKGRTHVQTRLVEPVHTSLNRGDCFILVAGSQLFRYVGSFANVIEISRSKKICAAIVENKDLGCTATQE--VILTDGKYLKERQWRQFWQLLGKKEDDQSDIAECGHADEDDVFESSLIETNKIYEYQDEALIPLEKFWGCIPKVDMLDTRKVLVFDFGSELYVWNGKNAPSDAKRAAMRLAQEHFGAENSADYADCYLNPLNYVAIVGRRENTKYAKRCAQRPEWCVLGKITQNMETVLFKEKFSDWPEIER---------------EDLEKDYLSNGVHMVRALNGTALHKGEPYQEPNLVLEQANLGRGNFY--YDTDTMRHFDVITKSTDKWQIHEFNFDAANNRDDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTVELDKEKGAQMRVSQGDECTAFVRLFR-QMWQHRGRKEQCLERHSEWRLYQLQGNVSEETIIKEVVCQSSHLRSRSSMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKTVPKDL-FSAETANLTEVEEGSDDDQCKKALGLKDERNEYGSLLKSTKSFD--YQIRIFNFSSTQGVFKALELSDPLRCQDLHS---PYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPLE------DVKINTDERSSPTNENRAGV--NRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEPLAFKALFPDWTERPDVREI--------NEEDGRTDASISIATMLAQMTQTEYPLEVLKARPLPEGVEPTRLEVYLNAEDFQAALGCSRAEFEQLPIWKQTKLKKERGLF 1514          
BLAST of HP domain-containing protein vs. Ensembl Fly
Match: Svil (gene:FBgn0266696 transcript:FBtr0345104)

HSP 1 Score: 430.639 bits (1106), Expect = 1.535e-122
Identity = 302/944 (31.99%), Postives = 476/944 (50.42%), Query Frame = 3
Query: 2136 FDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCL--HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQ--GFNYDSCTINPLDPLP---NNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDI-------GNILNMSHP--STHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITD-NAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKK-------WKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGE-INLNYLSLPRNRIASEKLALLK-SVDSWLSQNKDK-------LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM-------TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            FD+I     L   ++KR V+  + ++ ++RNPLK L  R DI +EY E  SG+AEREL+R ++++    A    EA+A L   EDF  + L R+ S  L + ++ P+K +ML+ VKGR +VQ RLVEP  +S+N GDC++L+    +F ++G  ANVIE +++ ++ + I + K+L  + + +   I+      K     QFW+ L    D    I   G   ED+++E  +  TN +Y   +  LIP +++WG   K  ML   +V +FDFG+ELY+W+G  A    K     L +  F      +Y  C +NPL+ +       N       + RP W ++G++ Q  ET LFKEKFSDWPE  R               + +E D     +       G  L+   P    +++++  ++GRG  +   +   +R F VITK+ + W I + N        + G F+S ++YI+RW Y+++       G+ +  +  G     +F WQG  +S  EK A+AL T++LDK++  Q+RV Q  E  AF RLF   M  H G K+Q  ++ S+ RL+ ++G +  E    EVV +S  LR RS  LLI+ +     +W G+ ++P +++ A    Q L+   P D   +     L E+E+G +     + +G+  +        KS+ SF+    IR +  S   GV    E+   L     H+    +P  Q+ LY + QP +FL+     L++W GWW L+      D   N D+     N N   +  NR  SE+ A L+ +VD W +++ +        +   +V+AGLEP +F+ LFP W    + + I        N+ED  TD   +  TM        Y  E L+ RPLPE V  +R+E YL  EDF+     ++ +F +L  WKQ + KKE  LF
Sbjct: 2145 FDDIKPTERL---VSKRHVQGPKGRR-AARNPLKSLAAREDISSEYTEMRSGIAERELRRLKLESYGHNANLAAEAIAGLASVEDFKSVAL-RSSSIPLQQMWL-PHKPVMLLHVKGRTHVQTRLVEPVHTSLNRGDCFILVAGSQLFRYVGSFANVIEISRSKKICAAIVENKDLGCTATQE--VILTDGKYLKERQWRQFWQLLGKKEDDQSDIAECGHADEDDVFESSLIETNKIYEYQDEALIPLEKFWGCIPKVDMLDTRKVLVFDFGSELYVWNGKNAPSDAKRAAMRLAQEHFGAENSADYADCYLNPLNYVAIVGRRENTKYAKRCAQRPEWCVLGKITQNMETVLFKEKFSDWPEIER---------------EDLEKDYLSNGVHMVRALNGTALHKGEPYQEPNLVLEQANLGRGNFY--YDTDTMRHFDVITKSTDKWQIHEFNFDAANNRDDYGHFYSAESYIVRWIYQISVTVRELSGKVSNRSTVGRDRCVYFTWQGQDSSANEKGAAALLTVELDKEKGAQMRVSQGDECTAFVRLFR-QMWQHRGRKEQCLERHSEWRLYQLQGNVSEETIIKEVVCQSSHLRSRSSMLLIHGSQGNVIVWHGSKSAPHTRNVAVGVAQDLIKTVPKDL-FSAETANLTEVEEGSDDDQCKKALGLKDERNEYGSLLKSTKSFD--YQIRIFNFSSTQGVFKALELSDPLRCQDLHS---PYPFSQSQLYNARQPTIFLLDDGDELWLWMGWWPLE------DVKINTDERSSPTNENRAGV--NRWISERRAALETAVDYWRAKHGENENEPFHGIKGQVVWAGLEPLAFKALFPDWTERPDVREI--------NEEDGRTDASISIATMLAQMTQTEYPLEVLKARPLPEGVEPTRLEVYLNAEDFQAALGCSRAEFEQLPIWKQTKLKKERGLF 3040          
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 532.717 bits (1371), Expect = 3.644e-159
Identity = 318/931 (34.16%), Postives = 497/931 (53.38%), Query Frame = 3
Query: 2109 STNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ V  +DDFD+IF      L S++  +  KR V+P R+ + SS+NPLK L  R DI++EY E+   +   E KR + + +   +GF E ALA L  KE+FS + L+    S +       PYK LMLI VKGR++VQ RLVEP ASS+N GDC+LL+T  + F+WIGE ANVIE  KA EL +++    +L    S  +   ++   N     A  FWK L   T       G   +DE YE  +  TN +YR++E++L+P+D+YWG   +  ML   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++    K       N E      G+ +P D   +L+        ++DG ++GRG  + ++E    R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++   G+   + R    G     +FFWQG ++++ EK  SAL T++LD++R  Q++V+Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +E V    SLR R+  +L+N      ++W G  A   ++        ++  + P++  ++  ++  ++E ++G EP+ FW+ +G  K+ + +Y         FN   P R + +S  +G     E    +YP  E N++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K T  + +++AGLEP +F  +FP WE  E+   I        +Q   V DVL+     TY    L+ RPLPE V   R+E+YL+ EDFE   +MT+ ++  L  WKQ   KK   LF
Sbjct:  866 TSRVEISDDFDDIFGVQLPRLTSEMVQH--KRAVRPTRNVQ-SSKNPLKMLAVREDIRHEYTEQRLNIGLLESKRMKQEKMNKNSGFSEVALAGLASKENFSSVSLRSVNASEQSSNNSAMPYKKLMLIQVKGRRHVQTRLVEPRASSLNSGDCFLLITPHHCFIWIGEFANVIEKAKAAELATFVQTKHDLGCRASYVQ--TIEEGANTHTHAAKDFWKILGGQTS--YQSAGTPEQDEFYESAVVETNCIYRLMEDKLVPHDDYWGRVPRCSMLNPKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNALIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWSDSKNSKKNGDLHVENKELRS---GECRPYDASLMLSALRAPVRTVLDGVNIGRG--YGLVEGEEGRNFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMISRAVGKRLHSERIIGPGKEKCCYFFWQGRNSTVNEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFNGGMIVHAGKREEEEDNTQNDWRLYCVRGEKPIEGHLLEAVCHCSSLRSRTSMILLNIPKASLYLWHGCKAQVHTRDVGRTTANKIKEQCPLEAGLHSSSKVSIQECDEGAEPQGFWEALG--KRDRKAYDCMLQDPGKFN-FTP-RLFQLSSASGEFAAVEF---VYPSREPNLVNSMPFLQEDLYTATQPALFLVDNHHEVYLWQGWWPQDSE-STGS------------------ARIRWDSDRKCAMETVLQYSKEKNEKKTPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEKEAEVCHQIILVEDVLSRLCKTTYPLAELKARPLPEGVDPLRLETYLSDEDFEKALEMTRSEYEALPGWKQVNVKKAKGLF 1756          
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 529.25 bits (1362), Expect = 5.403e-158
Identity = 319/938 (34.01%), Postives = 499/938 (53.20%), Query Frame = 3
Query: 2109 STNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDL-------FKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ V  +DDFD+IF      L S++  +  KR V+P R+ + SS+NPLK L  R DI++EY E+   +   E KR + + +   +GF E ALA L  KE+FS + L+    S +       PYK LMLI VKGR++VQ RLVEP ASS+N GDC+LL+T  + F+WIGE ANVIE  KA EL +++    +L    S  +   ++   N     A  FWK L   T       G   +DE YE  +  TN +YR++E++L+P+D+YWG   +  ML   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++    K       N E      G+ +P D   +L+        ++DG ++GRG  + ++E    R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G     +FFWQG ++++ EK  SAL T++LD++R  Q++V+Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +E V    SLR R+  +L+N      ++W G  A   ++        ++  + P++  ++  ++  ++E ++G EP+ FW+ +G  K+ + +Y         FN   P R + +S  +G     E    +YP  E N++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K T  + +++AGLEP +F  +FP WE  E+   I        +Q   V DVL+     TY    L+ RPLPE V   R+E+YL+ EDFE +        +MT+ ++  L  WKQ   KK   LF
Sbjct:  864 TSRVEISDDFDDIFGVQLPRLTSEMVQH--KRAVRPTRNVQ-SSKNPLKMLAVREDIRHEYTEQRLNIGLLESKRMKQEKMNKNSGFSEVALAGLASKENFSSVSLRSVNASEQSSNNSAMPYKKLMLIQVKGRRHVQTRLVEPRASSLNSGDCFLLITPHHCFIWIGEFANVIEKAKAAELATFVQTKHDLGCRASYVQ--TIEEGANTHTHAAKDFWKILGGQTS--YQSAGTPEQDEFYESAVVETNCIYRLMEDKLVPHDDYWGRVPRCSMLNPKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNALIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWSDSKNSKKNGDSHVENKELRS---GECRPYDASLMLSAVRAPVRTVLDGVNIGRG--YGLVEGEEGRNFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMISTAVGKRLHSERIIGPGKEKCCYFFWQGRNSTVNEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFNGGMIVHAGKREEEEDNTQNDWRLYCVRGEKPIEGHLLEAVCHCSSLRSRTSMILLNIPKASLYLWHGCKAQVHTRDVGRTTANKIKEQCPLEAGLHSSSKVSIQECDEGAEPQGFWEALG--KRDRKAYDCMLQDPGKFN-FTP-RLFQLSSASGEFAAVEF---VYPSREPNLVNSMPFLQEDLYTATQPALFLVDNHHEVYLWQGWWPQDSE-STGS------------------ARIRWDSDRKCAMETVLQYSKEKNEKKTPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEKEAEVCHQIILVEDVLSRLCKTTYPLAELKARPLPEGVDPLRLETYLSDEDFEGVGASGKKALEMTRSEYEALPGWKQVNVKKAKGLF 1761          
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 529.25 bits (1362), Expect = 5.403e-158
Identity = 319/938 (34.01%), Postives = 499/938 (53.20%), Query Frame = 3
Query: 2109 STNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDL-------FKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ V  +DDFD+IF      L S++  +  KR V+P R+ + SS+NPLK L  R DI++EY E+   +   E KR + + +   +GF E ALA L  KE+FS + L+    S +       PYK LMLI VKGR++VQ RLVEP ASS+N GDC+LL+T  + F+WIGE ANVIE  KA EL +++    +L    S  +   ++   N     A  FWK L   T       G   +DE YE  +  TN +YR++E++L+P+D+YWG   +  ML   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++    K       N E      G+ +P D   +L+        ++DG ++GRG  + ++E    R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G     +FFWQG ++++ EK  SAL T++LD++R  Q++V+Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +E V    SLR R+  +L+N      ++W G  A   ++        ++  + P++  ++  ++  ++E ++G EP+ FW+ +G  K+ + +Y         FN   P R + +S  +G     E    +YP  E N++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K T  + +++AGLEP +F  +FP WE  E+   I        +Q   V DVL+     TY    L+ RPLPE V   R+E+YL+ EDFE +        +MT+ ++  L  WKQ   KK   LF
Sbjct:  864 TSRVEISDDFDDIFGVQLPRLTSEMVQH--KRAVRPTRNVQ-SSKNPLKMLAVREDIRHEYTEQRLNIGLLESKRMKQEKMNKNSGFSEVALAGLASKENFSSVSLRSVNASEQSSNNSAMPYKKLMLIQVKGRRHVQTRLVEPRASSLNSGDCFLLITPHHCFIWIGEFANVIEKAKAAELATFVQTKHDLGCRASYVQ--TIEEGANTHTHAAKDFWKILGGQTS--YQSAGTPEQDEFYESAVVETNCIYRLMEDKLVPHDDYWGRVPRCSMLNPKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNALIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWSDSKNSKKNGDSHVENKELRS---GECRPYDASLMLSAVRAPVRTVLDGVNIGRG--YGLVEGEEGRNFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMISTAVGKRLHSERIIGPGKEKCCYFFWQGRNSTVNEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFNGGMIVHAGKREEEEDNTQNDWRLYCVRGEKPIEGHLLEAVCHCSSLRSRTSMILLNIPKASLYLWHGCKAQVHTRDVGRTTANKIKEQCPLEAGLHSSSKVSIQECDEGAEPQGFWEALG--KRDRKAYDCMLQDPGKFN-FTP-RLFQLSSASGEFAAVEF---VYPSREPNLVNSMPFLQEDLYTATQPALFLVDNHHEVYLWQGWWPQDSE-STGS------------------ARIRWDSDRKCAMETVLQYSKEKNEKKTPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEKEAEVCHQIILVEDVLSRLCKTTYPLAELKARPLPEGVDPLRLETYLSDEDFEGVGASGKKALEMTRSEYEALPGWKQVNVKKAKGLF 1761          
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 526.554 bits (1355), Expect = 6.206e-157
Identity = 318/938 (33.90%), Postives = 498/938 (53.09%), Query Frame = 3
Query: 2109 STNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDL-------FKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ V  +DDFD+IF      L S++  +  KR V+P R+ + SS+NPLK L  R DI++EY E+   +   E KR + + +   +GF E ALA L  KE+FS + L+    S +       PYK LMLI VKGR++VQ RLVEP ASS+N GDC+LL+T  + F+WIGE ANVIE  KA EL +++    +L    S  +   ++   N     A  FWK L   T       G   +DE YE  +  TN +YR++E++L+P+D+YWG   +  ML   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++    K       N E      G+ +P D   +L+        ++DG ++GRG  + ++E    R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++   G+   + R    G     +FFWQG ++++ EK  SAL T++LD++R  Q++V+Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +E V    SLR R+  +L+N      ++W G  A   ++        ++  + P++  ++  ++  ++E ++G EP+ FW+ +G  K+ + +Y         FN   P R + +S  +G     E    +YP  E N++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K T  + +++AGLEP +F  +FP WE  E+   I        +Q   V DVL+     TY    L+ RPLPE V   R+E+YL+ EDFE +        +MT+ ++  L  WKQ   KK   LF
Sbjct:  866 TSRVEISDDFDDIFGVQLPRLTSEMVQH--KRAVRPTRNVQ-SSKNPLKMLAVREDIRHEYTEQRLNIGLLESKRMKQEKMNKNSGFSEVALAGLASKENFSSVSLRSVNASEQSSNNSAMPYKKLMLIQVKGRRHVQTRLVEPRASSLNSGDCFLLITPHHCFIWIGEFANVIEKAKAAELATFVQTKHDLGCRASYVQ--TIEEGANTHTHAAKDFWKILGGQTS--YQSAGTPEQDEFYESAVVETNCIYRLMEDKLVPHDDYWGRVPRCSMLNPKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNALIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWSDSKNSKKNGDLHVENKELRS---GECRPYDASLMLSALRAPVRTVLDGVNIGRG--YGLVEGEEGRNFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMISRAVGKRLHSERIIGPGKEKCCYFFWQGRNSTVNEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFNGGMIVHAGKREEEEDNTQNDWRLYCVRGEKPIEGHLLEAVCHCSSLRSRTSMILLNIPKASLYLWHGCKAQVHTRDVGRTTANKIKEQCPLEAGLHSSSKVSIQECDEGAEPQGFWEALG--KRDRKAYDCMLQDPGKFN-FTP-RLFQLSSASGEFAAVEF---VYPSREPNLVNSMPFLQEDLYTATQPALFLVDNHHEVYLWQGWWPQDSE-STGS------------------ARIRWDSDRKCAMETVLQYSKEKNEKKTPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEKEAEVCHQIILVEDVLSRLCKTTYPLAELKARPLPEGVDPLRLETYLSDEDFEGVGASGKKALEMTRSEYEALPGWKQVNVKKAKGLF 1763          
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 526.554 bits (1355), Expect = 6.206e-157
Identity = 318/938 (33.90%), Postives = 498/938 (53.09%), Query Frame = 3
Query: 2109 STNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDL-------FKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ V  +DDFD+IF      L S++  +  KR V+P R+ + SS+NPLK L  R DI++EY E+   +   E KR + + +   +GF E ALA L  KE+FS + L+    S +       PYK LMLI VKGR++VQ RLVEP ASS+N GDC+LL+T  + F+WIGE ANVIE  KA EL +++    +L    S  +   ++   N     A  FWK L   T       G   +DE YE  +  TN +YR++E++L+P+D+YWG   +  ML   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++    K       N E      G+ +P D   +L+        ++DG ++GRG  + ++E    R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++   G+   + R    G     +FFWQG ++++ EK  SAL T++LD++R  Q++V+Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +E V    SLR R+  +L+N      ++W G  A   ++        ++  + P++  ++  ++  ++E ++G EP+ FW+ +G  K+ + +Y         FN   P R + +S  +G     E    +YP  E N++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K T  + +++AGLEP +F  +FP WE  E+   I        +Q   V DVL+     TY    L+ RPLPE V   R+E+YL+ EDFE +        +MT+ ++  L  WKQ   KK   LF
Sbjct:  866 TSRVEISDDFDDIFGVQLPRLTSEMVQH--KRAVRPTRNVQ-SSKNPLKMLAVREDIRHEYTEQRLNIGLLESKRMKQEKMNKNSGFSEVALAGLASKENFSSVSLRSVNASEQSSNNSAMPYKKLMLIQVKGRRHVQTRLVEPRASSLNSGDCFLLITPHHCFIWIGEFANVIEKAKAAELATFVQTKHDLGCRASYVQ--TIEEGANTHTHAAKDFWKILGGQTS--YQSAGTPEQDEFYESAVVETNCIYRLMEDKLVPHDDYWGRVPRCSMLNPKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNALIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWSDSKNSKKNGDLHVENKELRS---GECRPYDASLMLSALRAPVRTVLDGVNIGRG--YGLVEGEEGRNFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMISRAVGKRLHSERIIGPGKEKCCYFFWQGRNSTVNEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFNGGMIVHAGKREEEEDNTQNDWRLYCVRGEKPIEGHLLEAVCHCSSLRSRTSMILLNIPKASLYLWHGCKAQVHTRDVGRTTANKIKEQCPLEAGLHSSSKVSIQECDEGAEPQGFWEALG--KRDRKAYDCMLQDPGKFN-FTP-RLFQLSSASGEFAAVEF---VYPSREPNLVNSMPFLQEDLYTATQPALFLVDNHHEVYLWQGWWPQDSE-STGS------------------ARIRWDSDRKCAMETVLQYSKEKNEKKTPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEKEAEVCHQIILVEDVLSRLCKTTYPLAELKARPLPEGVDPLRLETYLSDEDFEGVGASGKKALEMTRSEYEALPGWKQVNVKKAKGLF 1763          
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Match: ccdc181 (coiled-coil domain containing 181 [Source:Xenbase;Acc:XB-GENE-972794])

