Small heat shock protein p36

Overview
NameSmall heat shock protein p36
Smed IDSMED30014640
Length (bp)1659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small heat shock protein p36 (SMED30014640) t-SNE clustered cells

Violin plots show distribution of expression levels for Small heat shock protein p36 (SMED30014640) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small heat shock protein p36 (SMED30014640) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small heat shock protein p36 (SMED30014640) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014640

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014640SMESG000028601.1 Contig48850newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014640SMESG000028601.1 Contig48850uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014640SMESG000028601.1 dd_Smed_v4_6399_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small heat shock protein p36 vs. UniProt/SwissProt
Match: sp|P12812|P40_SCHMA (Major egg antigen OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.388e-49
Identity = 120/391 (30.69%), Postives = 193/391 (49.36%), Query Frame = 3
Query:  273 ISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSW------DPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTN-----LVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADA-----CKTQTMDRNQVIVKRNTSGPVVLND-EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSN----SSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            +SIPVN++ R+ E++R+++ + LE                  R N +     D               W S V  WI +S KRWD +M R++R MF+L      +  +++      +PF  + + +        RQ         I+ +R+ M +  VP+        S  D   + YE G+DG++HFK+RF+A+ F P+DI VT + N + +  +K  T        E  + + +P SID  + +C +T DG+L+LEAPVK     S+   E            + + +  +Q +V +   G   ++D   GKRLH+E+AV+  Y P D  V  +  ++ V GRH  + S+    SSSF EFSQ Y IPET+DP+S++  V+  TL++EA
Sbjct:   10 VSIPVNREQRSFEKQRRDLLTGLEHG------------GGAHRGNSIAPYTED---------------WPSTVDNWIDSSWKRWDDDMRRLRRGMFAL------LPLDTFSIGILENPFALMHQMD--------RQ---------IQDIRERMGSLDVPSTG------SVNDFLKDAYEVGEDGKVHFKVRFDAQGFAPQDINVTSSENRVTVHAKKETTTDGRKCSREFCRMVQLPKSIDDSQLKCRMTDDGVLMLEAPVKVDQNQSLTLNESGQVAVRPKSDNQIKAVPASQALVAKGVHGLSYVDDGSGGKRLHVEVAVDPVYKPEDLFVNVDSNRVVVSGRHHKQKSDQHGRSSSFAEFSQSYAIPETVDPLSVSAQVVGNTLVLEA 344          
BLAST of Small heat shock protein p36 vs. UniProt/SwissProt
Match: sp|Q7YZT0|TSP36_TAESA (Small heat shock protein p36 OS=Taenia saginata OX=6206 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.087e-28
Identity = 91/312 (29.17%), Postives = 151/312 (48.40%), Query Frame = 3
Query:  489 VSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTR-FVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKS----DTNLVE-LHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSI-VPQEKVFADACKTQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKG--RHEVKTSNS--SSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEAIVY 1391
            V +W + SR+    ++  + R++FSLE            PF ++       D+ F          E + +   ++Q R F P +   +      D   + YE G+DG LHFK+ F  KNFK E+I +    N L +  +KS    D  + E + +SI +P S+D    Q  IT D +L++EAPV  P+Y +I +  EK    A +   +   Q+ VK      +V  ++  K++HLE+ V+  + P D  V A+  K+ V G    E KT N+  S  +EF + +  PE +D       ++DG +++EA ++