HSP 1 Score: 518.85 bits (1335), Expect = 2.490e-152
Identity = 317/927 (34.20%), Postives = 490/927 (52.86%), Query Frame = 3
Query: 2130 DDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-----IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL-TTHGRYTRNNR---TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQN--KDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            DDFD +F   +  L      +KR V+P R  + +S NPLK L  R DI  EY E    VA  E KR +++ +   + F E ALA L  KE+F+ + L+    + +       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LL+T  + F+W+GE ANVIE  KA+EL S I   +EL    S  +   V+   N     A  FWK L   T       G   EDE YE  I  TN +YR++E++L+P DE+WG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  +      P++     + P      + D++P DI  ++ +   S   ++DG +V RG  + +IE    R++ + T ++++WHI +     +P  + GQF   DAY+++W Y + TT G+  +       G    A+FFWQG ++ ++EK  SAL T++LD++R  Q++V Q  E P F + F G M+VH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +L++ N    ++W G      +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y         FN   P R + +S  +G    +E+   LYP    NV+ + P LQ  LY ++QPALFL+ +   +++W+GWW  + N+  G                    R R  S++ + +++V S+      K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL+ +DFE   +MT+E++  L PWKQ   KK   LF
Sbjct: 1244 DDFDLLFSSEEPKLTSAVAEHKRAVRPARRVQ-ASGNPLKMLAAREDILQEYTETRLNVAFMESKRMKVEKMSKNSNFSEVALAGLASKENFTSVSLRSVNMTEQHSNNSAVPYKKLMLVQIKGRRHVQSRLVEPRASSLNSGDCFLLITPHHCFLWVGEFANVIEKAKASELASIIQTKRELGCRASYVQ--TVEEGINTHTHGAKDFWKLLSGQTES--QAAGSPEEDERYENAIIETNCIYRLLEDKLVPVDEFWGKVPKCSLLESKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGAFDYENCDINPLD--PGECNSLIPRKGHGRPDWAIFGRLTEHNETILFKEKFLDWTEMKK------PNEKGVCEDSPKLKEDPQSDVKPYDIMLMVPVPQKSVGTVLDGLNVARG--YGLIEGDDCRQYEISTVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKYFVSTTVGQRQKTEHVRIAGKEKCAYFFWQGRNSPVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMIVHAGRREEEEENTQSDWRLYCVRGEVPVEGNLMEVACHCSSLRSRTSLILLSINKALIYLWHGCKVQIHAKEVGRTAANKIKEECPLEAGLHSSSKVTIYECDEGSEPPGFWDALG--RRDRKAYDCMLQDPGKFN-FTP-RLFSLSSSSGEFTASEI---LYPSRHPNVVNSMPFLQEDLYTASQPALFLVDNHHEVYLWQGWWPSE-NIITGSA------------------RIRWDSDRKSAMETVLSYCKGKNIKKPPKSYLIHAGLEPLTFTNMFPSWEHREDIAQITEKDAEVSNQIILVEDVLAKLCKRIYPLADLLARPLPEGVDPLKLELYLSDKDFEVALEMTREEYNTLPPWKQVNTKKAKGLF 2129          
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Match: ccdc181 (coiled-coil domain containing 181 [Source:Xenbase;Acc:XB-GENE-972794])

HSP 1 Score: 519.235 bits (1336), Expect = 2.712e-152
Identity = 317/927 (34.20%), Postives = 490/927 (52.86%), Query Frame = 3
Query: 2130 DDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-----IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL-TTHGRYTRNNR---TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQN--KDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            DDFD +F   +  L      +KR V+P R  + +S NPLK L  R DI  EY E    VA  E KR +++ +   + F E ALA L  KE+F+ + L+    + +       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LL+T  + F+W+GE ANVIE  KA+EL S I   +EL    S  +   V+   N     A  FWK L   T       G   EDE YE  I  TN +YR++E++L+P DE+WG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  +      P++     + P      + D++P DI  ++ +   S   ++DG +V RG  + +IE    R++ + T ++++WHI +     +P  + GQF   DAY+++W Y + TT G+  +       G    A+FFWQG ++ ++EK  SAL T++LD++R  Q++V Q  E P F + F G M+VH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +L++ N    ++W G      +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y         FN   P R + +S  +G    +E+   LYP    NV+ + P LQ  LY ++QPALFL+ +   +++W+GWW  + N+  G                    R R  S++ + +++V S+      K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL+ +DFE   +MT+E++  L PWKQ   KK   LF
Sbjct: 1276 DDFDLLFSSEEPKLTSAVAEHKRAVRPARRVQ-ASGNPLKMLAAREDILQEYTETRLNVAFMESKRMKVEKMSKNSNFSEVALAGLASKENFTSVSLRSVNMTEQHSNNSAVPYKKLMLVQIKGRRHVQSRLVEPRASSLNSGDCFLLITPHHCFLWVGEFANVIEKAKASELASIIQTKRELGCRASYVQ--TVEEGINTHTHGAKDFWKLLSGQTES--QAAGSPEEDERYENAIIETNCIYRLLEDKLVPVDEFWGKVPKCSLLESKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGAFDYENCDINPLD--PGECNSLIPRKGHGRPDWAIFGRLTEHNETILFKEKFLDWTEMKK------PNEKGVCEDSPKLKEDPQSDVKPYDIMLMVPVPQKSVGTVLDGLNVARG--YGLIEGDDCRQYEISTVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKYFVSTTVGQRQKTEHVRIAGKEKCAYFFWQGRNSPVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMIVHAGRREEEEENTQSDWRLYCVRGEVPVEGNLMEVACHCSSLRSRTSLILLSINKALIYLWHGCKVQIHAKEVGRTAANKIKEECPLEAGLHSSSKVTIYECDEGSEPPGFWDALG--RRDRKAYDCMLQDPGKFN-FTP-RLFSLSSSSGEFTASEI---LYPSRHPNVVNSMPFLQEDLYTASQPALFLVDNHHEVYLWQGWWPSE-NIITGSA------------------RIRWDSDRKSAMETVLSYCKGKNIKKPPKSYLIHAGLEPLTFTNMFPSWEHREDIAQITEKDAEVSNQIILVEDVLAKLCKRIYPLADLLARPLPEGVDPLKLELYLSDKDFEVALEMTREEYNTLPPWKQVNTKKAKGLF 2161          
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Match: ccdc181 (coiled-coil domain containing 181 [Source:Xenbase;Acc:XB-GENE-972794])

HSP 1 Score: 518.85 bits (1335), Expect = 2.747e-152
Identity = 317/927 (34.20%), Postives = 490/927 (52.86%), Query Frame = 3
Query: 2130 DDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-----IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL-TTHGRYTRNNR---TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQN--KDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            DDFD +F   +  L      +KR V+P R  + +S NPLK L  R DI  EY E    VA  E KR +++ +   + F E ALA L  KE+F+ + L+    + +       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LL+T  + F+W+GE ANVIE  KA+EL S I   +EL    S  +   V+   N     A  FWK L   T       G   EDE YE  I  TN +YR++E++L+P DE+WG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  +      P++     + P      + D++P DI  ++ +   S   ++DG +V RG  + +IE    R++ + T ++++WHI +     +P  + GQF   DAY+++W Y + TT G+  +       G    A+FFWQG ++ ++EK  SAL T++LD++R  Q++V Q  E P F + F G M+VH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +L++ N    ++W G      +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y         FN   P R + +S  +G    +E+   LYP    NV+ + P LQ  LY ++QPALFL+ +   +++W+GWW  + N+  G                    R R  S++ + +++V S+      K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL+ +DFE   +MT+E++  L PWKQ   KK   LF
Sbjct: 1274 DDFDLLFSSEEPKLTSAVAEHKRAVRPARRVQ-ASGNPLKMLAAREDILQEYTETRLNVAFMESKRMKVEKMSKNSNFSEVALAGLASKENFTSVSLRSVNMTEQHSNNSAVPYKKLMLVQIKGRRHVQSRLVEPRASSLNSGDCFLLITPHHCFLWVGEFANVIEKAKASELASIIQTKRELGCRASYVQ--TVEEGINTHTHGAKDFWKLLSGQTES--QAAGSPEEDERYENAIIETNCIYRLLEDKLVPVDEFWGKVPKCSLLESKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGAFDYENCDINPLD--PGECNSLIPRKGHGRPDWAIFGRLTEHNETILFKEKFLDWTEMKK------PNEKGVCEDSPKLKEDPQSDVKPYDIMLMVPVPQKSVGTVLDGLNVARG--YGLIEGDDCRQYEISTVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKYFVSTTVGQRQKTEHVRIAGKEKCAYFFWQGRNSPVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMIVHAGRREEEEENTQSDWRLYCVRGEVPVEGNLMEVACHCSSLRSRTSLILLSINKALIYLWHGCKVQIHAKEVGRTAANKIKEECPLEAGLHSSSKVTIYECDEGSEPPGFWDALG--RRDRKAYDCMLQDPGKFN-FTP-RLFSLSSSSGEFTASEI---LYPSRHPNVVNSMPFLQEDLYTASQPALFLVDNHHEVYLWQGWWPSE-NIITGSA------------------RIRWDSDRKSAMETVLSYCKGKNIKKPPKSYLIHAGLEPLTFTNMFPSWEHREDIAQITEKDAEVSNQIILVEDVLAKLCKRIYPLADLLARPLPEGVDPLKLELYLSDKDFEVALEMTREEYNTLPPWKQVNTKKAKGLF 2159          
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Match: ccdc181 (coiled-coil domain containing 181 [Source:Xenbase;Acc:XB-GENE-972794])

HSP 1 Score: 518.85 bits (1335), Expect = 5.742e-152
Identity = 317/927 (34.20%), Postives = 490/927 (52.86%), Query Frame = 3
Query: 2130 DDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-----IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL-TTHGRYTRNNR---TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQN--KDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            DDFD +F   +  L      +KR V+P R  + +S NPLK L  R DI  EY E    VA  E KR +++ +   + F E ALA L  KE+F+ + L+    + +       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LL+T  + F+W+GE ANVIE  KA+EL S I   +EL    S  +   V+   N     A  FWK L   T       G   EDE YE  I  TN +YR++E++L+P DE+WG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  +      P++     + P      + D++P DI  ++ +   S   ++DG +V RG  + +IE    R++ + T ++++WHI +     +P  + GQF   DAY+++W Y + TT G+  +       G    A+FFWQG ++ ++EK  SAL T++LD++R  Q++V Q  E P F + F G M+VH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +L++ N    ++W G      +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y         FN   P R + +S  +G    +E+   LYP    NV+ + P LQ  LY ++QPALFL+ +   +++W+GWW  + N+  G                    R R  S++ + +++V S+      K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL+ +DFE   +MT+E++  L PWKQ   KK   LF
Sbjct: 1362 DDFDLLFSSEEPKLTSAVAEHKRAVRPARRVQ-ASGNPLKMLAAREDILQEYTETRLNVAFMESKRMKVEKMSKNSNFSEVALAGLASKENFTSVSLRSVNMTEQHSNNSAVPYKKLMLVQIKGRRHVQSRLVEPRASSLNSGDCFLLITPHHCFLWVGEFANVIEKAKASELASIIQTKRELGCRASYVQ--TVEEGINTHTHGAKDFWKLLSGQTES--QAAGSPEEDERYENAIIETNCIYRLLEDKLVPVDEFWGKVPKCSLLESKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGAFDYENCDINPLD--PGECNSLIPRKGHGRPDWAIFGRLTEHNETILFKEKFLDWTEMKK------PNEKGVCEDSPKLKEDPQSDVKPYDIMLMVPVPQKSVGTVLDGLNVARG--YGLIEGDDCRQYEISTVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKYFVSTTVGQRQKTEHVRIAGKEKCAYFFWQGRNSPVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMIVHAGRREEEEENTQSDWRLYCVRGEVPVEGNLMEVACHCSSLRSRTSLILLSINKALIYLWHGCKVQIHAKEVGRTAANKIKEECPLEAGLHSSSKVTIYECDEGSEPPGFWDALG--RRDRKAYDCMLQDPGKFN-FTP-RLFSLSSSSGEFTASEI---LYPSRHPNVVNSMPFLQEDLYTASQPALFLVDNHHEVYLWQGWWPSE-NIITGSA------------------RIRWDSDRKSAMETVLSYCKGKNIKKPPKSYLIHAGLEPLTFTNMFPSWEHREDIAQITEKDAEVSNQIILVEDVLAKLCKRIYPLADLLARPLPEGVDPLKLELYLSDKDFEVALEMTREEYNTLPPWKQVNTKKAKGLF 2247          
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Match: ccdc181 (coiled-coil domain containing 181 [Source:Xenbase;Acc:XB-GENE-972794])

HSP 1 Score: 518.85 bits (1335), Expect = 6.757e-152
Identity = 317/927 (34.20%), Postives = 490/927 (52.86%), Query Frame = 3
Query: 2130 DDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-----IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL-TTHGRYTRNNR---TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQN--KDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            DDFD +F   +  L      +KR V+P R  + +S NPLK L  R DI  EY E    VA  E KR +++ +   + F E ALA L  KE+F+ + L+    + +       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LL+T  + F+W+GE ANVIE  KA+EL S I   +EL    S  +   V+   N     A  FWK L   T       G   EDE YE  I  TN +YR++E++L+P DE+WG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  +      P++     + P      + D++P DI  ++ +   S   ++DG +V RG  + +IE    R++ + T ++++WHI +     +P  + GQF   DAY+++W Y + TT G+  +       G    A+FFWQG ++ ++EK  SAL T++LD++R  Q++V Q  E P F + F G M+VH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +L++ N    ++W G      +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y         FN   P R + +S  +G    +E+   LYP    NV+ + P LQ  LY ++QPALFL+ +   +++W+GWW  + N+  G                    R R  S++ + +++V S+      K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL+ +DFE   +MT+E++  L PWKQ   KK   LF
Sbjct: 1389 DDFDLLFSSEEPKLTSAVAEHKRAVRPARRVQ-ASGNPLKMLAAREDILQEYTETRLNVAFMESKRMKVEKMSKNSNFSEVALAGLASKENFTSVSLRSVNMTEQHSNNSAVPYKKLMLVQIKGRRHVQSRLVEPRASSLNSGDCFLLITPHHCFLWVGEFANVIEKAKASELASIIQTKRELGCRASYVQ--TVEEGINTHTHGAKDFWKLLSGQTES--QAAGSPEEDERYENAIIETNCIYRLLEDKLVPVDEFWGKVPKCSLLESKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGAFDYENCDINPLD--PGECNSLIPRKGHGRPDWAIFGRLTEHNETILFKEKFLDWTEMKK------PNEKGVCEDSPKLKEDPQSDVKPYDIMLMVPVPQKSVGTVLDGLNVARG--YGLIEGDDCRQYEISTVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKYFVSTTVGQRQKTEHVRIAGKEKCAYFFWQGRNSPVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMIVHAGRREEEEENTQSDWRLYCVRGEVPVEGNLMEVACHCSSLRSRTSLILLSINKALIYLWHGCKVQIHAKEVGRTAANKIKEECPLEAGLHSSSKVTIYECDEGSEPPGFWDALG--RRDRKAYDCMLQDPGKFN-FTP-RLFSLSSSSGEFTASEI---LYPSRHPNVVNSMPFLQEDLYTASQPALFLVDNHHEVYLWQGWWPSE-NIITGSA------------------RIRWDSDRKSAMETVLSYCKGKNIKKPPKSYLIHAGLEPLTFTNMFPSWEHREDIAQITEKDAEVSNQIILVEDVLAKLCKRIYPLADLLARPLPEGVDPLKLELYLSDKDFEVALEMTREEYNTLPPWKQVNTKKAKGLF 2274          
BLAST of HP domain-containing protein vs. Ensembl Mouse
Match: Svil (supervillin [Source:MGI Symbol;Acc:MGI:2147319])

HSP 1 Score: 513.072 bits (1320), Expect = 4.044e-152
Identity = 319/942 (33.86%), Postives = 494/942 (52.44%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L S  ++  +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct:  872 PRSPVELEEDFDVIFDPYAPKLTS--SVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 1766          
BLAST of HP domain-containing protein vs. Ensembl Mouse
Match: Svil (supervillin [Source:MGI Symbol;Acc:MGI:2147319])

HSP 1 Score: 513.072 bits (1320), Expect = 8.990e-151
Identity = 319/942 (33.86%), Postives = 494/942 (52.44%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIF------LQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L S  ++  +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct: 1162 PRSPVELEEDFDVIFDPYAPKLTS--SVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 2056          
BLAST of HP domain-containing protein vs. Ensembl Mouse
Match: Svil (supervillin [Source:MGI Symbol;Acc:MGI:2147319])

HSP 1 Score: 512.301 bits (1318), Expect = 3.955e-150
Identity = 318/940 (33.83%), Postives = 491/940 (52.23%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct: 1276 PRSPVELEEDFDVIFDPYAPKLTSSVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 2170          
BLAST of HP domain-containing protein vs. Ensembl Mouse
Match: Svil (supervillin [Source:MGI Symbol;Acc:MGI:2147319])

HSP 1 Score: 512.301 bits (1318), Expect = 3.955e-150
Identity = 318/940 (33.83%), Postives = 491/940 (52.23%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct: 1276 PRSPVELEEDFDVIFDPYAPKLTSSVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 2170          
BLAST of HP domain-containing protein vs. Ensembl Mouse
Match: Svil (supervillin [Source:MGI Symbol;Acc:MGI:2147319])

HSP 1 Score: 512.301 bits (1318), Expect = 3.955e-150
Identity = 318/940 (33.83%), Postives = 491/940 (52.23%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct: 1276 PRSPVELEEDFDVIFDPYAPKLTSSVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 2170          
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Match: sp|O95425|SVIL_HUMAN (Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2)

HSP 1 Score: 517.309 bits (1331), Expect = 7.590e-151
Identity = 316/934 (33.83%), Postives = 493/934 (52.78%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS---IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V  ++DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  KE+FS + L+    TE N        PYK LML+ +KGR++VQ RLVEP AS++N GDC+LLL+    F+W+GE ANVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R  +  +P +    +  P   D++  D+  +++M   +   I+DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G    TE    +YP    +V+ + P LQ  LY + QPALFL+ +   +++W+GWW ++  ++                      R R AS++ + +++V  +      K  A    +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    MT++++  L  WKQ   KK   LF
Sbjct: 1320 PRSPVEMDEDFDVIFDPYAPKLTSSVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKRLMLLQIKGRRHVQTRLVEPRASALNSGDCFLLLSPHCCFLWVGEFANVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYEAAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQPKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKRSNE-KNPGELAQHKEDP-RTDVKAYDVTRMVSMPQTTAGTILDGVNVGRG--YGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFMVSTAVGSRQKGEHSVRAAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVNKALIYLWHGCKAQAHTKEVGRTAANKIKEQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFAATEF---VYPARAPSVVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGS-------------------ARIRWASDRKSAMETVLQYCKGKNLKKPAPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 2214          
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K4L3|SVIL_MOUSE (Supervillin OS=Mus musculus OX=10090 GN=Svil PE=1 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 2.766e-149
Identity = 318/940 (33.83%), Postives = 491/940 (52.23%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER----FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNN-----ERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNR----TGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL---TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V   +DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + S + F E  LA L  +E+FS I L+   S  L E+       PYK LML+ +KGR++VQ RLVEP ASS+N GDC+LLL+ Q  F+W+GE +NVIE  KA+EL + I   +EL    +  +   ++   N     A  FWK L   T       GD  EDELYE  I  TN VYR+ +++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GR+ +  ET LFKEKF DW E  R      P++ N+     +++ P   D++P D+  ++     +   I+DG +VGRG  + ++E    R+F + T ++++WHI +     +P  + GQF   DAY+++W Y  +T  G   +        G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++  +S  RL+ +RGE+  E + +EV     SLR R+  +++N N    ++W G  A   +K        ++  + P++  ++ +    + E ++G EP  FW  +G  ++ + +Y        SFN   P R + +S  +G  + TE    +YP    + + + P LQ  LY + QPALFL+ +   +++W+GWW  +  ++                      R R AS++ + +++V  +      K     + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    M++++F  L  WKQ   KK   LF
Sbjct: 1276 PRSPVELEEDFDVIFDPYAPKLTSSVAEHKRQVRPKRRVQ-ASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLR---SVNLMEQNSNNSAMPYKKLMLLQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCRATYIQ--TIEEGINTHTHAAKDFWKLLGGQTS--YQSAGDPKEDELYETAIIETNCVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKR------PTEKNSGEVVQQKDDP-RADVKPYDVTRMVATPQITAGTILDGVNVGRG--YGLVEGDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGSFN-FAP-RLFILSSSSGDFSATEF---VYPAQAPSAVSSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGS-------------------ARIRWASDRKSAMETVLQYCRGKNLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF 2170          
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Match: sp|O46385|SVIL_BOVIN (Supervillin OS=Bos taurus OX=9913 GN=SVIL PE=1 SV=2)

HSP 1 Score: 511.146 bits (1315), Expect = 8.221e-149
Identity = 312/938 (33.26%), Postives = 494/938 (52.67%), Query Frame = 3
Query: 2106 PSTNVPTNDDFDEIFLQSDLNLNL----NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR---TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTN----NERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY--------SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQ---NKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            P + V  ++DFD IF      L      +KR V+P R  + +S+NPLK L  R D+  EY E+   VA  E KR +++ + + + F E  LA L  KE+FS + L+    TE N        PYK LML+ VKGR++VQ RLVEP A S+N GDC+LLL+  + F+W+GE ANVIE  KA+EL S I   +EL    +  +   V+   N     A  FWK L           GD  EDELYE  I  TN +YR+++++L+P D+YWG   K  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y++C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E  R      P++ N     +       +++P D+  ++ +   +   ++DG +VGRG  + ++E    R+F + + ++++WHI +     +P  + GQF   DAY+++W + ++T  G   +   +    G     +FFWQG  ++++EK  SAL T++LD++R  Q++V Q  E P F + F G MVVH G+++  ++ ++S  RL+ +RGE+  E + +EV     SLR R+  +++N +    ++W G  A   +K        ++  + P++  ++  ++  + E ++G EP  FW  +G  ++ + +Y        +FN   P R + +S  +G  + TE    +YP  + +V+ + P LQ  LY + QPALFL+ +   +++W+GWW ++  ++                      R R AS++ + +++V  +       K    + +++AGLEP +F  +FP WE  E+   I        NQ   V DVL       Y    L  RPLPE V   ++E YL  EDFE    MT++++  L  WKQ   KK   LF
Sbjct: 1300 PRSPVELDEDFDVIFDPYAPRLTSSVAEHKRAVRPKRRVQ-ASKNPLKMLAAREDLLQEYTEQRLNVAFVESKRMKVEKLSANSSFSEVTLAGLASKENFSNVSLRSVNLTEQNS--NNSAVPYKKLMLLQVKGRRHVQTRLVEPRAPSLNSGDCFLLLSPHHCFLWVGEFANVIEKAKASELASLIQTKRELGCRATYIQ--TVEEGINTHTHAAKDFWKLLGGQAS--YQSAGDPKEDELYETAIIETNCIYRLMDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGTFDYENCDINPLD--PGECNPLIPRKGQGRPDWAIFGRLTEHNETILFKEKFLDWTELKR------PNEKNASELAQHKDDARAEVKPYDVTRMVPVPQTTAGTVLDGVNVGRG--YGLVEGDDRRQFEIASISVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKFIVSTAVGSRQKGEHSVRVAGKEKCVYFFWQGRQSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVHSGRREEEEENTQSEWRLYCVRGEVPVEGNLLEVACHCSSLRSRTSMVVLNVHKALIYLWHGCKAQAHTKEVGRTAANKIKDQCPLEAGLHSSSKVTIHECDEGSEPLGFWDALG--RRDRKAYDCMLQDPGNFN-FTP-RLFILSSSSGDFSATEF---MYPARDPSVVNSMPFLQEDLYSAPQPALFLVDNHHEVYLWQGWWPIENKITGSA-------------------RIRWASDRKSAMETVLQYCRGKNLKKPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 2194          
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WQ85|VILD_DICDI (Villidin OS=Dictyostelium discoideum OX=44689 GN=vilA PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 1.936e-35
Identity = 189/816 (23.16%), Postives = 333/816 (40.81%), Query Frame = 3
Query: 2457 KDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQII--NPPGDVSEDELYERMIQHTNMVYR--VVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGN-ILNMSHPSTHIIIDGKS-----VGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRV---TQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDM----GIIKKWKSSYSFNSLVPI------RGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDN--VTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            K  +LI VKG++ ++VR+V+ + SS+N  + ++L     +FVW G   + +   KA +  + I + KE        K T+++ D   ++  +  FW+ L  ++   I   P  +  + E  +  I    +  +   +  RL      W  P K ++L    V++ D  TE+++W G ++    +     +  +L +Q                             R +W  + RL + GE  LFKEKF+++P       ++  S T  E    I+  +    + + I  ++   T   ID ++     +  GG+ KV                  W I D   +  P     QFFS+D+YI+ +         Y +NN+  +++   +++ G  +SI EK  SA  T+DL++  V    Q RV  N E   F  LF   MV+H GK      P K  L+ ++G  + +   V+V   S  L    V +L      + ++W G F+    ++ A    +            N     +E +++G E   FW       G  K +      +S +P       R +  S  +G++ +TE                 P  Q  L   +  ++ ++   SH+++W G     R               E+ LN++   +                 L  +K+     I     EP  F+  F  W  ++  ++        L ++D   V  VL +YL   Y+ E L   PLP  V S+++++YL  EDFE +FKMT+ ++ ++  WK+   KKE+ LF
Sbjct: 1025 KQKILIQVKGKRKIRVRMVKLSTSSLNCHNSFILDAGPRIFVWAGSKTSRVNKAKALDFANRI-RTKE-----RGGKSTLIQLDQG-RDEQSFDFWEILGGNSSDPIATTPTPEEQDTESIKTTIYRVGLDVKKNSLRARLAWEGTDWKLPNK-EILNTKFVYVVDCVTEIFVWVGKESSSIQRKMATKVALVLQAQ---------------------------KDRVDWTKITRLTEFGENNLFKEKFANYP------GMLPISTTRQE----IKSHVATSKVEHKIETLASRMTTPFIDNEALFTIPIDEGGRVKV------------------WKIEDYEKIDHPQHLYSQFFSSDSYIVLYT--------YMQNNKEAHVI---YYYLGRDSSINEKGTSAYLTVDLNESLVGACVQTRVVANKECKNFLNLFKTKMVIHKGKYN-NYDPKKPSLYQVKGLDKIDIRAVQVEFSSSMLNTLHVSIL--RTPEKIYIWHGKFSLDAEQNSALSIAENF----------NSTSAPIEILKEGSESNEFWSAFESTGGRQKYFNDIMIQSSSIPTSFTYKPRFFVCSNASGIVEVTE---------------ESPFSQDDL---DIGSVCILDVQSHIYLWIGSRATHRTKRAS---------MEVVLNFIETSK-----------------LGHSKEHTKVLIATPFEEPIGFKSYFRAWCTSKYPKN-----KLPLVEKDGIPVEQVLKDYLKEIYTYEELLADPLPAGVDSTKLDTYLNDEDFEKVFKMTRTEWLKIPAWKREGIKKELFLF 1704          
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q07171|GELS_DROME (Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 1.744e-26
Identity = 126/545 (23.12%), Postives = 221/545 (40.55%), Query Frame = 3
Query: 2469 LISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVE-NRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPET----SRLIKIISPSQTNNERNKPIEGDLQPIDIGN--ILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVD-FRINYNEFKLEEIEQGKEPRTFWQDM 4079
            L  VKG++NV+VR V  + SS+N GDC++L    +++V++G  A  +E  KA      I+   ++     + +  +   DD   +++   F+  L   +   +       ED  +ER       +Y+V + +  +  D     PL   ML   + FI D G+ +++W G  A  K K +      +  +Q F                            P W  + R+ +  E+  FK+ F  W +     SRLI+                     + IG+  +LN     + +    KS GR   +  + D        IT+ +      +     VP           +Y++ +NYE         N  TG+L    + W G+  S   +  +    +   KD +  ++  Q HE   F ++F G ++           P  ++LF IRG +ES+ H  EV  +S SL     F+L +   ++ ++W+G  AS   K  A            VD F   +++ +LE++E+G EP  FW+++
Sbjct:  194 LFQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKA------ISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDA-----MAKAQEF----------------------LRTKKYPAWTQIHRIVEGSESAPFKQYFDTWRDAGMSHSRLIR-------------------SALGIGSDELLNDDEIDSVVTQLKKSGGRA--FGFMPDHGQNVIETITQYVAKPGSDEIVVSTVPFDEKLPLLGFASYVLTYNYE-------ANNGDTGSLT---YVWHGVKASAAARKRAFEEGLVGSKDGLL-VQTNQGHEPRHFYKIFKGKLLT-----SFTALPVTAQLFRIRGTVESDVHASEVAADSSSLASSDAFVLHSGKSHKIYIWNGLGASAFEKQAA------------VDRFSDYWDDVELEQVEEGAEPDEFWEEL 656          