Sbjct:   35 VFDWAERSRQSLHDDIVNMHRNLFSLE------------PFTAM-------DNAF----------ESVMKEMSAIQPREFHPELEYTQPG--ELDFLKDAYEVGKDGRLHFKVYFNVKNFKAEEITIKADKNKLVVRAQKSVACGDAAMSESVGRSIPLPPSVDRNHIQATITTDDVLVIEAPVNEPNYKAIKLSPEKGL--AIQPSEVQERQLAVKNKEGLEIVTAEDGSKKIHLELKVDPHFAPKDVKVWAKGNKVYVHGVTGKEEKTENASHSEHREFYKAFVTPEVVDASKTQAEIVDGLMVVEAPLF 313          
BLAST of Small heat shock protein p36 vs. TrEMBL
Match: A0A183W2C5 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6880 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.471e-55
Identity = 121/385 (31.43%), Postives = 194/385 (50.39%), Query Frame = 3
Query:  273 ISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNI-----VVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADA-----CKTQTMDRNQVIVKRNTSGPVVLND-EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKT----SNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            +SIPVN++ R+ E++R+++ + LE   S  + + N+                              D+W   V  W+ ++ +RWD +M R++R MF+L    D    ++ DPF  + +                     I+ +RD M T  VP+        S+ D   + YE G+DG++HFK+RF+AK F PEDI VT + N L +      V+    ++ E  + + +P SID+   +C +T DG+L+LEAPVK P+Y S+   E            + Q +  ++ +V + T GP VL+D   GK LH+E+ V+  Y P D  V  +  ++ V GRH  +       +SSF EFSQ Y IPET+DP+S+   ++  TL++EA
Sbjct:   10 VSIPVNREPRSFEKQRRDLLTGLERGGSGSSHSGNS-------------------------ITPYHDDWTGTVDHWVNSAWRRWDEDMRRLRRGMFALLP-VDHFPLSTHDPFALMHQMEHH-----------------IQDIRDRMGTLDVPS------TASASDFLKDAYEVGEDGKVHFKVRFDAKGFDPEDINVTSSDNCLTVHAKKETVKDGGKSIREFCRMVELPRSIDNNHLKCRLTDDGVLMLEAPVKVPEYQSLTLNESGQVGVRPKSDSQLQAVPSSKALVVKGTHGPTVLDDGSGGKLLHVEVPVDPVYKPEDLCVNVDSGRVVVSGRHHKEKHSARGGASSFAEFSQSYAIPETVDPLSVTSQLVGNTLVLEA 345          
BLAST of Small heat shock protein p36 vs. TrEMBL
Match: Q5DFS8 (Major egg antigen OS=Schistosoma japonicum OX=6182 GN=EWB00_009262 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 7.527e-52
Identity = 126/409 (30.81%), Postives = 206/409 (50.37%), Query Frame = 3
Query:  261 YRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSW-DPFRSVKRFNEDRDSEFQRQQKIASCSEG-IKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEK-----SDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFAD----------ACKTQTMDRNQVIVKRNTSGPVVLND-EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGR-HEVKTSNS-----SSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEAIVY*TIASISH 1415
            ++  + IP+N++++T E+ R+ + + L+ ++             R RP L N               +  D W   +  W+ +S + WD EM R++R MF+L         +S  DPF  + R                   EG I+ +R+ +    VP V       +  D   + YE G+DG+L+FK+ F+AK F P++IKV  T N L +  +K     S T   E  + I +P +ID  + +C +T+DG+L+LEAPVK+PDY SI      F D          A + Q++  ++++  +  SGP +L+D   GKRLHLE+ V+  Y P D  V  +  ++ V G+ H+  +S+S     SS+ EF+  YEIPET+DP+ +   + D  L++EA +  T  ++SH
Sbjct:    7 HQKSVVIPINQESKTFEQHRREMLTGLQHRHK-----------GRKRPKLSN--------------TTHIDTWSDVIDNWVDSSWRSWDDEMHRLRRGMFALLPLDTFGQISSIPDPFDLMHRM------------------EGEIEEIRNRIGMSKVPGVG------ALTDFLKDAYEVGEDGKLYFKVHFDAKGFAPDNIKVNSTENRLVVHAKKVSESDSSTQSREFCRMIELPRTIDHNQLKCRLTEDGVLMLEAPVKAPDYESI-----TFTDNRQLGIHPKSANQIQSIPSSKILALKGVSGPTILDDGANGKRLHLEVPVDPVYKPEDLCVNVDSNRVVVSGKIHKTDSSHSNKRSTSSYAEFTHSYEIPETVDPLLVAAQLFDNRLVLEAPLV-TRHTVSH 360          