HSP 2 Score: 55.8398 bits (133), Expect = 3.492e-6
Identity = 40/141 (28.37%), Postives = 62/141 (43.97%), Query Frame = 3
Query: 3417 TKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLD---KDRVTQIRVKQNHESPAFCRLFDGSMVVHIG------KQQLAKKPSKSRLFIIRGE 3812
            T  +E+W I +   V+ P TN G+F++ D++I+    E         N +   L     FW G+ TS  E  A+A+ T+ LD        Q R  Q+HES  F   F   +    G      K        ++RLF ++G+
Sbjct:   69 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIE---------NKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKGK 200          
BLAST of HP domain-containing protein vs. TrEMBL
Match: K1P9W8 (Supervillin OS=Crassostrea gigas OX=29159 GN=CGI_10014153 PE=4 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 388/1151 (33.71%), Postives = 625/1151 (54.30%), Query Frame = 3
Query: 1482 YSKKPHLTQPIT---KLDMEAHNSIEANSSIKDRISQIQ-TQENSWKARLRKDTD-----VETKCR-------PNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVR-LTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTT-----HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKL-EEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVP------IRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASI-VYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            Y    H TQPIT   K + E   S E   S++DR+S ++ + E  WK R+ K  +     VE K R       P    I+     L+ +   WK RVE+ D   FT  +KL    + + + K+     +  ++  +G   I+   T   +  K P  +T+IS   V E+++     E K   ++AA+ V++ P+      KV +P+  D+ L +FF  S + +E       T +DF+E+F+ ++ ++    R ++P R    S RNPLK  +   +I+ EY+E   G AE E++R Q + I  KAGF E ALA L  KE+F+++ L++T E        + PYKDLMLI VKGR+ VQ+RLVEP+A SIN GDCY+L+T   V  W+GE ANVIE  KA ++ ++I + K+L       K T+V++ +  ++      +FW  +    ++ I+  G   EDELYE  I  +NMVY++  N L+PY EYWG   K +ML  DQV +FDFGTELY+W G     + +  G  L + L+ +G++Y +C INP+ PL        P     RP W + G++ Q  ET LF+EKFSDWP+TSRLIK+    ++ +  +K    +L+P D   ++ ++  +  ++++G +VGRG  W    +G +RE  ++T  + +WH+ +     +P  + GQF   D Y++RW Y +T+      G  +R +  G    A+FFWQG +++I EK ASAL T++LD++R  Q+RV +  E P F  LF G M+ HIGK++     ++   R + +RGE E+E   +E+   +  LR R+ F+++N      F+W G  + P  +  AS   ++L  K P++  +    + L  E+E+G E    W  +G+    +S Y  +   P      +R + ++ ++G  ++ E+   L P    ++   FP+LQ  LY  +QP LFL+   + +++W GWW         + D+ ++     N++  S      A  K A+  ++     +N +    ++ VYAGLEP  F  LFPYW+V+E A+S+NL    +  +  ++ D+L       Y+ E L E  LPE V + R+ESYL  E+FE++ ++++E+FY+L  WKQ + K++V LF
Sbjct:  861 YGATRHKTQPITPEEKREAEGGQSSEVKVSVRDRLSLLKKSGEEEWKKRVSKPAELQAEEVEVKLREKRALDAPRPHSIADRLNLLETSQIGWKGRVEENDAKRFTVAHKLAGQVEESPLMKKLRERSKRESESESGSPDILSPSTPTRDLPKIPLPKTIISGPPV-EAETEAKPKEVKVGITMAAEEVKA-PV------KVEVPSMDDEVLKSFFRHSSETSEVHEKIDVTVEDFNELFIIAN-DMLPTMRKIRPKRKHATSVRNPLKTTS--VEIRTEYEEVKMGYAELEIRRKQKEKIADKAGFAEAALAGLASKENFARVSLRKTGEPGMGLPSRLDPYKDLMLIHVKGRRKVQIRLVEPSAKSINSGDCYILVTPDKVITWVGEFANVIEKAKAADIATFIVQKKDLGT-----KATLVETVEEKRHHLGTGKKFWSAI--GGLKTISSAGPTEEDELYENHIMASNMVYKLENNSLVPYQEYWGGQPKQEMLKKDQVLVFDFGTELYVWQGKAVKPERRKMGVKLARQLYEKGYDYSACDINPMSPLSTEEMGGMPAAAKERPAWCLFGKVNQNMETILFREKFSDWPDTSRLIKV----KSLDAGSKTDLTELKPYDAKLMIPVNKGAVSLVLEGSNVGRGNVWHEDMEGFIREQDIVTLGVTVWHVLEYEHYKMPDPSFGQFHDGDTYVVRWQYMITSKGMNLKGTQSRKSLVGRERCAYFFWQGKNSTINEKGASALMTVELDEERGPQVRVAEGKEMPCFLNLFKGRMITHIGKREDEATNTQGAWRCYCVRGEYENETCLIEIPMGADRLRSRASFIMLNVKSGLMFVWHGCKSPPHCREMASKAAERLKDKCPLEVGVKEGIYILITEMEEGSEKPELWSALGVKANTRSLYCSHMTDPTPYDYTLRVFHMTSVSGNFDVHEI---LNPSRSPDLSTPFPVLQADLYNVSQPGLFLVDDDNIVYLWHGWW--------KEADAEVE-----NVHTGSAKSRFSADRKCAIETALHYCKEKNPESPPKAVAVYAGLEPLDFTNLFPYWDVDESAKSLNLRDGKQDGEMTSLEDILGKMTKTRYTYEELMEDDLPEGVDAKRLESYLDDEEFEEIMEISREEFYKLPQWKQDKIKQQVGLF 1973          
BLAST of HP domain-containing protein vs. TrEMBL
Match: A0A2R2MLJ1 (supervillin-like OS=Lingula unguis OX=7574 GN=LOC106160984 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 396/1185 (33.42%), Postives = 614/1185 (51.81%), Query Frame = 3
Query: 1458 KGYKQTKSYSKKPHLTQPIT----KLDMEAHNSIEANSSIKDRISQIQ-TQENSWKARLRKD-----TDVETKCRP---------NSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQT-LISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHK-------------VTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSP--------YKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQ-FWKCLH-YDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGR-------YTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYN-EFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPI----RGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWI----LDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            K  ++ KSY+++ H TQPIT    +   +    ++  SSIK+R++ ++ + + +WK R+ KD     + V+ + RP         N+  I+    Q+ +++  WK+RVE+KDV +FT   K+ K  K ++     T                      + K  P PK T   SD   DE        E K  +S   D    +P +  E HK             V +P   D++   FF       E   +   + DDF+E+F+ +   L   K+  +P R +K  S+NPLK L  R DI++EY E  + VA+RELKR + Q I S+AG  E ALA L   EDF+KI LK+     L +  V+P        YK +ML+ VKGR++VQ RLVEP   S+N GD ++L+   +V  W GE ANVIE  KA+++ ++I + K+L    + D  ++   D+  ++  A + FWK L   D   +  PP    EDE+YE+ +  TNM+YR  ++ L+PY EYWG+  K++ML  DQ+F++DFG E+Y+W G       +     L + ++ QG++Y  C INP  PL +  +   P     RP+W + G++ Q  ET LFKEKF DWP+ +R+I +      +  +N+P   +L+  D   ++ +      + ++G++VGRG  W    +G+ RE+ ++T  + MWHI +     +P    GQF + D Y++RW + +   G          R + TG    A+FFWQG  ++I+EK ASAL T++LD++R  Q+RV +  E PAF  LF+G M+ +IGK++     ++   RL+ IRGE+E+E + VEV  +   LR RS FLL+N      ++W G   +  ++  A    Q+L  K PV+  ++      + E+E+G E  +FW  +    + K      S        R + ++ + G   ++E+   L P    + + AFP +QT LYK +QPAL LI + + +F+W+GWW      D N+  G   +  D +             R+A E    LK        +  K  A +VYAGLEP  F  LFPYWE  E+  S+NL   +   Q DN+ + +       Y+   L+ERPLP  V   ++ESYL+ E+FE++  MTKE+FY L  WKQ + KK   LF
Sbjct:   21 KNQRKIKSYTQERHKTQPITDAEKEEAEKEEEGLKVGSSIKERLAFLKKSGDEAWKKRIGKDVGGEDSPVKLRDRPARQGLDVKENTGSIADRLNQIAKSSQGWKDRVEEKDVDQFTVEGKINKQEKQDDSLASSTPRAPP--------------APGAFKLPPLPKHTPRASDDAEDE--------EGKLQKSYTVD----DPEHAAEQHKTSEMGVEAKQINKVQVPQADDETFDAFFQKPAQTKEDSESVRVSVDDFNELFMDAGEILQTAKK-ARPQR-RKAGSKNPLKSLAARKDIQSEYIEIRTDVADRELKRVKRQAIASEAGLAEAALAGLASTEDFAKIALKKM---NLSQGAVTPGGMGRMDPYKSVMLLQVKGRRHVQTRLVEPCPLSVNSGDSFVLIVDGSVVHWTGEYANVIEKAKASDISTYIVQKKDLGCKNARDVGSV---DEKKQHLGAGKLFWKTLGGQDEYTMSGPP---EEDEIYEQCMVQTNMIYRFEDDSLVPYTEYWGNVPKYEMLNPDQIFVYDFGPEMYVWLGKNMPFDKRKIAIKLARQIWDQGYDYSECDINPFSPLRSEEDGGAPAKADKRPDWSLFGKITQNMETILFKEKFLDWPDPARIITVKGADTDSKTKNEPAV-ELKAYDAAVMVPLDTSPVTLCLEGQNVGRGLNWAEEYEGLWREYDILTLGLAMWHILEFDHYQLPEECLGQFHNQDTYVVRWQFLVGQKGMKNLKGGVSNRQSMTGRERCAYFFWQGKGSTISEKGASALMTVELDEERGPQVRVTEGKEPPAFLNLFEGRMITYIGKREEESTNTQGSWRLYAIRGELETETNLVEVPAKVECLRSRSSFLLLNIKTGYLYVWHGCKCTANTRKNALAAAQRLKNKCPVEVGLHEKASIVITEVEEGSEKSSFWAGLDCKDRDKYDTLLKSPAKFDYTPRLFNMTSVAGTFEVSEV---LNPCRHPDYVSAFPFIQTDLYKHSQPALCLIDNKTEVFLWQGWWPEGTEEDENVKTGSAHARFDVD------------KRLAME--TTLKYCKECNPSSPAK--AYLVYAGLEPKHFVNLFPYWEYREDVTSLNLKEGFVDGQMDNMEESMTELCRSRYTMAELQERPLPSGVDPLKLESYLSDEEFEEILHMTKEEFYSLPKWKQSDLKKPAGLF 1148          
BLAST of HP domain-containing protein vs. TrEMBL
Match: A0A210QRF5 (Supervillin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24675 PE=4 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 3.318e-179
Identity = 393/1157 (33.97%), Postives = 601/1157 (51.94%), Query Frame = 3
Query: 1497 HLTQPITKLDME-AHNSIE-ANSSIKDRISQIQ-TQENSWKARLRK----DTDVETKCRPNSVVISSIQE------------------QLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRT-ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTT------HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLV--------PIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL-TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            H TQPIT  + + A +  E +NSSIKDR+S ++ + +  W+ R+ K    D+ V+ K R  S V   ++E                  Q++ + + WK RVE+ D  +FT  +K+    +++ +  +     +  +D  +G       T + E  K P   TL+S           +VD + + ++   +     P+      KV++P   +        S+    +     V   D FD++F++++ ++    R ++P R     S+NPLK ++   ++K+EY+E   G AE+ELKR +      +AGF +EALA L  KE+FSK+ L++T E        + PYKDLML+ VKGR+ VQ RLVEP A SIN GDCY+L+T      WIGE  NVIE  KA ++ S I + K++   G+    T V S +  +       QFW  L     + I P G   EDELYE  I  TNMVY + +N L PY EYWG+  K++ML  DQV IFD+GTE Y+W G       +     L + L+ +G++Y SC INPL  L        P   S RP+W + G++ Q  ET LFKEKFSDWP++SRLI+    SQT+   NK    +L+P D   ++ +      ++++G  VGRG +W    +G  RE S+ITK + +WH+ +     +P  + GQF   D Y++RW Y +T        G   R ++ G    A+FFWQG +++I EK ASAL T++LD++R  QIRV +  E P F  LF G MV+HIGK++     ++   R + +R +  +EA  VE+      LR RS F+L+N N    ++W G       +         L AK P++  + +  E  + E+E+G E   F + MG     ++ Y  +SL+         +R + +S ++GV  + E+     P    +++  +P LQ+ LYK++QPALFL+ +   +F+W GWW         + D+ I    +   N            K A+   +     +N D   +A  V+AGLEPT F  +FPYWEV+E   +INL       +  ++ D+L       Y+   L+ERPLP+ V   ++E YL  E+FE+   MTK+ FY L  W+QH+ KK+VDLF
Sbjct: 3887 HKTQPITPEEKKLAEDRQEGSNSSIKDRLSALKKSGDEEWRKRVSKSIDFDSPVDVKGRAASPVEVKLREKRSLSPVGRPSSIADRLCQIKSSQEGWKGRVEETDAKKFTVAHKIAGQVEDSPLVSKLKRLTKRESDSESGSELTSPSTPSKEWPKIPFPTTLVS--------GPPVVDVAMEIKAEEEEEEDKGPV------KVSVPQQDNLESFFITKSTELIIKNEKVQVEV-DTFDDLFIEAN-DILTTTRKIRPKRKHSARSKNPLKTMSLNLEVKSEYEEVKVGYAEQELKRQKTAQFSKEAGFAQEALAGLASKENFSKVSLRKTAEQATSGTSRLEPYKDLMLLHVKGRRRVQTRLVEPVAMSINSGDCYVLVTPDKALTWIGEYCNVIEKAKAADVASMIVQKKDMGCKGA----TAVGSVEEARQHLGTGKQFWAALGGQ--KEIAPVGPTEEDELYENHIVETNMVYHLKDNTLQPYQEYWGTVPKYEMLKKDQVLIFDYGTEFYIWQGKAVKPDQRKLAVKLARQLWDKGYDYSSCAINPL-CLKLEEEGGLPVKNSVRPSWTLFGKVNQNMETALFKEKFSDWPDSSRLIRC--KSQTDLAGNKVDLVELKPYDAKLMIPVDSKPVSLLLEGSHVGRGVRWFEDMEGFTREQSIITKGVTVWHVLEYDHFKMPDLSFGQFHDGDTYVVRWQYMITQAGMKGLKGNQVRRSQVGRERCAYFFWQGRNSTINEKGASALMTVELDEERGPQIRVDEAKEMPCFLNLFGGKMVIHIGKREEEDSNTQGCWRFYCVRNDSTNEACLVEIQAGMECLRSRSSFILVNVNSGLLYLWHGAKCPEHVRVLIKAAVDNLKAKCPLEVGLHDKAEIYVIELEEGAERDDFLKVMGSDGTDRTMY--HSLLLDRKPHDHTVRLFHMSSVSGVFEVHEIQN---PSRTPDLVCPYPFLQSDLYKASQPALFLVDNHHTVFLWHGWW----PEGDAEVDNVITGSAQARFNV---------DRKCAIDTVLHYCQEKNPDNPPSAYAVHAGLEPTCFTNVFPYWEVDESVNTINLREGKTDGEMVSLHDILEKMTKACYTFVELQERPLPDGVDPLKLEKYLIDEEFEETLGMTKDAFYALPKWQQHQLKKDVDLF 5000          
BLAST of HP domain-containing protein vs. TrEMBL
Match: R7UG55 (HP domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_139004 PE=4 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 3.889e-177
Identity = 324/903 (35.88%), Postives = 501/903 (55.48%), Query Frame = 3
Query: 2190 VKPIRHQKPSSRNPLKKLNERTDIKNEYDE-RLSGVAERELKRYQIQN----IQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL------TTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLV--------PIRGWFVSGITGVLNLTEMLYSLYPDSEHN-VIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVD-SWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++P + +  SSRNPL++L ER D++  Y E + +GVAERE++R + +      QS + F  EALA L  KE+FSK+ LK+ +S K  +   +PYKDLML+ VKGR++ Q RLVEP A SIN GDC++L+T + +F WIG   NVIE  KA E+ + I + +EL      + P +++   N  N     FW+ L  +     + P +  EDE+YE  +  TNMVY++ ++ L P +E+WG PLKH+ML   +  I DFG+ELY+W+G K  +  +  G  L + L+  G++Y  C +NPL    +      P     RP+W + G++ Q  ET LF+EKF DWP+T+RLIK                 DL P+D   ++ ++     ++++   VGRG  W    DG+ R + V T  + +WHI++   + +   + GQF   D Y+IRW Y++      T  GR + +   G    A+FFWQG  +SITEK ASAL T++LD++R  Q+RV Q  E PAF +LFDG M VH GK++     ++   R +I+R E+  E   +EV     +LR R+ F+++N      ++W G  +S Q +  A    + L  K P +     + F + E+++G E + FW  M  ++  +S+Y  +SL+          R +F++ + G+    E+L    P   H+ V+ AFP +QT LY ++QPALFL+      ++W+GWW               + E E N+   S         + AL  ++    L +++  + A +V+AGLEP  F  LFP WEV E+ + IN A   + ++  +V D+L+  L   Y+ E L+ERPLPE V   ++E +L  ++FE++  M++E+F  L  WKQ   KKEVDLF
Sbjct:    3 IRPTKRKAASSRNPLRRLQERQDLQQGYTEVKSTGVAEREVQRLKREGGAALSQSNSKFAREALAGLASKENFSKVTLKKADSFKGVK--YAPYKDLMLLQVKGRRHCQTRLVEPKAESINSGDCFILVTSEKIFTWIGRFCNVIERAKAAEVTAQIHQKRELGCKCPRE-PVLIEEAKNQSNET---FWELLGGEKPYPGSGPSE--EDEIYEDCMNITNMVYKLYDDELDPVEEFWGKPLKHEMLDPKEALILDFGSELYMWAGKKCPLDKRRKGLRLAEDLWKTGYDYTECDVNPL----SAETGKLPEKDDKRPDWTVFGKVTQNMETILFREKFIDWPDTTRLIKF---------------ADLVPVDAKIMVPLNPTPVSLVLEASHVGRGRLWLEDMDGLHRMWEVSTIEMAVWHISEYEHLPMVKESYGQFHEGDTYVIRWRYKVAQTGMKTLKGRESSHATVGRERCAYFFWQGRGSSITEKGASALMTVELDEERGPQVRVTQGKEPPAFLQLFDGCMTVHRGKREDESTNTQGSWRCYIMRNELPFETCLLEVQRSVENLRSRTSFIIMNIKTGMLYVWHGAKSSSQCREQALRISKSLSTKCPEEISREQSTFVVTEMDEGAEKKDFWVAMDALRGDRSAY--HSLLDDPQPQNYSPRLFFMTSVAGIFEAKEVLN---PCRNHDDVVSAFPFMQTELYSASQPALFLVDVGHCAYLWQGWW-------------PEESEQEENVKTGSAEARFNTDRRCALQTTIHYCQLKKSRKPVKAYLVHAGLEPLEFTNLFPQWEVREDVRKINEAEGRERDEITSVEDLLSKLLKTKYTWEELQERPLPEGVDPLKMEQFLQDDEFEEVMCMSREEFAALPTWKQGNIKKEVDLF 860          
BLAST of HP domain-containing protein vs. TrEMBL
Match: V4C5B3 (HP domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_201948 PE=4 SV=1)

HSP 1 Score: 555.829 bits (1431), Expect = 4.370e-173
Identity = 307/878 (34.97%), Postives = 495/878 (56.38%), Query Frame = 3
Query: 2256 DIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKL--FERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTT------HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYN-EFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLV--------PIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL-TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++++EY E  +G+AE+ELKR + + I    GF EEALA L  KE+FSK+ L++T++      +  + P+KD ML+ VKGR+NVQ RLV PT+ SIN GDCY+L+T   +  W+G  +NVIE  KA ++ S+I   +++     +   TI   ++  +      FW  L     Q     G   EDE+YE +I  TNMVY++V+N L+PY EYWG+ LK+ ML  +   +FDFG+ELYLW G K   + +  GR L + L+ +G++Y SC INPL PL N      P   +TRP+W + G++ Q  ET LFKEKF DWP+++R+IK+        ++ + +E  LQ  D+  ++  +     ++++G +VGRG KW     G +++  +IT  + +WH+ +     +P T  GQF   D Y++RW Y ++        G+  RN  TG    A+FFWQG  ++I EK ASAL T++LD++R  Q+RV Q  E P F  LF+GSM+VHIGK++  +  ++   RL+ +R E E+E   +E+     +LR RS F+L+N      ++W+G  +   ++  A     +L    P++  ++ +    + E+E+G+E   FW   G ++  +    + SL+         +R ++++ ++G+  + E L     D  +     FP LQ+ LYK +QPALFL+ +   +++W+GWW               ++EG +   +     +R   ++   L++  ++    + ++    IV AG+EP  F  +FPYWEV+E A+ +N+         ++  ++L+      YS E L+ERPLPE V +S++ESYL  E FE++  M+KE FY+L  WKQ + K+   LF
Sbjct:    7 EVRSEYTEVTTGLAEKELKRLKTEKISKDVGFAEEALAGLASKENFSKVALRKTDATSTPGSKDRLDPFKDNMLLHVKGRRNVQTRLVAPTSLSINSGDCYVLITPDKIINWVGTFSNVIEKAKAADITSFIHTKRDMGCRSGTSVATI--EEEKQRLGAGKHFWATL--GGQQDYQAVGPEEEDEIYETLINKTNMVYKLVDNSLLPYQEYWGAILKYDMLHPELTLVFDFGSELYLWLGKKVSPEERKVGRILSQQLWEKGYDYSSCDINPLCPLHNTG--GVPIKSTTRPDWALFGKVHQGMETILFKEKFFDWPDSARIIKVKGQDADTEKKVELVE--LQAYDVSKMVPANTSPVTLVLEGSNVGRGTKWLEDMQGFIKQTDIITCGVNVWHVMEYDHYKLPETCYGQFHEGDTYVVRWQYMVSNAGLKSLKGQAARNTLTGRERCAYFFWQGSESTINEKGASALMTVELDEERGPQVRVIQGKEPPCFLNLFNGSMMVHIGKREEEESNTQGPWRLYCVRNEHENELMLLEINLCIDNLRSRSSFVLLNVKTGHLYIWNGCKSPQHTRQQARRAADKLKIHCPLEVGLHTDASIMISEMEEGEEKSQFW---GAVES-RDRTRYMSLLDSGRSLEHSVRLFYMTSVSGIFEVAERLNPCRTDEFYT---PFPFLQSDLYKVSQPALFLVDNHYEVYLWQGWW-----------PEGNEEEGNV---HTGSAHSRFNIDRKCALQTTINYCKGFRSRMPNMYIVCAGVEPQQFTNIFPYWEVDETAKELNMRDGKHEGYLESAEEMLSKLSRTQYSLEELQERPLPEGVDASKLESYLDDETFENILHMSKEDFYKLPSWKQRQLKQPTGLF 855          
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 521.161 bits (1341), Expect = 1.080e-154
Identity = 318/931 (34.16%), Postives = 485/931 (52.09%), Query Frame = 3
Query: 2118 VPTNDDFDEIFLQSDLNLN----LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSL-------------YPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL--TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            V  +DDFD IF      L      +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   +GF   ALA L  KE+FS + L+    + +       PYK  ML+ VKGR++VQ RLVEP +SS+N GDC+LL+T  + F+W+GE ANVIE  KA EL ++I    +L    S  +   ++   N  +  A +FWK L           G   EDE YE  I  TN VYR+ E++L+P D+YWG   +  ML   +V + DFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ +  K    +Q   E++    G+ +P D   +L +S      I+DG  VGRG      EDG  R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G    ++FFWQG +++++EK  SAL T++LD++R  Q++V Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +EV+    SLR R+  +L+N      ++W G  A   ++        ++  + P++  + N ++  ++E ++G EP  FW+ +G  K+ + +Y  + ++   G F        N T  LY L              P  E  ++ + P  Q  LY + QPALFL+ +   +++W+GWW  D            ++ G          R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V DVL      TY    L+ RPLPE V   R+E YL+ EDFE   +MT+  +  L  WKQ   KK   LF
Sbjct:  939 VEISDDFDAIFGTQMPKLTSEMVQHKRAVRPARNVQ-SSRNPLKLLASREDIRHEYTEQRLNIGMLESKRIKQEKMSKNSGFSAVALAGLASKENFSSVSLRSVNITEQSSHSSAMPYKSTMLMQVKGRRHVQTRLVEPRSSSLNSGDCFLLVTPHHCFIWVGEFANVIEKAKAAELATFIQTKHDLGCRASYVQ--TIEEGCNTHSHAAKEFWKILGGQAS--YQAAGTPEEDEFYETAIVETNCVYRLQEDKLVPDDDYWGRVPRCSMLNPTEVLVLDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTTCDINPLD--PGECNSLIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWTDSKKAAKKNGNTQEVEEKDGQ-SGECRPYDASLMLPLSQAPVRTILDGVDVGRGYGMVDGEDG--RGFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMVSTAVGKRFHSERVVGPGKEKCSYFFWQGRNSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFNGGMIVHAGKREEEEDNAQNDWRLYCVRGEKPIEGHLLEVLCHCSSLRSRTSMILLNIPKASMYLWHGCKAQMHTRDVGRTAANKIKEQCPLEAGLHNSSKVTIQECDEGTEPVGFWEALG--KRDRKAY--DCMIHDLGKF--------NFTPRLYQLSSASGEFTAVEFNCPFREPKLVNSMPFHQEDLYTAAQPALFLVDNHHEVYLWQGWWPQDS-----------ENTGSA--------RIRWDSDRKCAMETVLHYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDIAEITEKEAEVCNQIILVEDVLARLCKATYPLADLQARPLPEGVDPLRLEIYLSDEDFEKALEMTRSDYEALPGWKQVNVKKAKGLF 1828          
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 520.005 bits (1338), Expect = 5.756e-153
Identity = 318/931 (34.16%), Postives = 485/931 (52.09%), Query Frame = 3
Query: 2118 VPTNDDFDEIFLQSDLNLN----LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSL-------------YPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            V  +DDFD IF      L      +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   +GF   ALA L  KE+FS + L+    + +       PYK  ML+ VKGR++VQ RLVEP +SS+N GDC+LL+T  + F+W+GE ANVIE  KA EL ++I    +L    S  +   ++   N  +  A +FWK L           G   EDE YE  I  TN VYR+ E++L+P D+YWG   +  ML   +V + DFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ +  K    +Q   E++    G+ +P D   +L +S      I+DG  VGRG      EDG  R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G    ++FFWQG +++++EK  SAL T++LD++R  Q++V Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +EV+    SLR R+  +L+N      ++W G  A   ++        ++  + P++  + N ++  ++E ++G EP  FW+ +G  K+ + +Y  + ++   G F        N T  LY L              P  E  ++ + P  Q  LY + QPALFL+ +   +++W+GWW  D            ++ G          R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V DVL      TY    L+ RPLPE V   R+E YL+ EDFE   +MT+  +  L  WKQ   KK   LF
Sbjct: 1231 VEISDDFDAIFGTQMPKLTSEMVQHKRAVRPARNVQ-SSRNPLKLLASREDIRHEYTEQRLNIGMLESKRIKQEKMSKNSGFSAVALAGLASKENFSSVSLRSVNITEQSSHSSAMPYKSTMLMQVKGRRHVQTRLVEPRSSSLNSGDCFLLVTPHHCFIWVGEFANVIEKAKAAELATFIQTKHDLGCRASYVQ--TIEEGCNTHSHAAKEFWKILGGQAS--YQAAGTPEEDEFYETAIVETNCVYRLQEDKLVPDDDYWGRVPRCSMLNPTEVLVLDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTTCDINPLD--PGECNSLIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWTDSKKAAKKNGNTQEVEEKDG-QSGECRPYDASLMLPLSQAPVRTILDGVDVGRGYGMVDGEDG--RGFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMVSTAVGKRFHSERVVGPGKEKCSYFFWQGRNSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFNGGMIVHAGKREEEEDNAQNDWRLYCVRGEKPIEGHLLEVLCHCSSLRSRTSMILLNIPKASMYLWHGCKAQMHTRDVGRTAANKIKEQCPLEAGLHNSSKVTIQECDEGTEPVGFWEALG--KRDRKAY--DCMIHDLGKF--------NFTPRLYQLSSASGEFTAVEFNCPFREPKLVNSMPFHQEDLYTAAQPALFLVDNHHEVYLWQGWWPQDS-----------ENTGSA--------RIRWDSDRKCAMETVLHYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDIAEITEKEAEVCNQIILVEDVLARLCKATYPLADLQARPLPEGVDPLRLEIYLSDEDFEKALEMTRSDYEALPGWKQVNVKKAKGLF 2120          
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 520.005 bits (1338), Expect = 6.873e-153
Identity = 318/931 (34.16%), Postives = 485/931 (52.09%), Query Frame = 3
Query: 2118 VPTNDDFDEIFLQSDLNLN----LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSL-------------YPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDK--LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            V  +DDFD IF      L      +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   +GF   ALA L  KE+FS + L+    + +       PYK  ML+ VKGR++VQ RLVEP +SS+N GDC+LL+T  + F+W+GE ANVIE  KA EL ++I    +L    S  +   ++   N  +  A +FWK L           G   EDE YE  I  TN VYR+ E++L+P D+YWG   +  ML   +V + DFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ +  K    +Q   E++    G+ +P D   +L +S      I+DG  VGRG      EDG  R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G    ++FFWQG +++++EK  SAL T++LD++R  Q++V Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +EV+    SLR R+  +L+N      ++W G  A   ++        ++  + P++  + N ++  ++E ++G EP  FW+ +G  K+ + +Y  + ++   G F        N T  LY L              P  E  ++ + P  Q  LY + QPALFL+ +   +++W+GWW  D            ++ G          R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V DVL      TY    L+ RPLPE V   R+E YL+ EDFE   +MT+  +  L  WKQ   KK   LF
Sbjct: 1263 VEISDDFDAIFGTQMPKLTSEMVQHKRAVRPARNVQ-SSRNPLKLLASREDIRHEYTEQRLNIGMLESKRIKQEKMSKNSGFSAVALAGLASKENFSSVSLRSVNITEQSSHSSAMPYKSTMLMQVKGRRHVQTRLVEPRSSSLNSGDCFLLVTPHHCFIWVGEFANVIEKAKAAELATFIQTKHDLGCRASYVQ--TIEEGCNTHSHAAKEFWKILGGQAS--YQAAGTPEEDEFYETAIVETNCVYRLQEDKLVPDDDYWGRVPRCSMLNPTEVLVLDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTTCDINPLD--PGECNSLIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWTDSKKAAKKNGNTQEVEEKDG-QSGECRPYDASLMLPLSQAPVRTILDGVDVGRGYGMVDGEDG--RGFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMVSTAVGKRFHSERVVGPGKEKCSYFFWQGRNSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFNGGMIVHAGKREEEEDNAQNDWRLYCVRGEKPIEGHLLEVLCHCSSLRSRTSMILLNIPKASMYLWHGCKAQMHTRDVGRTAANKIKEQCPLEAGLHNSSKVTIQECDEGTEPVGFWEALG--KRDRKAY--DCMIHDLGKF--------NFTPRLYQLSSASGEFTAVEFNCPFREPKLVNSMPFHQEDLYTAAQPALFLVDNHHEVYLWQGWWPQDS-----------ENTGSA--------RIRWDSDRKCAMETVLHYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDIAEITEKEAEVCNQIILVEDVLARLCKATYPLADLQARPLPEGVDPLRLEIYLSDEDFEKALEMTRSDYEALPGWKQVNVKKAKGLF 2152          
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Match: svila (supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5])

HSP 1 Score: 519.62 bits (1337), Expect = 8.987e-153
Identity = 318/931 (34.16%), Postives = 485/931 (52.09%), Query Frame = 3
Query: 2118 VPTNDDFDEIFLQSDLNLN----LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRYTRNNRT---GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSL-------------YPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLT--ASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            V  +DDFD IF      L      +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   +GF   ALA L  KE+FS + L+    + +       PYK  ML+ VKGR++VQ RLVEP +SS+N GDC+LL+T  + F+W+GE ANVIE  KA EL ++I    +L    S  +   ++   N  +  A +FWK L           G   EDE YE  I  TN VYR+ E++L+P D+YWG   +  ML   +V + DFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ +  K    +Q   E++    G+ +P D   +L +S      I+DG  VGRG      EDG  R F + T ++++WHI +     +P  + GQF   D Y+++W Y ++T  G+   + R    G    ++FFWQG +++++EK  SAL T++LD++R  Q++V Q  E P F + F+G M+VH GK++  +  +++  RL+ +RGE   E H +EV+    SLR R+  +L+N      ++W G  A   ++        ++  + P++  + N ++  ++E ++G EP  FW+ +G  K+ + +Y  + ++   G F        N T  LY L              P  E  ++ + P  Q  LY + QPALFL+ +   +++W+GWW  D            ++ G          R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V DVL      TY    L+ RPLPE V   R+E YL+ EDFE   +MT+  +  L  WKQ   KK   LF
Sbjct: 1256 VEISDDFDAIFGTQMPKLTSEMVQHKRAVRPARNVQ-SSRNPLKLLASREDIRHEYTEQRLNIGMLESKRIKQEKMSKNSGFSAVALAGLASKENFSSVSLRSVNITEQSSHSSAMPYKSTMLMQVKGRRHVQTRLVEPRSSSLNSGDCFLLVTPHHCFIWVGEFANVIEKAKAAELATFIQTKHDLGCRASYVQ--TIEEGCNTHSHAAKEFWKILGGQAS--YQAAGTPEEDEFYETAIVETNCVYRLQEDKLVPDDDYWGRVPRCSMLNPTEVLVLDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTTCDINPLD--PGECNSLIPRKGQGRPDWAVFGRLTQHNETTLFKEKFLDWTDSKKAAKKNGNTQEVEEKDG-QSGECRPYDASLMLPLSQAPVRTILDGVDVGRGYGMVDGEDG--RGFEISTLSVDVWHILEFDYSRLPKQSIGQFHEGDTYVVKWKYMVSTAVGKRFHSERVVGPGKEKCSYFFWQGRNSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFNGGMIVHAGKREEEEDNAQNDWRLYCVRGEKPIEGHLLEVLCHCSSLRSRTSMILLNIPKASMYLWHGCKAQMHTRDVGRTAANKIKEQCPLEAGLHNSSKVTIQECDEGTEPVGFWEALG--KRDRKAY--DCMIHDLGKF--------NFTPRLYQLSSASGEFTAVEFNCPFREPKLVNSMPFHQEDLYTAAQPALFLVDNHHEVYLWQGWWPQDS-----------ENTGSA--------RIRWDSDRKCAMETVLHYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDIAEITEKEAEVCNQIILVEDVLARLCKATYPLADLQARPLPEGVDPLRLEIYLSDEDFEKALEMTRSDYEALPGWKQVNVKKAKGLF 2145          
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Match: svild (supervillin-like [Source:NCBI gene;Acc:103046197])

HSP 1 Score: 491.115 bits (1263), Expect = 5.648e-147
Identity = 300/910 (32.97%), Postives = 460/910 (50.55%), Query Frame = 3
Query: 2178 NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFER-FVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPI--------EGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTT-HGRYTRNNRT-----GNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYN-EFKLEEIEQGKEPRTFWQDMG--------IIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDK-LTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++R V+P R+ K  SRNPL+ L  R D++  Y E+   +A  E KR Q++ +   +   + ALA L  KE+F K+ L+  +S ++       P+  LMLI +KGR++VQVRLVEPTASS+N GDC+LL+T ++ F+W GE ANVIE  K +E+  ++   ++L     + + T+++   N  N  A +FW  L   T       G+  EDELYE  I  +N VYR+VE++L+PY+E W S     ML   +  + DFG+E+Y+W+G    +  +     L K+L+S  ++Y +C +NPLDP  +N +   P  G  RP W + GRL++  ET LF+EKF DW E     K +   Q N E   P+        + +L+P D+  +L+       + + G  V RG      EDG  R+  + T  ++ WHI +     +P  + GQ    D Y+IRW Y +T+  G+  +         G    A FFWQG  +S++ +  SAL T++L      Q+ V Q  E P F +LF G +V+H G ++  A      RLF +RGE   E   +EV   S SLR R+  +L+     + ++W G  + P ++  A    ++L    P +  +N N   K++EIE+G EP+ FW  +G         + +    Y+F      R + +S   G     E    L P    N + A P LQ  LY + QPALFL+ +   +++W+G    D   + G      D+E                  K A+  ++    ++N  +   A ++ AG EP +F  +FPYWE +   +   +     L     V D L+      YS E L  +PLPE V    +E YL+ +DF+DL +MT+E+F  L  WKQ   KK   LF
Sbjct:  547 HRRAVRPSRNTK-GSRNPLRALATRDDLRQAYTEQRLNIATVEAKRMQVERMAKHSRLADCALAGLASKENFRKVSLRSIKSTEVVTNNSAVPFHKLMLIQIKGRRHVQVRLVEPTASSLNSGDCFLLITPKHCFLWCGEFANVIEKAKGSEMAQYVQAKRDLGCK--APQVTVLEEGINTDNRFAKEFWNLLGGQTE--YRAAGEPEEDELYESAIVESNGVYRLVEDKLVPYEEVWASIPSVTMLNSKEALVLDFGSEVYVWTGKDVALSDRKVVMQLGKLLWSGAYDYTTCRVNPLDPFSSNKD--IPMQGEGRPGWALFGRLSEHNETALFREKFLDWAER----KPLKEEQVNEEMKSPVHQPCSPTHDSELKPCDVRALLDGGETPLKMNLGGVDVQRGYGLVRSEDG--RQAELATVAVDAWHIREFDDFEIPRESVGQLHEGDTYVIRWKYSITSVVGKRQKPGEVSASGPGRERIACFFWQGRHSSVSGRGTSALMTVELGNHEGAQVLVTQGKEPPCFLQLFQGGLVIHSGCREDAATNTGGWRLFCVRGEAAVEGSLLEVECCSASLRSRACLILLGVCERQLYLWHGCKSHPAAREVAKKTVERLTQTCPPELGLNNNSSLKVQEIEEGSEPQAFWDALGQQDRKTYDCMLQDPGKYNFTP----RLYRLSASAGTFKGEEQ---LSPCRVANAVMAMPFLQENLYAAPQPALFLLDNRMEVYLWQGQQPEDAECT-GSAKIRWDNE-----------------RKCAMETALQYCKAKNSRRPPQAYLILAGAEPLTFTNIFPYWEKDPSIRVQGMRNKVIL-----VEDALSKLSKNQYSIEELTSKPLPEGVDPLHLELYLSDKDFQDLLQMTREEFCTLPNWKQLNLKKSKGLF 1413          
BLAST of HP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003626.1 (pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 gene:ENSPMAG00000003299.1 transcript:ENSPMAT00000003626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 439.499 bits (1129), Expect = 1.840e-132
Identity = 313/924 (33.87%), Postives = 466/924 (50.43%), Query Frame = 3
Query: 2169 LNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVK---GRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYD-TVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPI--------------DIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELT------THGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIG-KQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRG--------WFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQP-ALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS-IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            ++ ++R V+P R +  +SRNP+K L +R DIK EY E+   VA  E  R + Q +   +   + ALA L  KEDFS + L+    ++        PYK +ML+ VK   GR++VQ RLVEP A S+N GDC+LLLT Q+ ++WIGE ANVIE  KA++L ++I   ++L    SS   TI++   N  ++ A  FW  L    + +   PP    EDELYE  +  TN  +R+   RL+P DE WG   +  ML    V +FDFG+E+Y+W G +  +  +     L K L+   ++Y++C INPL           P  G  RP W I GRL Q  ET LFKEKF DW +  +      P +  +E N      +QP+               I     ++  +   +++G  VGRG      ED   R F + T  +E WH+ ++    V  T+ GQ    DAYI++W Y L             R+   G    A+FFWQG +  +++K ASAL TI+LD ++  Q+ V+Q  E P F +LF G M+VH G +++L      +RLF +RGE+  EA  +EVV    +LR R+  LL+    +   +W G    P S+  A +  ++L    P +  I       LEE E+G EP +FW  +G   +     ++ SL+  +G        +  S  +G L L E   ++   S      A P LQ  LY   QP ALF++ +    ++W+GWW +DR           +  G   + + +   +R A+ + ALL   +   S  K K TA+ +VYAGLEP SF  LFP WE + +  + +        +   + D L      TYS  +L  RPLP  V   ++E YL+  DF+ +  M++E+++ +  WKQ   KKEV LF
Sbjct:  167 MSEHRRSVRPAR-RTTASRNPIKALAQRNDIKTEYTEQRLNVATIEANRLRAQKLAKHSRLADAALAGLASKEDFSSVNLRSVATASPSSNNSALPYKPVMLLQVKACEGRRHVQTRLVEPRAISLNSGDCFLLLTHQHCYLWIGEFANVIEKAKASDLATYIQTKRDLGCRASSI--TIIEEGINCSSNRARSFWDLLGGRVSYKGTGPP---EEDELYENDVVATNCAFRLQGERLVPDDECWGKVPRCTMLNPCDVVVFDFGSEVYVWHGKEVTLAQRKVAFQLAKQLWVGPYDYNTCRINPL-------GSDIPRMGEGRPEWSIFGRLTQHNETVLFKEKFLDWADVMK-----PPKKNGDELNHHF---IQPLTVHLSTDALAFTSSSISYFPCITPQAGGTVLEGVDVGRGHGTVKGEDA--RAFELSTVAVEAWHVAEHGYSSVAATSRGQLHMGDAYIVKWKYMLCPAVSKRKKSEAVRSVTAGRERCAYFFWQGRNAGVSDKGASALMTIELDTEKGPQVPVQQGKEPPCFVQLFQGGMIVHRGRREELDNSQGMTRLFCVRGELVEEALLLEVVCGPAALRSRASLLLLEPLRHVLTVWHGCCCPPSSRRVARHTAKRLRDVCPPEMNIPGTTTLSLEECEEGAEPSSFWNALGGHDR----MAYQSLLQDKGREGDSLKLYRTSSASGELVLVECTSNV---SVPGAPSAMPFLQDDLYGVEQPEALFVLQTSREAYVWQGWWPVDR-----------ESTGSSRMRWDT---DRRAAMEAALLLHKE---SSGKVKGTAAYLVYAGLEPPSFTNLFPCWESHPDVAASSQQNTEVREKCTLLEDALAQLSQTTYSLAQLTTRPLPPGVDPLKLERYLSDVDFQSVLNMSREEYHSIPLWKQATLKKEVGLF 1043          
BLAST of HP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002059.1 (pep scaffold:Pmarinus_7.0:GL477505:32441:37656:-1 gene:ENSPMAG00000001866.1 transcript:ENSPMAT00000002059.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.696e-40
Identity = 85/249 (34.14%), Postives = 122/249 (49.00%), Query Frame = 3
Query: 2787 GDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYEL 3533
            G   EDELYE +I  TN +YR+V ++LIP D  WG     ++L    V +FDFG+E+Y+W G +     +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W I GRL Q  ET LFK+KF DW +    +    P +  +        +L P DI  +L     S       ++   G        G +    + T  +++WHI D     VP ++ GQF   D Y+++W Y L
Sbjct:   10 GGTEEDELYEGVIAETNCIYRMVHDKLIPEDGAWGRVPTQELLEPSDVLVFDFGSEVYVWCGREVPSAARAVAFQLAKQLWNGTFDYTNCDINPLD--PGECNSLIPRKGRGRPDWAIFGRLIQHSETILFKQKFLDWFDA---VPSGGPPRDPDRYGDTQPPELHPCDIRLMLIEPSESQDPAGAAEAPLEGLGPGRGARGAMGGRDIATAGVDVWHILDCDYSRVPQSSVGQFHEGDTYVLKWRYVL 253          
BLAST of HP domain-containing protein vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 73.1738 bits (178), Expect = 4.256e-13
Identity = 89/418 (21.29%), Postives = 149/418 (35.65%), Query Frame = 3
Query: 2877 DEYWGSPLKHKMLVDDQVFIFD-FGTELYLWSGFKADMKTKNNG-RNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKD---RVTQIRVKQNHESPAFCRLFDGSMVVH-----------IGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMG 4082
            +E    PL   +L  D  +I D  G ++Y+W G  +  + +    +  L  + ++G+           P+  N                 V  +A   E+ +FK+ F  W E  +                  +G  +   +G I  +        +         + ++++DG        +   EM+ I D     V     GQF+  D Y++ + Y        T NN+   LL   + WQG   +  E  ASA   + LD+       Q+RV    E   F  +F G ++++            G       P  +RLF +RG  E     VEV   + +L    VF+L NA     F+W G   S   +  A      L  +              + + +G+EP  FW  +G
Sbjct:  266 EEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGY-----------PVSTN-----------------VETVADGAESAIFKQLFQHWTERGQ-----------------TQGMGKTYTVGKIARVEQVKFDPTVLHAKPEVAAQHRMVDDG--------SGTAEMFRIEDLELKPVEKRLHGQFYGGDCYLVLYTY--------TSNNKLAYLL---YMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVL-NAE-VACFLWCGKGCSGDEREMARSLADGLTRRDK------------QTVLEGQEPPEFWAALG 605          
BLAST of HP domain-containing protein vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 49.2914 bits (116), Expect = 3.206e-6
Identity = 30/105 (28.57%), Postives = 47/105 (44.76%), Query Frame = 3
Query: 3423 NIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDK---DRVTQIRVKQNHESPAFCRLF 3728
             +++W +     V VP    G F++ DAY++           ++  NR GN+     FW G   S  E  A+A++T+ +D     +  Q R  Q  ES AF   F
Sbjct:   15 GLQVWRVEKLDLVAVPKELYGSFYTGDAYVLL----------FSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYF 109          
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Match: EDO45796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP5])