BLAST of Small heat shock protein p36 vs. TrEMBL
Match: A0A5J4N7G0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007882 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 7.006e-51
Identity = 125/397 (31.49%), Postives = 191/397 (48.11%), Query Frame = 3
Query:  252 MSSYRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISS-EDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKS---DTNLV--ELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNS--------IVPQEKVFADACKTQTMDRNQVIVK-RNTSGPVVLND-EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEV----KTSNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            M+    E  IP+  D RTLE+RR+++ + LE K           +   D+P      NH               NWD +V+ WIQ +  RW+ ++ R+ R  F+L    D  D     PF     F        + +Q++ S    I           +  +  ++   +   D   + YE G+DG+LHFK+RF+ + F P DI+V+   N L +  +KS   DT+    E  ++I +P S+D  +FQCH+T DGIL++EAPVK+PDY S        +  + K   D  K  T   NQ+ ++     GP VL D E G++LH+E+ VE  +   +  V  +   + V GR  +      S  S  KEF++ Y IPET+D  S+   + D TLI+EA
Sbjct:    1 MTGKEHERVIPITTDARTLEQRRKDMVNNLERKQKS---ASGNLVKLADKPT----CNH---------------NWDDEVNRWIQEAYNRWNEDVGRMARDTFALVPQCD-FDMEPLVPFGMFGPFGHVPSILARMKQQLDSLHRQINAQPHLWSGNALGAITPRQCQTNGILDFLKDAYEIGEDGQLHFKVRFDVRGFGPNDIEVSTAKNRLTVHGKKSARTDTSSSSNEFSRTIYLPDSVDDSQFQCHMTGDGILMVEAPVKAPDYQSLTFDDKRQLAIKPKTGTDVAKAATNKNNQLALQLLGVCGPTVLQDGETGRKLHVEVPVEPGFTSDELRVRMDTNCVVVSGRKNIVEGSGQSQCSHVKEFTRTYTIPETVDTFSVKTQLKDNTLIVEA 374          
BLAST of Small heat shock protein p36 vs. TrEMBL
Match: A0A183NBG5 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS25640 PE=3 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 6.008e-50
Identity = 120/386 (31.09%), Postives = 188/386 (48.70%), Query Frame = 3
Query:  273 ISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSW-DPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTN-----LVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADA-----CKTQTMDRNQVIVKRNTSGPVVLND-EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSN----SSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            +SIPVN++ R+ E +R+++ + LE                  R NL+     D               W S V  WI +S +RWD +M R++R MF+L    D      W DPF  + + +                   I+ +R+ M +  VP+        S  D   + YE G+DG++HFK+RF+A+ F P+DI VT + N + +  +K  T        E  + + +P SID  + +C +T DG+L+LEAPVK     S+   E            + + +  +Q +V +   G   ++D   GKRLH+E+ V+  Y P D  V  +  ++ V GRH  + S+    SSSF EFSQ Y IPET+DP+S++  V+  TL++EA
Sbjct:   10 VSIPVNREQRSFERQRRDLLTGLEHG------------GGTHRGNLIAPYTED---------------WPSTVDSWINSSWRRWDEDMRRLRRGMFALLP-LDNFTHGIWEDPFALMHQMDRH-----------------IQDIRERMGSMDVPSTG------SVSDFLKDAYEIGEDGKVHFKVRFDAQGFAPQDINVTSSENRVTVHAKKETTTDGGKCSREFCRMVQLPKSIDDSQLKCRMTDDGVLMLEAPVKVDQNQSLTLNESGQVGVRPKSDNQIKAVPASQALVAKGVHGLSYVDDGSGGKRLHVEVPVDPVYKPEDLCVNVDSNRVVVSGRHHKQKSDRYGKSSSFAEFSQSYAIPETVDPLSVSAQVVGNTLVLEA 344          
BLAST of Small heat shock protein p36 vs. TrEMBL
Match: A0A5K4F2D7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.128e-49
Identity = 124/393 (31.55%), Postives = 196/393 (49.87%), Query Frame = 3