HSP 1 Score: 409.838 bits (1052), Expect = 5.129e-123
Identity = 296/921 (32.14%), Postives = 461/921 (50.05%), Query Frame = 3
Query: 2178 NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYD--------ERLSGVAERELKRYQIQNIQSKAG--FVEEALAALTVKEDFSKIKLKRT---ESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVV---ENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTH----GSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKP-IEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRG-GKWKVIEDGILREFSVI-TKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYT------RNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAK--KPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRI-NYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSY---SFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTAS--IVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            +K  +KP R    S  NP+K L ERTD++ E +        E+ +  +E  + R + +  +      F   ALA L   EDF+KI L++T   E  K  + +    K LML+ +KGR+N+Q RL+EP   S N GDCY+L+TK  +F W+G+ AN IE  K  E+ S I   +EL+           KS D D    A +FWK L+ D    I     +  DE YE+ +  TNM+Y+V       L+P + + G   +  +L   +V +FDFG+ELY+W+G ++    +     L K L+   F        P DP+       + T       TRP W ++ RL +K ET LF+EKF DWP+ +++IK+     ++ E  KP I  +L+P D   + +   P    +++G +VGRG G   V      +E ++  T  + +WHI +     +P  N G F S + Y+IRW Y + T    T      R+   G + +A+FFWQG   ++ EK A+A+  ++LD++R  QIRV Q  E P F  LF G M+VH GK         S  RL+++R +   E   V+V     SLR R  F+L+     + F+W G  A   +K  A    + + AKKP++  + N     L+E+++G+EP  F + +G  K + S     S +   P R + +S  TG     E+   L P      +  FP LQ  +Y + QP LFL+ +   + IWEGW   D      D DS +   G          + R  +++   +++   +  +   +++    +VYAGLEP SF+  FP+W       SI      +   ++ VT++L  +   +Y+   L+E+P P+ V  +++E+YL+  DF+++FKM KE F +L  WKQ   KK V LF
Sbjct:   14 DKLHLKPKRRHA-SKANPVKNLRERTDVRTETEVTKTSPRVEKKAVTSEHPVIRRKKKKYKDPDNLYFAASALAGLASTEDFTKISLRKTGGPEKAKELDSYRGT-KPLMLLHIKGRRNIQTRLIEPCQKSFNSGDCYVLVTKDELFAWVGKHANAIERAKVTEIASRIFTKRELDCKARDIVFVEEKSQDEDNLRGAKKFWKLLNGDPEAEIKEASSLPTDEDYEKGVTRTNMIYKVHWTDPPSLVPVETHCGRLPQISLLDTKEVLVFDFGSELYVWNGQQSLSGQRKTVFALGKQLYESSFKGH----GPYDPIYPYGKGREVTQDNKTADTRPAWTLLARLHEKAETILFREKFLDWPDPTKIIKMKG-HPSSGEVIKPLIVVELKPCDPKALASTPEPFKGQVLEGVNVGRGIGVPTVWTGDFYKEGNLCNTVGVTVWHINEYRHYELPNENHGHFHSGEGYVIRWAYFVMTDRIATDRKSRCRSTVAGRVRTAYFFWQGNDCTVNEKGAAAVMAVELDEERGPQIRVTQGKEPPCFLNLFKGGMIVHSGKYSDVSDNHTSTVRLYVVRNDEPGEGCLVQVRLSGLSLRSRGCFVLLMCRDGKVFVWYGAKALDDTKKNALVAAKNIQAKKPMECNVENTTVITLQEVQEGEEPEEFLKALGGKKYYCSLLNDPSPHQFTP-RLYELSSATGKFMANEV---LCPSRLEGKVCQFPFLQDDMYSAKQPGLFLLDNHYEVCIWEGWIPED------DIDS-LTGSG----------KQRWDNDRKLAMETALKYAEEVGKRVSHRVFVVYAGLEPMSFKAAFPHWTDRASVISIQKQSGKQPGAKEPVTELLQTFTKDSYTLSELQEQPPPQGVDPAKLETYLSNSDFQEVFKMGKEDFTKLPGWKQQNLKKAVKLF 906          
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Match: EDO29784 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N1])

HSP 1 Score: 158.688 bits (400), Expect = 8.210e-40
Identity = 127/519 (24.47%), Postives = 213/519 (41.04%), Query Frame = 3
Query: 2925 QVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNY-----------------------------------------DSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPE------TSRLIKIISPSQT----NNERNKPIE-GDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTT------HGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSR---LFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLV--------PIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPA 4274
            + ++ DFGTE+YLW G       +  G  L + +F + F +                                             INP+DP     +  +      RP W ++GR+  + ET LF+EKF DWP+         + K +S S T    N + ++P    DL+  D+  +L  S P   ++++G  VGRG    V E+G    F V T +++ WH+ + +   +P  + G F S + Y++RW Y +         G+ +R    G    A+FFWQG  +++ EK A+AL T+++D ++  Q+ V Q  E P F RLF+G MVVH+GK+   +         +FI+R E  +E++ ++V                                          F +   + P++         L+E ++G E   FW  +      +   S  SL+         +R +  +   G     E+   L P      +  +P+LQ+ LY + QP 
Sbjct:  179 RAYVLDFGTEVYLWLGRNCTRAARLKGMPLAQKVFDEKFKFKPSQLITNRSFYQRGSLKYGISYSVYKSLLRNFVQPFLIFSSKSKINPIDPKCAAKDLEE--REVKRPPWALLGRMTARSETVLFREKFIDWPDHNIDYSKDFVKKPLSGSFTQLASNKKGDRPASIFDLKSYDVRLMLE-SPPEPCLVLEGFDVGRG-TGSVNEEGW--RFQVDTIDVKTWHVKEYSYTPLPDEDRGHFHSAEGYVVRWKYCVKRVGVRNLKGKASRQEDVGRDKVAYFFWQGHDSTVNEKGAAALMTVEIDSEKGPQVLVSQGKEPPCFPRLFNGRMVVHLGKRDPPEDEEDEEDTCIFIVRNEDPAESYLLQVKTR---------------------------------------FNEKFPEDPLE---------LKEFDEGDETELFWDAL------RGDRSHESLINDSRKHEYTLRAFRFTSSMGQFEAHEV---LCPSRSSTYVTPYPILQSQLYSAQQPG 634          

HSP 2 Score: 87.4261 bits (215), Expect = 2.903e-17
Identity = 56/170 (32.94%), Postives = 94/170 (55.29%), Query Frame = 3
Query: 2178 NKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAG--------FVEEALAALTVKEDFSKIK--LKRTESN--------KLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANEL 2633
            ++R ++P R   P+S NPLK    R D++ E D    G  E++L +  I +  ++ G           EA+ AL+ KE+ +K    L++T  N        K F  F+     +ML+ +KG +++Q RLVEP+  S+N GD ++L+T ++V+VWIG  AN+++  +A  L
Sbjct:   20 HRRKLRPARKHAPTS-NPLKARQNREDLRTETDTEHDGQDEQKLYKRCIGSC-ARIGPGSDTDPILASEAIQALSAKENLAKASAMLRKTAKNTEGISTEIKEFGGFLP----VMLMQIKGYRHLQTRLVEPSVKSLNSGDAFVLVTPKSVYVWIGRSANIMKKARAYVL 183          
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Match: EDO43614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY13])

HSP 1 Score: 112.079 bits (279), Expect = 9.616e-25
Identity = 119/494 (24.09%), Postives = 201/494 (40.69%), Query Frame = 3
Query: 3417 TKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDR----VTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVN-ESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPI------RGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLS---LPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNE-EAQSINLARHYKLNQEDN-------VTDVLNNYLTM-TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            +K +  + +TD   V       G FFS D+Y++ + Y         R  R G   S  +FW+G  + + EK A+A  T+DLD +       Q+ V +  E P F R+F G ++V+ G  +   +    RLF +RG+ E+EA  VEV   ++  L     F+LIN +     +W G  ++      A     +++  +  D   NY+ F     E+G+E   FW+ +G     K  Y+ N L+        R +      G L + E++                  Q  L   +   +  +    H+++W G              S +D+  E    Y++    PRN  +                       + + AG E   F+  F  WE +   A+ +++    +L +E N       + DV         Y+  ++    LPE+V  +  E YL   +F++LF M+K  F  L  WK+ E +K+  LF
Sbjct:  474 SKEVGFYRVTDGGKVQCNTAAKGIFFSGDSYLVVYTY---------RTQR-GQKKSIIYFWKGNDSRVFEKGAAAKLTVDLDNNNFGGDAVQVEVNEGKEPPHFLRIFGGHLIVYQGDYENPDEFKHKRLFQVRGKRENEARVVEVAGVDASYLNSNDTFVLINNSST--IIWKGKGSTGDEVEAAKEA-AKIINPQGGD---NYDLF-----EEGREATKFWEILG----GKKPYANNILLQSSEAPEPRLFHCYNKRGSLEVEEIV---------------NFGQDDLVDDD---VMFVDLGDHIYMWVGEEA---------KKSEVDETQEFIKEYIASDPTPRNERS--------------------FVITRLRAGAETDDFKAFFGVWEDHRTAAKGMSIEEMKELQEEVNKQIDLSQLEDVGGEITKFYPYTELKVNVENLPEDVDPALREEYLEDHEFKELFGMSKGDFRSLREWKRRELRKDKGLF 895          
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Match: EDO38658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC4])

HSP 1 Score: 80.4925 bits (197), Expect = 2.719e-15
Identity = 74/293 (25.26%), Postives = 116/293 (39.59%), Query Frame = 3
Query: 2880 EYWGSPLKHKMLVDDQVFIFDFGTE-LYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDR---VTQIRVKQNHESPAFCRLFDGSMVV 3746
            E    PLK   L  +  FI D G+  +++W G                           CT N       N  +     G   PNW  V R+ + GET +FK+ FS W +    + +         ++K  +      D  ++ +   P               K  + +DG     S + K   +W + D+  V+VP    G FFS D Y+I + Y++        N R   ++   +FWQG+ +S  EK ASA+    +DK      TQ+RV Q  E   F R+F G +++
Sbjct:  263 EIEAKPLKKSNLDTNDCFILDCGSSGVFVWVG-------------------------KGCTKNEKSAAMKNGIDFIEKKGY--PNWTQVTRVVEGGETPIFKQFFSGWTDADSQVGLGRAF-----KSKIAKQSYDKFDATSLHDRKKPEXK------------KQILADDG-----SGVAK---IWRVEDHDLVLVPLELHGLFFSGDCYVIMYTYKV--------NMRESVII---YFWQGVQSSTDEKAASAMLADQIDKKMGGIATQVRVVQYKEPEHFLRIFRGRLII 492          
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Match: EDO49236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV1])

HSP 1 Score: 48.521 bits (114), Expect = 4.952e-6
Identity = 37/137 (27.01%), Postives = 54/137 (39.42%), Query Frame = 3
Query: 3423 NIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLD---KDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQ----QLAKKPSKSRLFIIRGE 3812
             +++W I        P    GQF++ D+YII W YE               L     FW G  ++  E   +A  T++LD    D   Q R   NHES  F   F     +  G +    Q+  K  K R+  + G+
Sbjct:   49 GLQIWRINKFKVEEWPKEKYGQFYAGDSYIILWTYE---------EKEDTELCYDLHFWIGRGSTQDEYGTAAYKTVELDTYLNDVPVQHREIMNHESDMFKTYFKSITYLKGGAETGFNQVKPKEYKPRILKVSGD 176          
BLAST of HP domain-containing protein vs. Ensembl Medaka
Match: svila (supervillin [Source:NCBI gene;Acc:101158061])

HSP 1 Score: 516.153 bits (1328), Expect = 1.061e-152
Identity = 313/912 (34.32%), Postives = 482/912 (52.85%), Query Frame = 3
Query: 2169 LNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR-TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAV-QFWKCL-HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSH-PSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRN------NRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS----RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWF------VSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL--TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            +  +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   + F E ALA L  KE+FS + L+  +ES +       PYK LML+ VKGR++VQ RLVEP ++S+N GDC+LL+T  + F+WIGE ANVIE NKA+EL ++I   ++L       + TIV+  +   N  SN+V +FWK L    + Q+   P    EDELYE  I  TN +YR+++N+L+P D++W    +  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ R     + S+   +   P         I +++   H       +DG +VGRG  + ++E    R + V T  +E+WHI +     +P  + GQF   D Y+++W Y ++      +N         G     +FFWQG +++I+EK  SAL T++LD++R  Q++V+Q  E P F + F G MVVH GK++  ++        RL+ +RGE+  E H +EVV    SLR R   +L+N      ++W G  +   ++  A     +L    P++  ++  +   + E  +G EP  FW+ +G  ++ + +Y      P R  F      +S  +G   + E    LYP  E  ++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V +VL      +Y  E L  RPLP+ V   R+E YL+ EDFE   +M++E++  L  WKQ + KK   LF
Sbjct:  996 MEQHKRAVRPTRNVR-SSRNPLKTLAAREDIRHEYTEQRLNIGLLESKRMKAEKMNKTSSFSEAALAGLASKENFSGVSLRSVSESEQTSNNSAVPYKKLMLLQVKGRRHVQTRLVEPRSASLNSGDCFLLITPHHCFLWIGEFANVIEKNKASELANFIQAKRDLGC-----RATIVQVVEEGVNSYSNSVKEFWKILGGQSSYQLAGTP---DEDELYEGAIVETNCIYRLMDNKLVPDDDFWAKLPRCSLLRPKEVLVFDFGSEMYIWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNPLIPKKGQGRPDWAVFGRLTQHNETTLFKEKFQDWSDSRRTPSPPTDSEQLPDAKDPPTSVQSHAHIASLMLSPHLEPVCTKLDGFNVGRG--YGLVEAEEWRSYEVSTLGVEVWHILEFDYSRLPGQSVGQFHDGDTYVVKWKYMVSAAVGKRQNPDQLKTAGPGKEKCCYFFWQGRNSTISEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFKGGMVVHSGKREEEEEEENLQNDWRLYCVRGEVTVEGHLLEVVCHCSSLRSRVSMVLLNGRQALIYLWHGCKSQKHTQEVARTAANKLKEDCPLEAGLHSSSRVTIRECHEGAEPAGFWEALG--RRDRKAYDCMLQDPGRFNFTPRLYQLSSSSGEFAVVEY---LYPSREPEMVNSMPFLQEDLYATCQPALFLVDNHHEVYLWQGWWPQDSE-STGSA------------------RIRWDSDRKCAMETVLQYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDVAEITEREAEVCNQIILVEEVLARLCKSSYPLEELLARPLPQGVDPLRLEIYLSDEDFERALEMSREEYGALPGWKQVKLKKAKGLF 1870          
BLAST of HP domain-containing protein vs. Ensembl Medaka
Match: svila (supervillin [Source:NCBI gene;Acc:101158061])

HSP 1 Score: 516.153 bits (1328), Expect = 8.615e-152
Identity = 355/1153 (30.79%), Postives = 566/1153 (49.09%), Query Frame = 3
Query: 1497 HLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCRPNSVVISSIQEQLQENNDNWKNRV--EQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDE---------------SKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR-TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAV-QFWKCL-HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSH-PSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRN------NRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS----RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWF------VSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL--TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            H  Q + K  +E H S            Q+   E S+K +   D ++E++     + I   ++Q++   + WK++      D  +FT   ++ K      +      H  +I+   NG    + ++   E+ K  P   L SD+ +D+                +S + V E K  E +    ++ E       H   +P  +++   +    +  +   P              L S   +  +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   + F E ALA L  KE+FS + L+  +ES +       PYK LML+ VKGR++VQ RLVEP ++S+N GDC+LL+T  + F+WIGE ANVIE NKA+EL ++I   ++L       + TIV+  +   N  SN+V +FWK L    + Q+   P    EDELYE  I  TN +YR+++N+L+P D++W    +  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ R     + S+   +   P         I +++   H       +DG +VGRG  + ++E    R + V T  +E+WHI +     +P  + GQF   D Y+++W Y ++      +N         G     +FFWQG +++I+EK  SAL T++LD++R  Q++V+Q  E P F + F G MVVH GK++  ++        RL+ +RGE+  E H +EVV    SLR R   +L+N      ++W G  +   ++  A     +L    P++  ++  +   + E  +G EP  FW+ +G  ++ + +Y      P R  F      +S  +G   + E    LYP  E  ++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V +VL      +Y  E L  RPLP+ V   R+E YL+ EDFE   +M++E++  L  WKQ + KK   LF
Sbjct:  994 HKKQEVVKAALEEHES------------QLWEMEQSFKKKRIADEEMESQRMETQMSIQERKQQIEAQEEAWKSKGLGAANDSTQFTVAARMVK----KGLASPSAFHSLVISKSKNGS---LAISKPQEEIKAMPDLNLESDLRLDKLESFLGRLNSKVCALPESTITVTEKKVKEVMN---LEDETFSKFYPHTDDLPANANKVEIDDDFDAIFDPRVPK-------------LAS--AMEQHKRAVRPTRNVR-SSRNPLKTLAAREDIRHEYTEQRLNIGLLESKRMKAEKMNKTSSFSEAALAGLASKENFSGVSLRSVSESEQTSNNSAVPYKKLMLLQVKGRRHVQTRLVEPRSASLNSGDCFLLITPHHCFLWIGEFANVIEKNKASELANFIQAKRDLGC-----RATIVQVVEEGVNSYSNSVKEFWKILGGQSSYQLAGTP---DEDELYEGAIVETNCIYRLMDNKLVPDDDFWAKLPRCSLLRPKEVLVFDFGSEMYIWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNPLIPKKGQGRPDWAVFGRLTQHNETTLFKEKFQDWSDSRRTPSPPTDSEQLPDAKDPPTSVQSHAHIASLMLSPHLEPVCTKLDGFNVGRG--YGLVEAEEWRSYEVSTLGVEVWHILEFDYSRLPGQSVGQFHDGDTYVVKWKYMVSAAVGKRQNPDQLKTAGPGKEKCCYFFWQGRNSTISEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFKGGMVVHSGKREEEEEEENLQNDWRLYCVRGEVTVEGHLLEVVCHCSSLRSRVSMVLLNGRQALIYLWHGCKSQKHTQEVARTAANKLKEDCPLEAGLHSSSRVTIRECHEGAEPAGFWEALG--RRDRKAYDCMLQDPGRFNFTPRLYQLSSSSGEFAVVEY---LYPSREPEMVNSMPFLQEDLYATCQPALFLVDNHHEVYLWQGWWPQDSE-STGSA------------------RIRWDSDRKCAMETVLQYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDVAEITEREAEVCNQIILVEEVLARLCKSSYPLEELLARPLPQGVDPLRLEIYLSDEDFERALEMSREEYGALPGWKQVKLKKAKGLF 2072          
BLAST of HP domain-containing protein vs. Ensembl Medaka
Match: svila (supervillin [Source:NCBI gene;Acc:101158061])

HSP 1 Score: 516.538 bits (1329), Expect = 9.784e-152
Identity = 313/912 (34.32%), Postives = 482/912 (52.85%), Query Frame = 3
Query: 2169 LNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR-TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAV-QFWKCL-HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSH-PSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRN------NRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS----RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWF------VSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL--TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            +  +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   + F E ALA L  KE+FS + L+  +ES +       PYK LML+ VKGR++VQ RLVEP ++S+N GDC+LL+T  + F+WIGE ANVIE NKA+EL ++I   ++L       + TIV+  +   N  SN+V +FWK L    + Q+   P    EDELYE  I  TN +YR+++N+L+P D++W    +  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ R     + S+   +   P         I +++   H       +DG +VGRG  + ++E    R + V T  +E+WHI +     +P  + GQF   D Y+++W Y ++      +N         G     +FFWQG +++I+EK  SAL T++LD++R  Q++V+Q  E P F + F G MVVH GK++  ++        RL+ +RGE+  E H +EVV    SLR R   +L+N      ++W G  +   ++  A     +L    P++  ++  +   + E  +G EP  FW+ +G  ++ + +Y      P R  F      +S  +G   + E    LYP  E  ++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V +VL      +Y  E L  RPLP+ V   R+E YL+ EDFE   +M++E++  L  WKQ + KK   LF
Sbjct: 1265 MEQHKRAVRPTRNVR-SSRNPLKTLAAREDIRHEYTEQRLNIGLLESKRMKAEKMNKTSSFSEAALAGLASKENFSGVSLRSVSESEQTSNNSAVPYKKLMLLQVKGRRHVQTRLVEPRSASLNSGDCFLLITPHHCFLWIGEFANVIEKNKASELANFIQAKRDLGC-----RATIVQVVEEGVNSYSNSVKEFWKILGGQSSYQLAGTP---DEDELYEGAIVETNCIYRLMDNKLVPDDDFWAKLPRCSLLRPKEVLVFDFGSEMYIWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNPLIPKKGQGRPDWAVFGRLTQHNETTLFKEKFQDWSDSRRTPSPPTDSEQLPDAKDPPTSVQSHAHIASLMLSPHLEPVCTKLDGFNVGRG--YGLVEAEEWRSYEVSTLGVEVWHILEFDYSRLPGQSVGQFHDGDTYVVKWKYMVSAAVGKRQNPDQLKTAGPGKEKCCYFFWQGRNSTISEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFKGGMVVHSGKREEEEEEENLQNDWRLYCVRGEVTVEGHLLEVVCHCSSLRSRVSMVLLNGRQALIYLWHGCKSQKHTQEVARTAANKLKEDCPLEAGLHSSSRVTIRECHEGAEPAGFWEALG--RRDRKAYDCMLQDPGRFNFTPRLYQLSSSSGEFAVVEY---LYPSREPEMVNSMPFLQEDLYATCQPALFLVDNHHEVYLWQGWWPQDSE-STGSA------------------RIRWDSDRKCAMETVLQYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDVAEITEREAEVCNQIILVEEVLARLCKSSYPLEELLARPLPQGVDPLRLEIYLSDEDFERALEMSREEYGALPGWKQVKLKKAKGLF 2139          
BLAST of HP domain-containing protein vs. Ensembl Medaka
Match: svila (supervillin [Source:NCBI gene;Acc:101158061])

HSP 1 Score: 515.768 bits (1327), Expect = 2.629e-151
Identity = 313/912 (34.32%), Postives = 482/912 (52.85%), Query Frame = 3
Query: 2169 LNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKR-TESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKN--SNAV-QFWKCL-HYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSH-PSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRN------NRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS----RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRIN-YNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWF------VSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKL--TASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            +  +KR V+P R+ + SSRNPLK L  R DI++EY E+   +   E KR + + +   + F E ALA L  KE+FS + L+  +ES +       PYK LML+ VKGR++VQ RLVEP ++S+N GDC+LL+T  + F+WIGE ANVIE NKA+EL ++I   ++L       + TIV+  +   N  SN+V +FWK L    + Q+   P    EDELYE  I  TN +YR+++N+L+P D++W    +  +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y +C INPLD  P   N   P  G  RP+W + GRL Q  ETTLFKEKF DW ++ R     + S+   +   P         I +++   H       +DG +VGRG  + ++E    R + V T  +E+WHI +     +P  + GQF   D Y+++W Y ++      +N         G     +FFWQG +++I+EK  SAL T++LD++R  Q++V+Q  E P F + F G MVVH GK++  ++        RL+ +RGE+  E H +EVV    SLR R   +L+N      ++W G  +   ++  A     +L    P++  ++  +   + E  +G EP  FW+ +G  ++ + +Y      P R  F      +S  +G   + E    LYP  E  ++ + P LQ  LY + QPALFL+ +   +++W+GWW  D   S G                    R R  S++   +++V  +  +  +K    A +++AGLEP +F  +FP WE  E+   I        NQ   V +VL      +Y  E L  RPLP+ V   R+E YL+ EDFE   +M++E++  L  WKQ + KK   LF
Sbjct: 1319 MEQHKRAVRPTRNVR-SSRNPLKTLAAREDIRHEYTEQRLNIGLLESKRMKAEKMNKTSSFSEAALAGLASKENFSGVSLRSVSESEQTSNNSAVPYKKLMLLQVKGRRHVQTRLVEPRSASLNSGDCFLLITPHHCFLWIGEFANVIEKNKASELANFIQAKRDLGC-----RATIVQVVEEGVNSYSNSVKEFWKILGGQSSYQLAGTP---DEDELYEGAIVETNCIYRLMDNKLVPDDDFWAKLPRCSLLRPKEVLVFDFGSEMYIWHGKEVTLAQRKVAFQLAKHLWNGTFDYTNCDINPLD--PGECNPLIPKKGQGRPDWAVFGRLTQHNETTLFKEKFQDWSDSRRTPSPPTDSEQLPDAKDPPTSVQSHAHIASLMLSPHLEPVCTKLDGFNVGRG--YGLVEAEEWRSYEVSTLGVEVWHILEFDYSRLPGQSVGQFHDGDTYVVKWKYMVSAAVGKRQNPDQLKTAGPGKEKCCYFFWQGRNSTISEKGTSALMTVELDEERGAQVQVQQGKEPPCFLQCFKGGMVVHSGKREEEEEEENLQNDWRLYCVRGEVTVEGHLLEVVCHCSSLRSRVSMVLLNGRQALIYLWHGCKSQKHTQEVARTAANKLKEDCPLEAGLHSSSRVTIRECHEGAEPAGFWEALG--RRDRKAYDCMLQDPGRFNFTPRLYQLSSSSGEFAVVEY---LYPSREPEMVNSMPFLQEDLYATCQPALFLVDNHHEVYLWQGWWPQDSE-STGSA------------------RIRWDSDRKCAMETVLQYCREKNEKKPPKAYLIHAGLEPLTFTNMFPCWEHREDVAEITEREAEVCNQIILVEEVLARLCKSSYPLEELLARPLPQGVDPLRLEIYLSDEDFERALEMSREEYGALPGWKQVKLKKAKGLF 2193          
BLAST of HP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003028.2 (supervillin [Source:NCBI gene;Acc:101166743])

HSP 1 Score: 487.649 bits (1254), Expect = 3.396e-144
Identity = 307/940 (32.66%), Postives = 489/940 (52.02%), Query Frame = 3
Query: 2112 TNVPTNDDFDEIFLQSDLNLN----LNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQ-NIQSKAG-FVEEALAALTVKEDFSKIKLKRTE-SNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDT-VQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEG---DLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTH-GRY----TRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKS--RLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNE-FKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSL-------------YPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWL--SQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQHEKKKEVDLF 4829
            T +  ++DFD IF      L      +K  V+P R+ + SSRNPL+ L  R DI++EY E+   VA+ E KR + + N  S+   + E ALA L  KE+FS + L+    + +       PYK LML+ VKGR++VQ RLVEP ASS+N GDC+LL+T  + FVWIGE +NVIE  KA +L ++I   K++     +++   ++   + + +   QFW  L      Q   PP    EDE +E  I  TN ++R+++++L+P DE WG      +L   +V +FDFG+E+Y+W G +  +  +     L K L++  F+Y  C INPLD  P   N   P  G  RP+W I GRL +  ET LFKEKF DW E     K  +P +      +P E    + +P D   +L +       I++G +VGRG      ED  +R   + T ++++WHI +     +P  + GQF   DAY+++W Y ++T  GR      R++  G     +FFWQG  ++++EK  SAL T++L++ R  Q++V+Q  E PAF + F+G M++H GK++  ++ ++S  RL+ +RGE+  E H +EV     SLR R+  +++N N    ++W G  +   ++S  +    ++  + P++  ++ +    + E ++G E   FW+ +G  +K + +Y      P          G  N T  L+ L             +P    +++ + P LQ  LY ++QPALF++ +   +++W+GWW  D   S G                    R R  +++   +++V  +      K    A +++AGLEP +F  +FP WE  E+   I        NQ   V DVL      ++   +L+ RPLPE V   R+E YL+ +DFE   +MT+E++  L  WKQ   KK   LF
Sbjct:  735 TRIELSEDFDSIFGSQSPKLTSAMVQHKLAVRPSRNVR-SSRNPLRMLAAREDIRHEYTEQRLNVAQVESKRIKAEKNEPSRTSEYSEAALAGLASKENFSGVSLRSVNLTEQSSNNSAVPYKSLMLMQVKGRRHVQTRLVEPRASSLNSGDCFLLVTPDHCFVWIGEFSNVIEKAKAMDLATFIQTKKDMGC--RANQLQTIEEGVDPQGAETQQFWTILGGQMPYQSAGPP---EEDEQFENGIVETNCIFRLLDDKLVPDDEEWGKNPHSCLLSSKEVLVFDFGSEVYVWHGKEVTLAQRKVAFQLAKHLWNGTFDYTCCDINPLD--PGGCNTLIPRKGQGRPDWAIFGRLTEHNETALFKEKFLDWSEA----KSPTPKEGGEPVPEPKEAPGRECRPYDATLMLPIICSPVCTILEGVNVGRGYGPVETED-RMRVQEISTVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMVSTSVGRRQNPDARSSGPGKEKCCYFFWQGRHSTVSEKGTSALMTVELNEKRGAQVQVQQGKEPPAFLQCFNGGMIIHAGKREEEEENTQSEWRLYCVRGEVPVEGHLLEVACHCSSLRSRASMIMLNINKAVIYLWHGCKSQQHTRSVGNTAALKIKEQCPLEAGLHCSSNVTIHECDEGAETPGFWEALG--RKDRKAYDCMLQDP----------GKFNFTPRLFQLSSTSGDFVAAEFFHPSGAADLVSSLPFLQEDLYNASQPALFMVDNFHEVYLWQGWWPQDSE-STGSA------------------RIRWDADRKCAMQTVLQYCKEKNEKKPPKAYLIHAGLEPLTFTNMFPSWEHREDVAEITEREAEVCNQIILVEDVLARLCQNSFPLSQLQTRPLPEGVDPLRLEIYLSDQDFERALEMTREEYECLPGWKQVNLKKAKGLF 1630          
BLAST of HP domain-containing protein vs. Planmine SMEST
Match: SMESG000075965.1 (SMESG000075965.1)

HSP 1 Score: 3019.18 bits (7826), Expect = 0.000e+0
Identity = 1526/1535 (99.41%), Postives = 1530/1535 (99.67%), Query Frame = 3
Query:  153 MNTDVINAFNLCRGKVFQYKQQLFSRFSNEHVPVPFGVDYXXXXXXXXPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPTVNRKIIQISAKSLQDKTINETQTILTDIKGISTTSPVRERPKVLDFPQETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKXXXXXXXXXXXXXXEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFXXXXXXXXXXXXXXXXXPHKLKKSNAILRAQSCFISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFK 4757
            MNTDVINAFNLCRGKVFQYKQQLFSRFSNEHVPVPFGVDYSSKSKSSKPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPT+NRKIIQISAKSLQDKTINETQTILTDI+GISTTSPV+ERPKVLDF QETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKSTPSSSRSNSLVPSEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSC ISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKD DVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKAD+KTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFED  K
Sbjct:    1 MNTDVINAFNLCRGKVFQYKQQLFSRFSNEHVPVPFGVDYSSKSKSSKPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPTINRKIIQISAKSLQDKTINETQTILTDIEGISTTSPVKERPKVLDFSQETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKSTPSSSRSNSLVPSEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSCLISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDMDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADIKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDYSK 1535          
BLAST of HP domain-containing protein vs. Planmine SMEST
Match: SMESG000075965.1 (SMESG000075965.1)

HSP 1 Score: 2995.68 bits (7765), Expect = 0.000e+0
Identity = 1516/1535 (98.76%), Postives = 1522/1535 (99.15%), Query Frame = 3
Query:  153 MNTDVINAFNLCRGKVFQYKQQLFSRFSNEHVPVPFGVDYXXXXXXXXPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPTVNRKIIQISAKSLQDKTINETQTILTDIKGISTTSPVRERPKVLDFPQETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKXXXXXXXXXXXXXXEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFXXXXXXXXXXXXXXXXXPHKLKKSNAILRAQSCFISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFK 4757
            MN    + F   +GKVFQYKQQLFSRFSNEHVPVPFGVDYSSKSKSSKPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPT+NRKIIQISAKSLQDKTINETQTILTDI+GISTTSPV+ERPKVLDF QETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKSTPSSSRSNSLVPSEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSC ISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKD DVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKAD+KTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFED  K
Sbjct:    1 MNDKFRSIFQSKKGKVFQYKQQLFSRFSNEHVPVPFGVDYSSKSKSSKPQPQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKSPTINRKIIQISAKSLQDKTINETQTILTDIEGISTTSPVKERPKVLDFSQETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVERKKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKSTPSSSRSNSLVPSEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRFKTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSCLISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDMDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADIKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDYSK 1535          
BLAST of HP domain-containing protein vs. Planmine SMEST
Match: SMESG000075965.1 (SMESG000075965.1)

HSP 1 Score: 2466.03 bits (6390), Expect = 0.000e+0
Identity = 1227/1233 (99.51%), Postives = 1229/1233 (99.68%), Query Frame = 3
Query: 1059 QPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFXXXXXXXXXXXXXXXXXPHKLKKSNAILRAQSCFISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFK 4757
            +PLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSC ISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKD DVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKAD+KTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFED  K
Sbjct:   25 EPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSCLISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDMDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADIKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDYSK 1257          
BLAST of HP domain-containing protein vs. Planmine SMEST
Match: SMESG000075965.1 (SMESG000075965.1)

HSP 1 Score: 2464.88 bits (6387), Expect = 0.000e+0
Identity = 1227/1233 (99.51%), Postives = 1229/1233 (99.68%), Query Frame = 3
Query: 1059 QPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFXXXXXXXXXXXXXXXXXPHKLKKSNAILRAQSCFISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTXXXXXXXXXXXXXXXTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDLFK 4757
            +PLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSC ISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKD DVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKAD+KTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFED  K
Sbjct:   53 EPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSSNKNSENQKSPHKLKKSNAILRAQSCLISQKPNICKPINEETIVPGIKVKDFIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHLTQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDMDVETKCRPNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKRYTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLIVDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTEKPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNERTDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKIKLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCYLLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVKSDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRVVENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADIKTKNNGRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRLAQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGNILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGKEPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYPDSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCGDYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASIVYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTMTYSAERLRERPLPENVISSRIESYLAPEDFEDYSK 1285          
BLAST of HP domain-containing protein vs. Planmine SMEST
Match: SMESG000015535.1 (SMESG000015535.1)