Query:  273 ISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSL-ESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTNLV-----ELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFAD----------ACKTQTMDRNQVIVKRNTSGPVVLNDE-KGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSN------SSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            + IP+N++ +T E+ R+ + + L+ ++             R RP L N  + DT              W   +  W+ +S + WD EM R++R MF+L   D   +  +  DPF  + R   + + E  R +   S   GI  + D ++                     + YE G+DG+L+FK+ F+AK F PEDIKV  T + L +  +K   +       E  + I +P +I+  + +C +T+DG+L+LEAPVKSPDY SI      F D          A + Q++  ++ +V +  SGP++L+DE  G+RLHLEI V+  Y P D  V  + K++ V G    K S       SS + EF+  YEIPET+DP+ +   +ID  L++EA
Sbjct:   12 VDIPINQEPKTFEQHRREMLTGLQHRHK-----------GRKRPKLANTPHTDT--------------WSDVIDNWVDSSWRSWDDEMYRLRRGMFALLPLDNFGLRSSYPDPFDLMNRM--ENEIEEIRNRVGMSRVLGIGALNDFLK---------------------DAYEVGEDGKLYFKVHFDAKGFTPEDIKVDSTEHRLTVHAKKVSESDSSKSSREFCRMIELPQTIEHNQLKCRLTEDGVLMLEAPVKSPDYESI-----TFTDNRRLGIHPKSADQIQSVPASKALVVKGVSGPIILDDEVNGRRLHLEIPVDPVYKPEDLCVNVDSKRVVVSGISYQKDSGYFNKKSSSLYAEFTHSYEIPETVDPLLVTAQLIDNRLVLEA 351          
BLAST of Small heat shock protein p36 vs. Planmine SMEST
Match: SMESG000028601.1 (SMESG000028601.1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 3
Query:  252 MSSYRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADACKTQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEAIVY 1391
            MSSYRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADACKTQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEAIVY
Sbjct:    1 MSSYRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADACKTQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEAIVY 380          
BLAST of Small heat shock protein p36 vs. Planmine SMEST
Match: SMESG000033587.1 (SMESG000033587.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.830e-78
Identity = 149/390 (38.21%), Postives = 220/390 (56.41%), Query Frame = 3
Query:  261 YRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDRPNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKRSMFSLESDRDEMDF-NSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRMRDS---MQTRFVPTVNEK-----EKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNI-----VVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQEKVFADACKTQTMDRNQVIVK-RNTSGPVVLNDE-KGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVIDGTLIIEA 1382
            Y  EI+IPVN+D+R  E+RR+++FS LE   S    +EN  ++++ +            F +E       D WD ++ +W+  S+  WD +  ++KR +F LE      DF NS     SV  +           QKI + S+G  +   S     T   P  N +     +K ++  D + + YE   D  +HFK+R +   FKPED+KV    + + I      V  +  +  E  K+I +P S+D +KFQCH T DGILILEAP+K  +  S+  ++ +   A   +    +  +VK    SGPVV++D   GK++HLEI V+ DY P DFSV  EL +I +KGRHEVKT+NSSSFKEFS+YYE+PET+DPMS++F ++DGTL++EA
Sbjct:    2 YHQEITIPVNRDSRNFEQRRKDMFSKLESSVSTHTTSENKTVATKSQ------------FGHE-------DLWDLEIKDWVSKSKSSWDQDFAKIKRGLFDLEPIEGYGDFSNSDTTHHSVASYT----------QKIVT-SDGKTKTESSKSFHTTSGEPVQNLERQDYSQKCLTGTDFFKDAYEISDDKLVHFKVRLDTLGFKPEDLKVIAQDSKVTINARKETVTANQKSFKEFSKTITVPPSVDIKKFQCHQTNDGILILEAPIKQQENISVTLKDGLGVKAISDRHSTFSNSLVKVTGQSGPVVVDDAIYGKKIHLEIPVDKDYEPSDFSVYTELNQIHIKGRHEVKTANSSSFKEFSRYYEVPETLDPMSVSFHLLDGTLVVEA 361          
BLAST of Small heat shock protein p36 vs. Planmine SMEST
Match: SMESG000009940.1 (SMESG000009940.1)

HSP 1 Score: 54.299 bits (129), Expect = 9.664e-8
Identity = 59/263 (22.43%), Postives = 110/263 (41.83%), Query Frame = 3
Query:  759 SSEDSYHNFYEFGQDGELHFKIRFEAKNFKPEDIKVTCTGNNLNIVVEKS-------------DTNLVELHKSIVIPSSIDSQK-FQCHITQDGILILEAPVKSPDYNSIVP-------------QEKVFADACKTQTMDRNQVIVKRNTSG--------------------------PVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNS-SSFKEFSQYYEIPETIDPMSINFSVID-GTLIIEA 1382
            S E S    YE   +G++ +    +   F P DI++   GN L I  ++S             ++   E  K I +PS+ID +K  +   T++G+L +  P+    Y+++ P             Q+  F     T  +         +TSG                          PV++ D K K    EI ++  + P D ++  +  ++ +  +HE    N  ++ KEF+  +++P  +DP ++  ++ID G ++IEA
Sbjct:   18 SFERSIQPRYEKSTNGDVDYIFTVDVDGFSPSDIRIDQRGNMLAIEAKQSKSGSKKGVHGNTEESEYKEFKKEISLPSNIDMKKEMRSVYTENGLLEIRIPILPQTYSNLYPPIRRPITIQRQSPQQTTFN--ILTPQISSPVYSSSFSTSGMGHRTLNGSLSPFDCSSSSLRSSMRSPVLITD-KSKNYVEEIVIDPIFRPEDLNIKTKGYRVIISAKHEESGPNGYTNMKEFNDEHDLPSNVDPDNLKATLIDNGVVLIEA 277          
BLAST of Small heat shock protein p36 vs. Planmine SMEST
Match: SMESG000030562.1 (SMESG000030562.1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.492e-6
Identity = 45/201 (22.39%), Postives = 93/201 (46.27%), Query Frame = 3
Query:  840 NFKPEDIKV---TCTGNNLNIVVE---KSDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQE--------KVFADACK-----TQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVI-DGTLIIEA 1382
             ++P ++ +   T    N  I++    +S+ +  E+ K + IP ++D +  +  +++DG+LIL+AP K    + + P +         ++ +  +        +D + VIV+  T      N   G    L+  +  D+   +  +    K+I ++ R E KT N  S K  ++   IP+ ++   +   ++ DG LI+EA
Sbjct:   43 GYEPSEVAIKEETSNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVRPRTEFIADGNGVSG-TWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEA 242          
The following BLAST results are available for this feature:
BLAST of Small heat shock protein p36 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P12812|P40_SCHMA1.388e-4930.69Major egg antigen OS=Schistosoma mansoni OX=6183 P... [more]
sp|Q7YZT0|TSP36_TAESA1.087e-2829.17Small heat shock protein p36 OS=Taenia saginata OX... [more]
back to top
BLAST of Small heat shock protein p36 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183W2C53.471e-5531.43Uncharacterized protein OS=Trichobilharzia regenti... [more]
Q5DFS87.527e-5230.81Major egg antigen OS=Schistosoma japonicum OX=6182... [more]
A0A5J4N7G07.006e-5131.49Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A183NBG56.008e-5031.09Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A5K4F2D71.128e-4931.55Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small heat shock protein p36 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000028601.10.000e+0100.00SMESG000028601.1[more]
SMESG000033587.11.830e-7838.21SMESG000033587.1[more]
SMESG000009940.19.664e-822.43SMESG000009940.1[more]
SMESG000030562.12.492e-622.39SMESG000030562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014640 ID=SMED30014640|Name=Small heat shock protein p36|organism=Schmidtea mediterranea sexual|type=transcript|length=1659bp
CTCGATTTTCTCAAATGTGCATCGCATTTCCACTGTGCGATTTTCCACTG
AAACAGCGAATCAAAAAACGGTTGACGAATGAAAACTCTAATTTCATCAG
TGAAATTTGTTGTGCAGTTATTGAACTTATAAATAGGCGCATTTGTAGAT
ATCGATTGATCAGCACTGGCATTGCAGTTTTTTTTTTGGAATTTTTGGTG
AATTATTATCTATTTCTAACGTATCCATTTTTCATTGAAATCATTTTATA
AATGAGCTCCTACCGAACGGAAATAAGTATTCCAGTAAATAAAGACAACC
GAACGCTAGAAGAACGACGACAAAATGTATTTTCTGCTTTGGAAGAAAAA
TATTCGAAACCGAATGTGACAGAAAATACTAGAATAAGCAGCCGAGACCG
ACCGAATCTTTTAAACCGAATAAATCACGATACATTTTTTGATAATGAAA
AGTTCTTTAAATCAGACTTTGACAATTGGGATAGTGATGTATCTGAATGG
ATTCAGAATTCTAGAAAAAGATGGGATATGGAAATGGATAGAGTAAAAAG
ATCAATGTTCAGTTTAGAATCGGATCGAGACGAAATGGATTTTAATTCTT
GGGATCCTTTTCGATCAGTGAAAAGATTCAATGAGGACAGAGATTCAGAA
TTTCAAAGACAACAAAAAATTGCAAGTTGCAGCGAAGGAATAAAACGAAT
GCGAGATTCAATGCAAACCAGGTTTGTGCCTACTGTTAATGAAAAAGAAA
AGAATATTTCCAGCGAAGATTCATATCATAACTTTTATGAATTCGGTCAA
GATGGAGAATTACATTTCAAAATTCGTTTTGAAGCAAAGAATTTCAAACC
GGAAGATATCAAGGTGACTTGTACTGGAAATAATCTGAATATTGTCGTGG
AAAAGTCTGACACAAACTTAGTTGAGCTCCACAAATCTATTGTAATTCCC
AGTTCAATTGATTCACAGAAATTCCAATGCCACATCACTCAAGATGGCAT
TTTAATATTAGAAGCTCCAGTTAAATCCCCAGATTATAATAGTATAGTGC
CTCAAGAAAAAGTCTTTGCAGATGCATGTAAAACTCAAACAATGGATAGG
AATCAAGTAATCGTTAAAAGAAATACTTCTGGTCCAGTGGTTTTAAACGA
TGAAAAAGGTAAAAGACTTCACTTGGAAATCGCCGTAGAAAGTGATTATG
TGCCAGGAGACTTCTCTGTTACTGCAGAATTGAAGAAAATTTCTGTCAAA
GGACGACACGAAGTGAAAACCTCAAATAGTAGTTCATTTAAGGAGTTCTC
TCAATATTATGAAATTCCTGAAACTATAGATCCAATGTCTATTAATTTTA
GTGTAATTGACGGTACGCTAATTATTGAAGCCATTGTTTACTGAACCATA
GCTTCAATCAGTCATTGCCTAAATTGGAGTTTTCTTGAAATTCTCAATTT
TATAGAAAAACATTCAAACAATGCATATATTCATTTGTGTAGAATTTCAT
AATGCTTCATACTATTTTTCAATGATTTAATGTGTTGTCTTTATGTCGTT
TTTAGAGTAGAATAACACTAATAGAAGTTACATTTTGAACTTGTCAATCA
CTTTGTTAAGTTCGTAGAATGAAATATTTTACATTTTATTACAATAAACG
TTTAGAAAG
back to top

protein sequence of SMED30014640-orf-1

>SMED30014640-orf-1 ID=SMED30014640-orf-1|Name=SMED30014640-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MSSYRTEISIPVNKDNRTLEERRQNVFSALEEKYSKPNVTENTRISSRDR
PNLLNRINHDTFFDNEKFFKSDFDNWDSDVSEWIQNSRKRWDMEMDRVKR
SMFSLESDRDEMDFNSWDPFRSVKRFNEDRDSEFQRQQKIASCSEGIKRM
RDSMQTRFVPTVNEKEKNISSEDSYHNFYEFGQDGELHFKIRFEAKNFKP
EDIKVTCTGNNLNIVVEKSDTNLVELHKSIVIPSSIDSQKFQCHITQDGI
LILEAPVKSPDYNSIVPQEKVFADACKTQTMDRNQVIVKRNTSGPVVLND
EKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFS
QYYEIPETIDPMSINFSVIDGTLIIEAIVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR013809ENTH
IPR002068A-crystallin/Hsp20_dom
IPR008978HSP20-like_chaperone
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002068Alpha crystallin/Hsp20 domainPFAMPF00011HSP20coord: 318..377
e-value: 3.1E-4
score: 20.8
coord: 185..261
e-value: 1.2E-6
score: 28.6
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031SHSPcoord: 169..274
score: 10.25
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031SHSPcoord: 287..380
score: 11.006
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 174..258
e-value: 1.1E-52
score: 180.9
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 259..377
e-value: 1.1E-52
score: 180.9
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 181..258
NoneNo IPR availablePANTHERPTHR45640:SF8RE23625Pcoord: 300..377
coord: 83..273
NoneNo IPR availablePANTHERPTHR45640FAMILY NOT NAMEDcoord: 300..377
coord: 83..273
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 184..257
e-value: 2.0089E-12
score: 60.2263
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 301..377
e-value: 4.96578E-9
score: 50.5963