HSP 1 Score: 58.151 bits (139), Expect = 2.763e-8
Identity = 56/236 (23.73%), Postives = 96/236 (40.68%), Query Frame = 3
Query: 3306 LNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDNAAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQGISTSITEKTASALWTIDLD---KDRVTQIRVKQNHESPAFCRLFDGSMVVHIGKQ----QLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANGNRGFMWSGNFASPQSKSCASYCFQQLLAKK 3992
            L++    T  ++   S      WK+++       +V T ++ +W I     V  P  + G+FF+ D+YII          +  +   +  L     FW G  ++  E   +A  T++LD    D+  Q R     ES  F   F    ++  G +    Q+  +  + RL       +     VEV    +SL    VF+L   NG   F W+G  ++   K  A+   QQL +++
Sbjct:   14 LSLFGSDTEKLVKKTSSETEAAWKLVK-------TVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIIL---------KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFIL--DNGLEAFQWNGKLSNKNEKVKAAQFLQQLESER 231          
The following BLAST results are available for this feature:
BLAST of HP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SVIL8.158e-15433.87supervillin [Source:HGNC Symbol;Acc:HGNC:11480][more]
SVIL1.449e-15133.83supervillin [Source:HGNC Symbol;Acc:HGNC:11480][more]
SVIL1.580e-15133.83supervillin [Source:HGNC Symbol;Acc:HGNC:11480][more]
SVIL1.150e-12734.55supervillin [Source:HGNC Symbol;Acc:HGNC:11480][more]
GSN6.183e-2123.16gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
viln-11.981e-3422.95VILliN related [Source:UniProtKB/TrEMBL;Acc:P9104... [more]
fli-12.267e-919.69pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svil1.995e-12832.01gene:FBgn0266696 transcript:FBtr0345108[more]
Svil5.558e-12832.01gene:FBgn0266696 transcript:FBtr0345107[more]
Svil5.558e-12832.01gene:FBgn0266696 transcript:FBtr0345106[more]
Svil5.995e-12632.01gene:FBgn0266696 transcript:FBtr0345105[more]
Svil1.535e-12231.99gene:FBgn0266696 transcript:FBtr0345104[more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svila3.644e-15934.16supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila5.403e-15834.01supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila5.403e-15834.01supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila6.206e-15733.90supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila6.206e-15733.90supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc1812.490e-15234.20coiled-coil domain containing 181 [Source:Xenbase;... [more]
ccdc1812.712e-15234.20coiled-coil domain containing 181 [Source:Xenbase;... [more]
ccdc1812.747e-15234.20coiled-coil domain containing 181 [Source:Xenbase;... [more]
ccdc1815.742e-15234.20coiled-coil domain containing 181 [Source:Xenbase;... [more]
ccdc1816.757e-15234.20coiled-coil domain containing 181 [Source:Xenbase;... [more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Svil4.044e-15233.86supervillin [Source:MGI Symbol;Acc:MGI:2147319][more]
Svil8.990e-15133.86supervillin [Source:MGI Symbol;Acc:MGI:2147319][more]
Svil3.955e-15033.83supervillin [Source:MGI Symbol;Acc:MGI:2147319][more]
Svil3.955e-15033.83supervillin [Source:MGI Symbol;Acc:MGI:2147319][more]
Svil3.955e-15033.83supervillin [Source:MGI Symbol;Acc:MGI:2147319][more]
back to top
BLAST of HP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95425|SVIL_HUMAN7.590e-15133.83Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 S... [more]
sp|Q8K4L3|SVIL_MOUSE2.766e-14933.83Supervillin OS=Mus musculus OX=10090 GN=Svil PE=1 ... [more]
sp|O46385|SVIL_BOVIN8.221e-14933.26Supervillin OS=Bos taurus OX=9913 GN=SVIL PE=1 SV=... [more]
sp|Q8WQ85|VILD_DICDI1.936e-3523.16Villidin OS=Dictyostelium discoideum OX=44689 GN=v... [more]
sp|Q07171|GELS_DROME1.744e-2623.12Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel... [more]
back to top
BLAST of HP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1P9W80.000e+033.71Supervillin OS=Crassostrea gigas OX=29159 GN=CGI_1... [more]
A0A2R2MLJ10.000e+033.42supervillin-like OS=Lingula unguis OX=7574 GN=LOC1... [more]
A0A210QRF53.318e-17933.97Supervillin OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
R7UG553.889e-17735.88HP domain-containing protein (Fragment) OS=Capitel... [more]
V4C5B34.370e-17334.97HP domain-containing protein OS=Lottia gigantea OX... [more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svila1.080e-15434.16supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila5.756e-15334.16supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila6.873e-15334.16supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svila8.987e-15334.16supervillin a [Source:ZFIN;Acc:ZDB-GENE-990706-5][more]
svild5.648e-14732.97supervillin-like [Source:NCBI gene;Acc:103046197][more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003626.11.840e-13233.87pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 ... [more]
ENSPMAT00000002059.11.696e-4034.14pep scaffold:Pmarinus_7.0:GL477505:32441:37656:-1 ... [more]
avil4.256e-1321.29advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna3.206e-628.57gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO457965.129e-12332.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297848.210e-4024.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436149.616e-2524.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386582.719e-1525.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492364.952e-627.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svila1.061e-15234.32supervillin [Source:NCBI gene;Acc:101158061][more]
svila8.615e-15230.79supervillin [Source:NCBI gene;Acc:101158061][more]
svila9.784e-15234.32supervillin [Source:NCBI gene;Acc:101158061][more]
svila2.629e-15134.32supervillin [Source:NCBI gene;Acc:101158061][more]
ENSORLT00000003028.23.396e-14432.66supervillin [Source:NCBI gene;Acc:101166743][more]
back to top
BLAST of HP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075965.10.000e+099.41SMESG000075965.1[more]
SMESG000075965.10.000e+098.76SMESG000075965.1[more]
SMESG000075965.10.000e+099.51SMESG000075965.1[more]
SMESG000075965.10.000e+099.51SMESG000075965.1[more]
SMESG000015535.12.763e-823.73SMESG000015535.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014645 ID=SMED30014645|Name=HP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5220bp
TGAATCACACGCTGATTGAACAGCATTATTCTATCCATCCTCTCATTGGT
CACTCGGCTGTTATTACAATAATGTACAATAGATTTGTTTTGTTCAACCC
TCTGCGACCGATATTGATCGATAAATAATCTATTGGATTTATCTGTTCCC
CAATGAACACTGATGTGATTAATGCATTTAATCTTTGTAGAGGAAAGGTT
TTCCAATATAAACAACAATTATTCAGTCGCTTTTCTAATGAACATGTTCC
TGTGCCATTTGGAGTGGATTATTCTTCTAAATCCAAATCATCTAAGCCTC
AGCCTCAAATAGACAAATCAACTAGTCAACATAATCAACCTGTACTGGTG
ACTCAGAGGGAAGATGTAGCTACATTGTCACCGAAAATTCTTAAAACCGA
CAGAAAACACGAAACATTTGAAACCGTTTCGAAAATTCAATTCCAAAAAT
CACCAACAGTTAATAGGAAAATTATACAGATTTCTGCCAAATCACTCCAA
GATAAAACAATAAATGAAACTCAAACCATTCTTACGGATATCAAAGGAAT
TTCCACAACTTCGCCAGTAAGAGAACGACCAAAAGTTTTGGATTTTCCTC
AAGAAACTTCAAAAAATCAAGAATCTAATATTATTTTTGGATTAAATTCT
CCATTAGATAGAAATACTCGAGTCAAAGAATACATTGGAAATCAATTATT
GTCTCCCCTTTCTGAACCGGAAGTGTTATGTAGTGAAGACTGTGTTGAAA
GAAAGAAAATAAGAAAAACCTTAACAATGAATAAACAAGATCGATATTCA
AATCAGACAATTTCTAGTCCAGGTCCGGTTGATCGTTCTCTAGTCAGTGT
TGCTCAAAGAGCTAAATATTTAATGAACAATAAATCTACCCCATCTTCTT
CCCGGTCAAATTCTCTTGTTCCCAGTGAAGAAGTAGATGAATCAGTTATG
TCAATAAAAGATCGTATTAAATTATTCAAGGATAATTTAGACCAATCAGC
GTCAACAGCGACAAGCCAAGGAAAGCCACAAAAACATGTGCTAAATCGGT
TCAAAACTCAACCACTTTCCTTTGATGATATAGCCCGAGCAAATGCTATG
ATTCTTGATCAAAGTGAAGTTTGTAGTACAATTGCTTCACCTTCGATGAC
AAATAGCAATGAAACTTTGGTAGATTTCTCAGAAGATAGCAATTCATCAT
CAAACAAAAACAGTGAAAATCAAAAGTCGCCACATAAGCTAAAAAAATCC
AACGCCATTTTGAGAGCTCAGAGTTGTTTTATTAGTCAAAAACCAAACAT
TTGCAAACCTATCAACGAAGAAACTATCGTACCAGGAATTAAAGTAAAAG
ATTTTATTCAAAATTGTGATAAAAAAGAAGATGTTATTCAACAAAAGTAT
CCAAAAAATGCTGTGGTTTCTCGTAAATTAGCATTTAAAAGTAAAACCGA
AGACGAAAAAGGCTACAAACAAACGAAATCTTATTCTAAAAAACCTCATT
TGACGCAACCGATTACAAAATTAGACATGGAAGCTCACAATAGTATTGAA
GCCAATTCCAGCATTAAAGATCGAATTTCCCAAATACAAACTCAAGAAAA
TAGTTGGAAAGCCAGACTCCGCAAGGATACGGACGTTGAGACTAAATGTC
GACCAAACAGTGTTGTTATATCATCCATCCAGGAGCAATTACAAGAGAAT
AATGACAACTGGAAAAATAGAGTCGAACAAAAAGATGTCGGTGAATTTAC
AGCTGTCAATAAACTTGGCAAATTTTCTAAAAATAATAACGTGACAAAAC
GGTATACAATTCACGGAGAGCTTATAAATGACGATGTTAACGGTGACCAT
TTTATTGTTCGTTTGACTGACAACAGTGAAAAGGATAAACCACCGCCCAA
ACAAACTCTGATTTCTGATATCATTGTTGATGAATCTAAATCTAATTTGA
TAGTTGATGAAAGCAAGAAATCAGAGTCTTTGGCAGCAGATATTGTCCAG
TCAGAACCACTTTATACAATTGAGTCACATAAAGTTACTATACCGAATAC
GTCTGACCAAAGTCTTTCAAATTTTTTTTCATCTTCCCCAGACAATACTG
AAAAACCTTCAACAAACGTTCCCACTAACGATGATTTCGATGAAATATTT
TTACAATCCGATCTCAATCTCAATTTAAATAAACGATTCGTGAAACCGAT
TAGGCATCAGAAACCTTCTTCAAGAAATCCTTTGAAAAAGTTAAATGAAA
GAACCGACATTAAAAATGAATATGACGAAAGATTATCCGGTGTTGCCGAA
AGAGAACTAAAACGTTATCAGATTCAGAACATTCAATCGAAAGCGGGTTT
TGTTGAAGAAGCTCTTGCAGCATTGACAGTTAAAGAAGACTTTTCGAAAA
TCAAACTAAAAAGAACAGAGAGTAATAAATTGTTCGAAAGATTCGTCAGC
CCATATAAGGATCTAATGCTCATATCTGTGAAAGGGCGAAAGAATGTTCA
GGTTCGTCTTGTGGAGCCAACCGCCTCTTCCATTAATATTGGTGACTGCT
ATCTACTGCTAACCAAACAAAACGTGTTTGTGTGGATAGGAGAATGTGCC
AATGTTATAGAAACTAATAAAGCTAATGAATTAGGGTCTTGGATTACTAA
ATGCAAAGAACTAAACTACAGTGGTAGTTCCGATAAGCCCACCATTGTTA
AATCAGATGATAATGATAAAAATTCTAACGCAGTTCAATTCTGGAAATGC
CTTCATTATGACACCGTTCAAATAATTAATCCTCCCGGGGATGTTTCCGA
AGACGAACTATATGAGAGAATGATACAGCATACTAATATGGTATATCGAG
TGGTTGAAAATCGTTTGATACCTTATGATGAATACTGGGGTTCACCTCTA
AAACATAAAATGTTGGTAGATGATCAAGTGTTTATATTCGATTTCGGAAC
AGAATTATATCTGTGGAGTGGATTCAAAGCTGACATGAAAACAAAAAATA
ATGGCAGAAATTTGTTGAAAATACTTTTTTCACAAGGTTTTAATTACGAT
TCATGTACAATAAATCCATTGGATCCTTTGCCAAATAACCATAACGAAGC
TAAACCTACGCATGGATCCACTAGACCTAATTGGGTAATTGTTGGAAGAC
TTGCTCAAAAAGGAGAAACAACATTATTTAAAGAAAAATTTTCCGATTGG
CCTGAAACATCGAGATTAATTAAAATTATTTCCCCATCTCAAACAAACAA
TGAACGAAATAAACCTATTGAAGGAGATTTACAACCAATTGATATTGGAA
ATATATTAAATATGTCTCATCCCAGTACTCACATAATAATTGATGGTAAG
AGTGTTGGTCGTGGAGGGAAATGGAAAGTTATAGAAGACGGTATTCTAAG
AGAATTTAGTGTGATAACTAAAAATATTGAGATGTGGCATATCACTGATA
ATGCAGCCGTTGTGGTCCCTCCAACGAACACTGGTCAATTTTTCTCTAAT
GACGCTTATATCATTCGGTGGAATTATGAATTGACCACCCATGGCAGGTA
TACTCGAAACAATCGCACTGGAAATTTATTGTCAGCATTTTTCTTTTGGC
AAGGAATATCAACAAGTATTACCGAAAAAACTGCAAGCGCATTATGGACC
ATTGATTTAGATAAAGATCGTGTTACTCAGATACGTGTCAAGCAAAATCA
TGAAAGTCCAGCATTTTGTCGTTTATTTGATGGCTCTATGGTTGTACATA
TTGGTAAACAGCAGTTAGCCAAAAAGCCTTCGAAGTCTCGTTTATTTATC
ATTCGGGGCGAAATAGAATCAGAAGCTCATTTTGTTGAGGTCGTTAATGA
ATCGCATTCTCTTCGAGATAGATCTGTGTTCTTATTGATAAATGCCAATG
GCAACCGAGGATTTATGTGGTCTGGTAATTTTGCGTCTCCTCAAAGTAAA
TCTTGCGCATCCTATTGTTTCCAACAATTGTTAGCTAAAAAACCAGTTGA
CTTTCGAATTAATTATAATGAGTTCAAACTTGAAGAGATAGAGCAGGGTA
AAGAACCAAGAACTTTTTGGCAAGATATGGGCATTATAAAAAAATGGAAA
TCTTCTTATAGTTTTAACTCACTCGTGCCTATACGAGGCTGGTTTGTGTC
TGGTATAACTGGAGTGCTCAATTTGACTGAGATGCTTTATTCTTTATACC
CAGACAGTGAGCACAATGTAATCCCAGCTTTTCCATTGCTCCAAACGACT
CTCTACAAATCAAATCAACCAGCTCTGTTTTTAATTTGGAGTCCTTCACA
TTTATTTATATGGGAAGGTTGGTGGATTTTAGACCGGAATCTGTCGTGTG
GTGATTATGATAGCAACATAGATGATGAAGGGGAAATAAACCTCAATTAT
TTATCGTTACCCAGAAATAGAATCGCTAGTGAAAAATTAGCATTGTTGAA
ATCTGTTGATTCGTGGTTGAGTCAAAATAAAGACAAACTTACAGCCTCGA
TAGTTTATGCAGGACTTGAACCGACATCATTTCAGGAATTATTTCCTTAC
TGGGAAGTTAACGAGGAAGCTCAGAGCATTAATCTAGCAAGGCATTATAA
ATTGAATCAAGAAGACAATGTGACAGACGTTCTCAACAATTATTTGACAA
TGACCTATTCTGCCGAGCGCCTACGTGAACGGCCGCTCCCAGAAAATGTG
ATCTCATCACGAATCGAATCCTATTTGGCGCCAGAGGATTTCGAGGACTT
ATTCAAAATGACCAAAGAAAAATTTTATGAATTAAGTCCTTGGAAGCAAC
ACGAAAAGAAGAAAGAAGTGGATTTATTTTAGAGTATCTTTACAAAGAAC
ACTTGCTCAAAAGTTTATTTATTGATGATATACTTTGCTATTTGTTATTG
ATTATTATATATAAACATTATTTTGGTGGACTCGGTAAGAAAACACATTT
GACTTCTTTAATTGTTTTTTTTTCATATTTTCAAGCCTGGGGGGATTCAG
TTGTTTATCCGGCAGTAATTTAGTAGATTGGGCATTTAAATTGGAGCTAA
GTAGACAGGACGGCATTCACCATTTGGGGGTTAGATTTTTTTTTCATGTT
CTATGCATAATTAGTTTGCAAACTTACTTTTTTAAATGCTGATTTTGTTT
TTATTGTATTTTTCTTTGCAATTTATCATCAAGTTCCAGCTATTATAATG
AATTAACATAATATGCTGAT
back to top

protein sequence of SMED30014645-orf-1

>SMED30014645-orf-1 ID=SMED30014645-orf-1|Name=SMED30014645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1560bp
MNTDVINAFNLCRGKVFQYKQQLFSRFSNEHVPVPFGVDYSSKSKSSKPQ
PQIDKSTSQHNQPVLVTQREDVATLSPKILKTDRKHETFETVSKIQFQKS
PTVNRKIIQISAKSLQDKTINETQTILTDIKGISTTSPVRERPKVLDFPQ
ETSKNQESNIIFGLNSPLDRNTRVKEYIGNQLLSPLSEPEVLCSEDCVER
KKIRKTLTMNKQDRYSNQTISSPGPVDRSLVSVAQRAKYLMNNKSTPSSS
RSNSLVPSEEVDESVMSIKDRIKLFKDNLDQSASTATSQGKPQKHVLNRF
KTQPLSFDDIARANAMILDQSEVCSTIASPSMTNSNETLVDFSEDSNSSS
NKNSENQKSPHKLKKSNAILRAQSCFISQKPNICKPINEETIVPGIKVKD
FIQNCDKKEDVIQQKYPKNAVVSRKLAFKSKTEDEKGYKQTKSYSKKPHL
TQPITKLDMEAHNSIEANSSIKDRISQIQTQENSWKARLRKDTDVETKCR
PNSVVISSIQEQLQENNDNWKNRVEQKDVGEFTAVNKLGKFSKNNNVTKR
YTIHGELINDDVNGDHFIVRLTDNSEKDKPPPKQTLISDIIVDESKSNLI
VDESKKSESLAADIVQSEPLYTIESHKVTIPNTSDQSLSNFFSSSPDNTE
KPSTNVPTNDDFDEIFLQSDLNLNLNKRFVKPIRHQKPSSRNPLKKLNER
TDIKNEYDERLSGVAERELKRYQIQNIQSKAGFVEEALAALTVKEDFSKI
KLKRTESNKLFERFVSPYKDLMLISVKGRKNVQVRLVEPTASSINIGDCY
LLLTKQNVFVWIGECANVIETNKANELGSWITKCKELNYSGSSDKPTIVK
SDDNDKNSNAVQFWKCLHYDTVQIINPPGDVSEDELYERMIQHTNMVYRV
VENRLIPYDEYWGSPLKHKMLVDDQVFIFDFGTELYLWSGFKADMKTKNN
GRNLLKILFSQGFNYDSCTINPLDPLPNNHNEAKPTHGSTRPNWVIVGRL
AQKGETTLFKEKFSDWPETSRLIKIISPSQTNNERNKPIEGDLQPIDIGN
ILNMSHPSTHIIIDGKSVGRGGKWKVIEDGILREFSVITKNIEMWHITDN
AAVVVPPTNTGQFFSNDAYIIRWNYELTTHGRYTRNNRTGNLLSAFFFWQ
GISTSITEKTASALWTIDLDKDRVTQIRVKQNHESPAFCRLFDGSMVVHI
GKQQLAKKPSKSRLFIIRGEIESEAHFVEVVNESHSLRDRSVFLLINANG
NRGFMWSGNFASPQSKSCASYCFQQLLAKKPVDFRINYNEFKLEEIEQGK
EPRTFWQDMGIIKKWKSSYSFNSLVPIRGWFVSGITGVLNLTEMLYSLYP
DSEHNVIPAFPLLQTTLYKSNQPALFLIWSPSHLFIWEGWWILDRNLSCG
DYDSNIDDEGEINLNYLSLPRNRIASEKLALLKSVDSWLSQNKDKLTASI
VYAGLEPTSFQELFPYWEVNEEAQSINLARHYKLNQEDNVTDVLNNYLTM
TYSAERLRERPLPENVISSRIESYLAPEDFEDLFKMTKEKFYELSPWKQH
EKKKEVDLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR007526SWIRM
IPR003128Villin_headpiece
IPR007122Villin/Gelsolin
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR007123Gelsolin-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0051015actin filament binding
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization