Ribose-phosphate pyrophosphokinase

Overview
NameRibose-phosphate pyrophosphokinase
Smed IDSMED30014636
Length (bp)1130
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribose-phosphate pyrophosphokinase (SMED30014636) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribose-phosphate pyrophosphokinase (SMED30014636) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribose-phosphate pyrophosphokinase (SMED30014636) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribose-phosphate pyrophosphokinase (SMED30014636) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014636

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014636h1SMcG0011339 dd_Smed_v4_8338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014636h1SMcG0011339 dd_Smed_v4_8338_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1 (phosphoribosyl pyrophosphate synthetase 1 [Source:HGNC Symbol;Acc:HGNC:9462])

HSP 1 Score: 327.405 bits (838), Expect = 1.369e-110
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS2 (phosphoribosyl pyrophosphate synthetase 2 [Source:HGNC Symbol;Acc:HGNC:9465])

HSP 1 Score: 325.479 bits (833), Expect = 9.402e-110
Identity = 169/316 (53.48%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++++ +R+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI++W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1 like 1 [Source:HGNC Symbol;Acc:HGNC:9463])

HSP 1 Score: 321.627 bits (823), Expect = 2.463e-108
Identity = 171/316 (54.11%), Postives = 233/316 (73.73%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N+ LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L IAGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+   I S     A+RV  +A++LNV F LI+ ERK+  E   I++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+ +    +VVTNTI QD+ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1 like 1 [Source:HGNC Symbol;Acc:HGNC:9463])

HSP 1 Score: 320.472 bits (820), Expect = 7.808e-108
Identity = 170/314 (54.14%), Postives = 232/314 (73.89%), Query Frame = 3
Query:   57 NIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N+ LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L IAGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+   I S     A+RV  +A++LNV F LI+ ERK+  E   I++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+ +    +VVTNTI QD+ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    3 NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Match: PRPS2 (phosphoribosyl pyrophosphate synthetase 2 [Source:HGNC Symbol;Acc:HGNC:9465])

HSP 1 Score: 320.087 bits (819), Expect = 1.108e-107
Identity = 169/319 (52.98%), Postives = 236/319 (73.98%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDN---NRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++++ +R+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD    +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI++W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHV 319          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211424:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 318.931 bits (816), Expect = 1.398e-107
Identity = 168/316 (53.16%), Postives = 231/316 (73.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR--EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L+ +I ER+ +++S+A+L KFSN E NV+I ESVRG+DVYI+QS   ++N++LMELLIMINACK ASS R+ AV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + +IK++I  W+   I S     A+RV  +A+RLNV F LI+ ERK     E++ +VG V  ++AI++ D+ DTC  I  +  KL+E GA  VY    HG+ S   +T ++ S    +VVTNTI QD+ ++K  KI C+D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKVFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7212735:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 318.931 bits (816), Expect = 1.398e-107
Identity = 168/316 (53.16%), Postives = 231/316 (73.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR--EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L+ +I ER+ +++S+A+L KFSN E NV+I ESVRG+DVYI+QS   ++N++LMELLIMINACK ASS R+ AV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + +IK++I  W+   I S     A+RV  +A+RLNV F LI+ ERK     E++ +VG V  ++AI++ D+ DTC  I  +  KL+E GA  VY    HG+ S   +T ++ S    +VVTNTI QD+ ++K  KI C+D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKVFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211442:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 318.931 bits (816), Expect = 1.398e-107
Identity = 168/316 (53.16%), Postives = 231/316 (73.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR--EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L+ +I ER+ +++S+A+L KFSN E NV+I ESVRG+DVYI+QS   ++N++LMELLIMINACK ASS R+ AV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + +IK++I  W+   I S     A+RV  +A+RLNV F LI+ ERK     E++ +VG V  ++AI++ D+ DTC  I  +  KL+E GA  VY    HG+ S   +T ++ S    +VVTNTI QD+ ++K  KI C+D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKVFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211436:7215226:1 gene:WBGene00020107.1 transcript:R151.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 318.931 bits (816), Expect = 1.398e-107
Identity = 168/316 (53.16%), Postives = 231/316 (73.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR--EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L+ +I ER+ +++S+A+L KFSN E NV+I ESVRG+DVYI+QS   ++N++LMELLIMINACK ASS R+ AV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + +IK++I  W+   I S     A+RV  +A+RLNV F LI+ ERK     E++ +VG V  ++AI++ D+ DTC  I  +  KL+E GA  VY    HG+ S   +T ++ S    +VVTNTI QD+ ++K  KI C+D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKVFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7212531:7215111:1 gene:WBGene00020107.1 transcript:R151.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 318.546 bits (815), Expect = 1.331e-106
Identity = 168/316 (53.16%), Postives = 231/316 (73.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR--EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L+ +I ER+ +++S+A+L KFSN E NV+I ESVRG+DVYI+QS   ++N++LMELLIMINACK ASS R+ AV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + +IK++I  W+   I S     A+RV  +A+RLNV F LI+ ERK     E++ +VG V  ++AI++ D+ DTC  I  +  KL+E GA  VY    HG+ S   +T ++ S    +VVTNTI QD+ ++K  KI C+D+S+I AEAIRR H GESVS L++++
Sbjct:   59 MPNIKVFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAILKYIKESIPNWQTSVIVSPDAGGAKRVTSIADRLNVDFALIHKERKRANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADKVYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHV 374          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0076415)

HSP 1 Score: 330.102 bits (845), Expect = 2.084e-111
Identity = 172/316 (54.43%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSG+S+  L ++I +R+GI L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  +IAI++ D+ DTC  I  +  +L+E GAT VY I THG+ S   ++ I+++    +VVTNTI QD +++   KI C+DVS++FAEA+RR H GESVS L++N+
Sbjct:   33 MPNIKVFSGTSHPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 348          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0345032)

HSP 1 Score: 330.102 bits (845), Expect = 2.084e-111
Identity = 172/316 (54.43%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSG+S+  L ++I +R+GI L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  +IAI++ D+ DTC  I  +  +L+E GAT VY I THG+ S   ++ I+++    +VVTNTI QD +++   KI C+DVS++FAEA+RR H GESVS L++N+
Sbjct:   33 MPNIKVFSGTSHPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 348          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0345034)

HSP 1 Score: 324.324 bits (830), Expect = 3.539e-109
Identity = 172/320 (53.75%), Postives = 236/320 (73.75%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD----NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSG+S+  L ++I +R+GI L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD     +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  +IAI++ D+ DTC  I  +  +L+E GAT VY I THG+ S   ++ I+++    +VVTNTI QD +++   KI C+DVS++FAEA+RR H GESVS L++N+
Sbjct:   33 MPNIKVFSGTSHPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 352          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0310662)

HSP 1 Score: 324.324 bits (830), Expect = 3.539e-109
Identity = 172/320 (53.75%), Postives = 236/320 (73.75%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD----NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSG+S+  L ++I +R+GI L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD     +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  +IAI++ D+ DTC  I  +  +L+E GAT VY I THG+ S   ++ I+++    +VVTNTI QD +++   KI C+DVS++FAEA+RR H GESVS L++N+
Sbjct:   33 MPNIKVFSGTSHPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 352          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Match: CG6767 (gene:FBgn0036030 transcript:FBtr0333856)

HSP 1 Score: 324.324 bits (830), Expect = 6.292e-109
Identity = 172/320 (53.75%), Postives = 236/320 (73.75%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD----NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSG+S+  L ++I +R+GI L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD     +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  +IAI++ D+ DTC  I  +  +L+E GAT VY I THG+ S   ++ I+++    +VVTNTI QD +++   KI C+DVS++FAEA+RR H GESVS L++N+
Sbjct:   48 MPNIKVFSGTSHPDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKANAQSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 367          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 325.865 bits (834), Expect = 4.409e-110
Identity = 168/316 (53.16%), Postives = 237/316 (75.00%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS++R+TAV+P  PY+RQ KKD +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCPKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 325.865 bits (834), Expect = 4.409e-110
Identity = 168/316 (53.16%), Postives = 237/316 (75.00%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS++R+TAV+P  PY+RQ KKD +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCPKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 325.865 bits (834), Expect = 4.409e-110
Identity = 169/316 (53.48%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI++W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GA  VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLVSAGAIKVYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 320.857 bits (821), Expect = 4.365e-108
Identity = 169/318 (53.14%), Postives = 236/318 (74.21%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD--NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD   +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI++W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GA  VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLVSAGAIKVYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 318          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 311.997 bits (798), Expect = 1.112e-104
Identity = 164/316 (51.90%), Postives = 233/316 (73.73%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS++R+TAV+P  PY+RQ KKD +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI   + S +  +AIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASATRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCPKIQVFEFSTL--KAIRRTHNGESVSYLFSHV 314          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: garem1 (GRB2 associated regulator of MAPK1 subtype 1 [Source:Xenbase;Acc:XB-GENE-976985])

HSP 1 Score: 327.791 bits (839), Expect = 9.246e-111
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++K+ ER+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  +++  KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQKVAERLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKQCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:394745])

HSP 1 Score: 324.709 bits (831), Expect = 1.787e-109
Identity = 168/316 (53.16%), Postives = 235/316 (74.37%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L      KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+ R+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  ++AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGRVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASACRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDKVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKIRHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:394745])

HSP 1 Score: 319.316 bits (817), Expect = 2.736e-107
Identity = 168/320 (52.50%), Postives = 235/320 (73.44%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNN----RVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L      KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+ R+TAV+P  PY+RQ KKD +    R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  ++AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGRVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASACRVTAVIPCFPYARQDKKDKSVTASRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDKVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKIRHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 320          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: rab10 (RAB10, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-5947409])

HSP 1 Score: 218.394 bits (555), Expect = 2.276e-67
Identity = 136/346 (39.31%), Postives = 202/346 (58.38%), Query Frame = 3
Query:   66 LFSGSSN---FLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKE--------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            LFS +SN     L ++I ER+G++L +  + +  N E  VQI+ESVRGKDV+I+Q+   DVN  +MELLIM+ AC+ + +  I+ V+PY PYS+Q K    R  I +KL+A ++  AG  H ITMDLH  +IQGFF++PVDNL + P  + +I++ I  +    I +   ++A+R    A RL +   +I+ E ++                                P+E+  I VVGDV  RIAII+ DIID  D   ++   L E GA  ++V+ATHG+LS      I++S I ++VVTNTI  +    +  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:   23 LFSANSNASCVELAKRIAERLGVELGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCAKTISGVIPYFPYSKQCKM-RKRGSIVSKLLASMMCKAGLTHFITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPSSAKRAQSFAERLRLGLAVIHGEAQDAESDMVDGRHSPPVVKNIGAAMHPSLEIPLMFPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFVAAADTLKERGAYKIFVMATHGLLSSEAPRLIEESTIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNI 367          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 202.216 bits (513), Expect = 3.772e-61
Identity = 135/344 (39.24%), Postives = 197/344 (57.27%), Query Frame = 3
Query:   63 RLFSGSSN---FLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERK-----------------------------EPREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            R+FS +S+     L +KI ER+G +L +A + + SN E  V+IKESVRG +++I+Q+   DVN  +MELLIM  A K + ++ I  V+PY PYS+QSK    R  I  KL+A ++  AG  HIITMDLH  +IQGFF+ PVDNL + P  + +I+  I  ++   I +     A+R    A RL +   +I+ E +                              P+E+  I +VGDV  +IAII+ DIID  +   ++   L E GA  VY +ATHG+LS      ++ S I ++VVTNTI  +   Q+  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:   17 RVFSANSSEACMELAKKITERLGAELGKAVVYQESNGETRVEIKESVRGHNIFIIQTIPRDVNTAIMELLIMAYALKTSCANSIIGVIPYFPYSKQSKM-RKRGSIVCKLLASMMSDAGLTHIITMDLHQKEIQGFFNFPVDNLRASPFLLQYIQDEIQNYKNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEPQCAELDMVDGRHSPPTVKNTVHKGLEIPLMMPKEKPPISLVGDVHGKIAIIVDDIIDEVESFVAAADILKERGAFKVYAMATHGILSSDAPRLLELSAIDEVVVTNTIPHELQKQQCSKIRTVDISLILSEAIRRIHNGESMSYLFRNI 359          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1l3 (phosphoribosyl pyrophosphate synthetase 1-like 3 [Source:MGI Symbol;Acc:MGI:3779453])

HSP 1 Score: 327.791 bits (839), Expect = 7.894e-111
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MSNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:MGI Symbol;Acc:MGI:97775])

HSP 1 Score: 327.405 bits (838), Expect = 9.396e-111
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps1l1 (phosphoribosyl pyrophosphate synthetase 1-like 1 [Source:MGI Symbol;Acc:MGI:1922706])

HSP 1 Score: 326.635 bits (836), Expect = 1.928e-110
Identity = 174/316 (55.06%), Postives = 233/316 (73.73%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI+LFSGSS+  L++KI ER+G++LS+    KFSN E  V+I ESVRG+DVYI+QSG  ++N+ LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L IAGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NIS W   TI S     A+RV  +A+ LNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   +  I+ +    +VVTNTI Q+  +++  KI  +D+++I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKLFSGSSHQDLSQKITERLGLELSKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDIAMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prps2 (phosphoribosyl pyrophosphate synthetase 2 [Source:MGI Symbol;Acc:MGI:97776])

HSP 1 Score: 324.709 bits (831), Expect = 1.053e-109
Identity = 169/316 (53.48%), Postives = 234/316 (74.05%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++++ +R+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI++W    I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+ +    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINSAAFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Match: Prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:MGI Symbol;Acc:MGI:2384838])

HSP 1 Score: 220.705 bits (561), Expect = 2.498e-68
Identity = 137/345 (39.71%), Postives = 203/345 (58.84%), Query Frame = 3
Query:   66 LFSGSSN---FLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKE-------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            LFS +SN     L++KI ER+G+++ +  + +  N E  VQI+ESVRGKDV+I+Q+   DVN  +MELLIM+ ACK + +  I  V+PY PYS+Q K    R  I +KL+A ++  AG  H+ITMDLH  +IQGFF++PVDNL + P  + +I++ I  +    I +    +A+R    A RL +   +I+ E ++                               P+E+  I VVGDV  RIAII+ DIID  D   ++ + L E GA  ++V+ATHG+LS      I++S I ++VVTNTI  +    +  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:   22 LFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKM-RKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNI 365          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q7ZXC9|PRPS2_XENLA (Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis OX=8355 GN=prps2 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.535e-111
Identity = 171/316 (54.11%), Postives = 238/316 (75.32%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++K+ ER+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+  +I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI QD+ +++  KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQKVAERLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIPEWKNSSIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQDEKMKQCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q4R4U3|PRPS1_MACFA (Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis OX=9541 GN=PRPS1 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.572e-110
Identity = 171/316 (54.11%), Postives = 237/316 (75.00%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S  +++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPVISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q5XGI0|PRPS2_XENTR (Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis OX=8364 GN=prps2 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 4.898e-110
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++K+ ER+G++L +    KFSN E +V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  +++  KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHQDLSQKVAERLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKQCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|P60892|PRPS1_RAT (Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus OX=10116 GN=Prps1 PE=1 SV=2)

HSP 1 Score: 327.405 bits (838), Expect = 6.572e-110
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Match: sp|Q5RFJ7|PRPS1_PONAB (Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii OX=9601 GN=PRPS1 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.572e-110
Identity = 171/316 (54.11%), Postives = 236/316 (74.68%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WI++NIS+W   TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: M1S1T0 (Phosphoribosyl pyrophosphate synthetase 1 OS=Dugesia japonica OX=6161 GN=PRPS1 PE=2 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 274/314 (87.26%), Postives = 298/314 (94.90%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPREQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            MLNIRLFSGSSN LLTEKIGERIGIKLSEA LNKFSNNE +VQIKESVRGKDV+ILQSGYI VNNHLMELLIMINACKNASS+RITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFF+VPVDNLLSEPC ISWIKKNISKWEEITIFSL V++AERVA+MAN + VRFGLIY+ERKE  EQIIV+GDVVSR A+I LDIID CDL+ SSVK+LMEVGA+GVYVIATHGMLSERLM E+DDS I++LVVTNTICQ+KYV++S+KITCLDVS+IFAEAIRR+H+GESVSCLYNNL
Sbjct:    1 MLNIRLFSGSSNVLLTEKIGERIGIKLSEAILNKFSNNETSVQIKESVRGKDVFILQSGYIGVNNHLMELLIMINACKNASSARITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFNVPVDNLLSEPCHISWIKKNISKWEEITIFSLSVSSAERVANMANTIKVRFGLIYVERKEASEQIIVIGDVVSRTAVIFLDIIDNCDLVISSVKRLMEVGASGVYVIATHGMLSERLMKEVDDSIITKLVVTNTICQEKYVKQSDKITCLDVSVIFAEAIRRIHYGESVSCLYNNL 314          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A7M6E2 (Ribose-phosphate pyrophosphokinase I OS=Dugesia ryukyuensis OX=79738 PE=2 SV=1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 275/314 (87.58%), Postives = 298/314 (94.90%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPREQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            MLNIRLFSGSSN LLTEKIGERIGIKLSEA LNKFSNNE +VQIKESVRGKDV+ILQSGYIDVNNHLMELLIMINACKNASS+RITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFF+VPVDNLLSE C ISWIKKNISKWEEITIFSL+VT+AERVA+MAN L VRFGLIY+E+KE  EQII+VGDVVSRIA+ILLDIID CDL+ SSVK+L EVGA GVYVIATHGMLSERLM E+DDS I++LVVTNTICQ+KYV++S+KI CLDVS+IFAEAIRR+H+GESVSCLYNNL
Sbjct:    1 MLNIRLFSGSSNILLTEKIGERIGIKLSEAILNKFSNNETSVQIKESVRGKDVFILQSGYIDVNNHLMELLIMINACKNASSARITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFNVPVDNLLSESCHISWIKKNISKWEEITIFSLNVTSAERVANMANTLKVRFGLIYVEKKEASEQIILVGDVVSRIAVILLDIIDNCDLVISSVKRLKEVGAAGVYVIATHGMLSERLMKEVDDSIITKLVVTNTICQEKYVKQSDKIACLDVSVIFAEAIRRIHYGESVSCLYNNL 314          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A0F6MV49 (Ribose-phosphate pyrophosphokinase 1 OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.349e-113
Identity = 177/316 (56.01%), Postives = 234/316 (74.05%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSSN+ L ++I + IGIKL  AN  KFSN E  V++ ESVRG+DVYI+Q+G  +VN+HLMELLIMINACK ASS R+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  I WI+KNI  W+E  I S     A+RV  +A++LNV F LI+ ERK   E  ++++VGDV  R AI++ D+ DTC  I ++ ++L E GAT VY I THG+ S   +  I+ S    +VVTNTI Q + ++K+ K+ C+D+S + AEAIRR H GESVS L+N++
Sbjct:    1 MPNIKVFSGSSNYDLAKRITDHIGIKLGMANSKKFSNQETCVEVIESVRGEDVYIIQTGSGEVNDHLMELLIMINACKIASSCRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVIRWIQKNIPDWQECCIVSPDAGGAQRVTSLADQLNVDFALIHKERKRANEVDRMVLVGDVKGRAAILVDDMADTCGTICTAAQRLTEAGATRVYAICTHGIFSGPAIERINKSCFEAVVVTNTIDQKENMKKAPKLQCIDISTVLAEAIRRTHNGESVSYLFNHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A0X3PLP2 (Pribosyltran_N domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS8105 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.349e-113
Identity = 178/316 (56.33%), Postives = 234/316 (74.05%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSSN+ L ++I + IGIKL  AN  KFSN E  V++ ESVRG+DVYI+Q+G  +VN+HLMELLIMINACK ASS R+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  I WI+KNI  W+E  I S     A+RV  +A++LNV F LI+ ERK   E  ++++VGDV  R AI++ D+ DTC  I ++ ++L E GAT VY I THG+ S   +  I+ S    +VVTNTI Q + ++K+ K+ C+DVS + AEAIRR H GESVS L+N++
Sbjct:    1 MPNIKVFSGSSNYDLAKRITDHIGIKLGLANSKKFSNQETCVEVIESVRGEDVYIIQTGSGEVNDHLMELLIMINACKIASSCRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVIRWIQKNIPDWQECCIVSPDAGGAKRVTSLADQLNVDFALIHKERKRANEVDRMVLVGDVKGRAAILVDDMADTCGTICTAAQRLTEAGATRVYAICTHGIFSGPAIERINKSCFEAVVVTNTIDQKENMKKAPKLQCIDVSTVLAEAIRRTHNGESVSYLFNHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Match: A0A4Y2IFD2 (Ribose-phosphate pyrophosphokinase 2 OS=Araneus ventricosus OX=182803 GN=prps2 PE=3 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.883e-112
Identity = 174/316 (55.06%), Postives = 240/316 (75.95%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L +K+ +R+GI L +  L KFSN E +V+I ESVRG+DVYI+QSG  +VN++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W   +I S     A+RV  +A+RLNV F LI+ ERK+  E   +++VGDV  R+AI++ D+ DTC  I  + +KLME GA+ VY I THG+ S   ++ I+++    +VVTNTI Q++++++  K+ C+DVS+I AEAIRR H GESVS L++N+
Sbjct:    1 MPNIKVFSGSSHVDLAQKVVDRLGIDLGKVVLKKFSNQETSVEIGESVRGEDVYIIQSGCGEVNDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWRNSSIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVTDRVAILVDDMADTCGTICHAAEKLMEAGASKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEQHMKECPKVQCIDVSMILAEAIRRTHNGESVSYLFSNV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:103045742])

HSP 1 Score: 327.02 bits (837), Expect = 1.116e-110
Identity = 169/316 (53.48%), Postives = 237/316 (75.00%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  +  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKTCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCPKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1a (ribose-phosphate pyrophosphokinase 1-like [Source:NCBI gene;Acc:103031347])

HSP 1 Score: 321.242 bits (822), Expect = 2.555e-108
Identity = 171/318 (53.77%), Postives = 236/318 (74.21%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD--NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G +L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD   +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI++W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGQELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLVSAGATKVYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCNKIQVIDISMILAEAIRRTHNGESVSYLFSHV 318          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prps1a (ribose-phosphate pyrophosphokinase 1-like [Source:NCBI gene;Acc:103031347])

HSP 1 Score: 289.656 bits (740), Expect = 3.227e-96
Identity = 155/289 (53.63%), Postives = 213/289 (73.70%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD--NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKI 905
            M NI++FSGSS+  L++KI +R+G +L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD   +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI++W+  TI S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q+  ++   KI
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGQELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENINEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLVSAGATKVYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCNKI 289          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: ENSAMXT00000048420.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:17120081:17135483:1 gene:ENSAMXG00000029524.1 transcript:ENSAMXT00000048420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.677 bits (644), Expect = 7.951e-82
Identity = 147/316 (46.52%), Postives = 207/316 (65.51%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++K+ +R+G+ L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD  R      L+  L                 Q  GFFD+ VDNL +EP  + WI++NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GA  VY I THG+ S   ++ I+++    +VVTNTI Q++ +++  KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHHDLSQKVADRLGLDLGKVITKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVR-----NLLKPL---------------NQQRPGFFDIAVDNLYAEPAVLQWIRENIPEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLISAGAIKVYAILTHGIFSGPAISRINNAPFEAVVVTNTIPQEEKMKQCPKIQVIDISMILAEAIRRTHNGESVSYLFSHV 296          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:NCBI gene;Acc:103041258])

HSP 1 Score: 216.468 bits (550), Expect = 5.262e-67
Identity = 133/340 (39.12%), Postives = 202/340 (59.41%), Query Frame = 3
Query:   72 SGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKE-------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            S  S+  L ++I ER+G++L +  + + +N E  VQI+ESVRGKDV+I+Q+   DVN  +MELLIM+ AC+ + +  I  V+PY PYS+Q K    R  I +KL+A ++  AG +H+ITMDLH  +IQGFF++PVDNL + P  + +I++ I  +    I +   ++A+R    A RL +   +I+ E ++                               P+E+  I VVGDV  RIAII+ DIID  D   ++ + L E GA  ++V+ATHG+LS      I++S I ++VVTNTI  +    +  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:   15 SNPSSRELGKRIAERLGVELGKVQVYQEANRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCARNIIGVIPYFPYSKQCKM-RKRGSIVSKLLASMMCKAGLSHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPSSAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPTVKNMGAIHPSLEIPLLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGILSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNI 353          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Sea Lamprey
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 196.823 bits (499), Expect = 2.444e-60
Identity = 129/332 (38.86%), Postives = 185/332 (55.72%), Query Frame = 3
Query:  114 RIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAH---MANRLNVRFGLIYIERKE----------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            R+   L +A + +  N E  V I++SVRGKDV+I+Q+   DVN  +MELLIM  ACK +++  I  V+PY PYS+ SK    R  I  KL+A +L  AG  H+ITMDLH  +IQGFF++PVDNL + P  I +I+  I  +    I +   ++A+R       A RL +   +I+ E ++                                  P+E+  I VVGDV  RIAII+ DIID       + + L E GA  +YV+ATHG+LS      I++S I ++VVTNTI  +    +  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:    1 RLSTDLGKAQVYQEPNRETRVHIQQSVRGKDVFIIQTCPRDVNTAVMELLIMTYACKTSAARNIIGVVPYFPYSKHSKM-RKRGSIVCKLLASMLCKAGMTHLITMDLHQKEIQGFFNIPVDNLRASPFLIQYIQDEIPDYRNAVIVAKSPSSAKRRGRAQSFAERLRLAMAVIHGEAQDAESDMDDGRHSPPPIVMKNSSSAIHPVLELPLMMPKEKPPITVVGDVGGRIAIIVDDIIDDVHSFVMAAETLKERGAYKIYVMATHGLLSSDAPRLIEESPIHEVVVTNTIPHEVQKLQCHKIKTVDISMIVSEAIRRIHNGESMSYLFRNI 331          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS4 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS4 has a paralog, PRS2, that arose from the whole genome duplication; a missense mutation in the conserved residue R196 of its human homolog PRPS1 is pathogenic [Source:SGD;Acc:S000000164])

HSP 1 Score: 258.84 bits (660), Expect = 1.084e-84
Identity = 142/315 (45.08%), Postives = 220/315 (69.84%), Query Frame = 3
Query:   57 NIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGY--IDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNN 989
            +I+L +G+S+  L E+I +++GI LS+  + ++SN E +V I ES+R +DVYI+Q+G    ++N+ LMELLI+I+ACK AS+ +IT V+P  PY+RQ KKD +R PITAKLVA+LL  AGA+H+ITMDLHASQIQGFF +PVDNL +EP  +++I+   + ++   + S     A+RVA +A++L++ F LI+ ER++  E  ++++VGDV ++  +++ D+ DTC  +  +   LME GA  V  I THG+ S     ++ +S +S++V TNT+  D  +  +++I   D+S  FAEAIRR+H GESVS L+ +
Sbjct:   13 SIKLLAGNSHPDLAEQISKKLGIPLSKVGVYQYSNKETSVTIGESLRDEDVYIIQTGIGEQEINDFLMELLILIHACKIASARKITTVIPNFPYARQDKKDKSRAPITAKLVANLLQTAGADHVITMDLHASQIQGFFHIPVDNLYAEPSVLNYIRTK-TDFDNAILVSPDAGGAKRVAALADKLDLNFALIHKERQKANEVSKMVLVGDVTNKSCLLVDDMADTCGTLVKACDTLMEHGAKEVIAIVTHGIFSGSAREKLRNSRLSRIVCTNTVPVDLDLPIADQI---DISPTFAEAIRRLHNGESVSYLFTH 323          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS3 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes [Source:SGD;Acc:S000001003])

HSP 1 Score: 256.144 bits (653), Expect = 9.826e-84
Identity = 140/314 (44.59%), Postives = 215/314 (68.47%), Query Frame = 3
Query:   57 NIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYIL-QSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNN 989
            +I+L +   +  L E + +R+G++L+ + L +    E++  I ESVR +D++I+ Q G   VN+ ++ELLIMINA K AS+ RITA++P  PY+RQ +KD +R PITAKL+AD+L  AG +H+ITMDLHASQIQGFFDVPVDNL +EP  + +IK+N++  + I I S     A+R A +A+RL++ F LI+ ER    E  ++++VGDV  +I II+ D+ DTC  +  + + L+E  A  V  I THG+LS R +  I++S + ++V TNT+  ++ ++K  K+  +D+S + AE+IRR+H GES+S L+ N
Sbjct:    5 SIKLLAPDVHRGLAELVAKRLGLQLTSSKLKRDPTGEVSFSIGESVRDQDIFIITQIGSGVVNDRVLELLIMINASKTASARRITAIIPNFPYARQDRKDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDVPVDNLYAEPSVVRYIKENVNYMDSI-IISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKICIIVDDMADTCGTLAKAAEILLENRAKSVIAIVTHGVLSGRAIENINNSKLDRVVCTNTVPFEEKIKKCPKLAVIDISSVLAESIRRLHNGESISYLFKN 317          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS2 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS2 has a paralog, PRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000000901])

HSP 1 Score: 254.218 bits (648), Expect = 5.213e-83
Identity = 140/315 (44.44%), Postives = 214/315 (67.94%), Query Frame = 3
Query:   57 NIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYID--VNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNN 989
            +I+L +G+S+  L E I +R+G+ LS+  + ++SN E +V I ES+R +DVYI+Q+GY +  +N+ LMELLI+I+ACK AS  RITAV+P  PY+RQ KKD +R PITAKL+A+LL  AG +H+ITMDLHASQIQGFF +PVDNL  EP  +++I+   + +    + S     A+RVA +A++L++ F LI+ ER++  E  ++++VGDV  +  +++ D+ DTC  +  +   LM+ GA  V  I THG+ S     ++ +S +S++V TNT+  D  +   +++   D+S   AEAIRR+H GESVS L+ +
Sbjct:    5 SIKLLAGNSHPGLAELISQRLGVPLSKVGVYQYSNKETSVTIGESIRDEDVYIIQTGYGEHEINDFLMELLILIHACKTASVRRITAVIPNFPYARQDKKDKSRAPITAKLIANLLETAGCDHVITMDLHASQIQGFFHIPVDNLYGEPSVLNYIRTK-TDFNNAILVSPDAGGAKRVASLADKLDMNFALIHKERQKANEVSRMLLVGDVAGKSCLLIDDMADTCGTLVKACDTLMDHGAKEVIAIVTHGIFSGSAREKLINSRLSRIVCTNTVPVDLDLDIVDQV---DISPTIAEAIRRLHNGESVSYLFTH 315          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS1 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; plays a key role in cell wall integrity (CWI) pathway; one of five related enzymes, which are active as heteromultimeric complexes; missense mutations in human homolog PRPS1 are associated with neuropathic Arts syndrome and Charcot-Marie Tooth (CMTX5) disease [Source:SGD;Acc:S000001664])

HSP 1 Score: 188.734 bits (478), Expect = 2.173e-56
Identity = 84/201 (41.79%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE 653
            M   ++F G+S+  L   + +R+GI+ +   L KF+N E +VQI  SVR +DVY++QSG   +N+ +MELLI+++AC+  S+ +ITAV+P  PYS+Q K   +R  ITA+++A+LL +AGA+H+++MDLHASQ+QGFF  PVDNL   P    WI++N+  +E+  + S +    +RV  +A+ L + F +I+ +R+  ++
Sbjct:    1 MRKCKIFVGNSHPELGNMVCQRLGIEPAPCTLKKFANGETSVQIGVSVRDEDVYVIQSGSPSINDDIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKRHRGAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVEDYEDAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRSKD 201          

HSP 2 Score: 71.633 bits (174), Expect = 3.525e-14
Identity = 53/121 (43.80%), Postives = 79/121 (65.29%), Query Frame = 3
Query:  648 REQII-VVGDVVSRXXXXXXXXXXXXXXXFSSVKKLME-VGATGVYVIATHGMLSERLMTEIDDS-FISQLVVTNTI-CQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNLQS 998
            REQ+I +VG+V  R AIIL D+ID      S+ + L++  GA  VYV+ATHG+ +   + E++ S  I  +VVTNT     + +  S+K+  +DVS IFAE IRR H+GES+S L+++L +
Sbjct:  306 REQLITLVGNVRGRSAIILDDMIDRPGSFISAAEHLVQNCGAKKVYVVATHGIFTGDCLEELEKSDAIDTIVVTNTYPISGERIAGSKKLVTIDVSPIFAECIRRDHYGESISVLFDSLAA 426          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Match: PRS5 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000005422])

HSP 1 Score: 111.309 bits (277), Expect = 1.703e-27
Identity = 58/110 (52.73%), Postives = 76/110 (69.09%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAK 380
            M NI +F G S+  L  KI E + I  S+  L KFSN E N+ ++ESVR KDVYI+QSG   VN+  M+LLI+I+ACK+AS+SR+TAV+PY+ YSRQ       +P TAK
Sbjct:    3 MSNIVVFGGDSHPELVTKICENLDIHPSKVELGKFSNGETNIALRESVREKDVYIIQSGCGQVNDTFMQLLILISACKSASASRVTAVMPYLCYSRQPD-----IPYTAK 107          

HSP 2 Score: 84.3445 bits (207), Expect = 2.197e-18
Identity = 58/190 (30.53%), Postives = 95/190 (50.00%), Query Frame = 3
Query:   81 SNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHL-MELLIMINACK--NASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERK 641
            S+ L+T++ G    +K    +L+    + IN++  + +R  +     +   D+   L    + MI   K  N S+S     L    ++ Q+      V     L+A LL  AGA+H+ITMDLH  Q  GFFD+PVDNL  +P   ++I+  I  +++  I S     A+R   +A+ L + F LI+ ER+
Sbjct:  130 SSSLMTQRPGAESSLK----SLDSAIRSTINLENPQPIRTPNSSATANNNFDIKKTLSFSRIPMIPGGKLQNTSNSTDAGEL----FNAQNAGYKLWVVQAGTLIAHLLSAAGADHVITMDLHDPQFPGFFDIPVDNLYCKPIAQNYIQHRIPDYQDAVIVSPDAGGAKRATAIADALELSFALIHKERR 311          

HSP 3 Score: 70.0922 bits (170), Expect = 1.263e-13
Identity = 44/113 (38.94%), Postives = 73/113 (64.60%), Query Frame = 3
Query:  651 EQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQ--KSEKITCLDVSIIFAEAIRRMHFGESVSCLY 983
            +  ++VGDV +++ II+ D++DT   I  + K L + G+T VY + THG+ S   +  I  S I +L+++NT+ QD+ +Q    +++  +DVS I  EAIRR+H GES+S L+
Sbjct:  380 QTTMLVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGSTKVYALITHGVFSGDALERIGQSSIDKLIISNTVPQDRTLQYLGKDRVDVIDVSCIIGEAIRRIHNGESISMLF 492          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Match: EDO47117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC7])

HSP 1 Score: 315.079 bits (806), Expect = 2.149e-106
Identity = 166/316 (52.53%), Postives = 221/316 (69.94%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++F GSS+ +L   I ER+G  L++  L KFSN E  V+I ESVRG+DVYI+QSG  ++N+++MELLIMINACK AS+ R+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+N+  W+   I S     A+RV  +A+ LN  F LI+ ERK   E   +++VGDV  R AI++ DI DTC  +  +  KL E GA  VY I THG+ S   +  +D S I  + +TN+I Q+  +Q   KI  +DVS+I AEAIRR H GESVS L+ ++
Sbjct:    1 MPNIKIFGGSSHPVLARLIAERLGFDLAKCVLKKFSNQETCVEIAESVRGEDVYIIQSGCGEINDNMMELLIMINACKIASAQRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENVHDWQNSVIVSPDAGGAKRVTSIADHLNCGFALIHKERKVANEVASMVLVGDVKDRTAILVDDIADTCGTLTLAATKLNEAGAAKVYAICTHGVFSGPALKRLDGSIIEAVAITNSIPQEAKMQMCSKIRSVDVSMILAEAIRRTHNGESVSYLFTHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Match: EDO48023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP7])

HSP 1 Score: 207.608 bits (527), Expect = 7.444e-64
Identity = 131/354 (37.01%), Postives = 200/354 (56.50%), Query Frame = 3
Query:   57 NIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYID---VNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKE-------------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
             + +FS ++   L+E I  R+G+  +  ++ +F+N E  V I  SVRG+DV+I+Q+G  +    NN +MELLIM  AC+ AS+ RI  V+PY+PYS+QSK  + R  I AKL+A LL  +G   IITMDLH+ +IQGF+D+PVDNL + P  + +I +++       I + +  +A+R    A RL +   +I+ E+KE                                     P+E+  + VVGDV  +IAII+ D+ID       + + L + GA  +YV+ THG+LS      I+ S I ++VVTNT+  D  V +  KI  +D+S + AEA+RR+H GES+  L+ N+
Sbjct:    9 GVLVFSLNTAKELSESIARRLGVLPAPVHVGQFANKESKVHIGVSVRGRDVFIIQTGQGEETTCNNAMMELLIMAYACRIASARRIVGVIPYLPYSKQSKM-HKRGAIPAKLMASLLGKSGLTSIITMDLHSKEIQGFYDIPVDNLRASPFIVHYINESVPDCRNAVIVAKNPASAQRATSFAERLRLGIAVIHGEQKESEGDQCDGRQSPPPKPENSIGFNFVPLENELNVPGFLPKEKPPMNVVGDVGGKIAIIVDDMIDDATTFVDAARLLRDRGAYKIYVMVTHGLLSGSAPELIEGSEIDEVVVTNTVPHDSKVARCSKIKTIDISQLLAEAVRRIHNGESMGYLFRNV 361          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Match: EDO27332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9J2])

HSP 1 Score: 75.0998 bits (183), Expect = 7.396e-16
Identity = 52/134 (38.81%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  591 MANRLNVRFGLIYIERKEPREQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            + N LNV     ++ +++P   + VVGDV  +IAII+ D+ID       + + L + GA  +YV+ THG+LS      I+ S I ++VVTNT+  D  V +  KI  +D+S + AEA+RR+H GES+  L+ N+
Sbjct:   68 LENELNVPG---FLPKEKP--PMNVVGDVGGKIAIIVDDMIDDATTFVDAARLLRDRGAYKIYVMVTHGLLSGSAPELIEGSEIDEVVVTNTVPHDSKVARCSKIKTIDISQLLAEAVRRIHNGESMGYLFRNV 196          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: ENSORLT00000008371.2 (ribose-phosphate pyrophosphokinase 2 [Source:NCBI gene;Acc:101173845])

HSP 1 Score: 322.013 bits (824), Expect = 1.050e-108
Identity = 170/316 (53.80%), Postives = 233/316 (73.73%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI LFSGSS+  L++K+ +R+G+ L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK ASSSR+TAV+P  PY+RQ KKD +R PI+AKLVA++L +AGA+HIITMDLHASQIQGFFD+ VDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+E GA  VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIVLFSGSSHHDLSQKVADRLGLDLGKVTTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIAVDNLYAEPAVLQWIKENIPEWKNCIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICFAADKLIEAGALKVYAILTHGIFSGPAISRINNAPFEAVVVTNTIPQEEKMKACPKIQVIDISMILAEAIRRTHNGESVSYLFSHV 316          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:101169709])

HSP 1 Score: 320.087 bits (819), Expect = 6.689e-108
Identity = 169/318 (53.14%), Postives = 236/318 (74.21%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD--NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD   +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI  +D+S+I AEAIRR H GESVS L++++
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNCIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVTDRVAILVDDMADTCGTICHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHV 318          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1 [Source:NCBI gene;Acc:101169709])

HSP 1 Score: 289.271 bits (739), Expect = 3.985e-96
Identity = 153/289 (52.94%), Postives = 213/289 (73.70%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKD--NNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKI 905
            M NI++FSGSS+  L++KI +R+G++L +    KFSN E  V+I ESVRG+DVYI+QSG  ++N++LMELLIMINACK AS+SR+TAV+P  PY+RQ KKD   +R PI+AKLVA++L ++GA+HIITMDLHASQIQGFFD+PVDNL +EP  + WIK+NI +W+   I S     A+RV  +A+RLNV F LI+ ERK+  E  ++++VGDV  R+AI++ D+ DTC  I  +  KL+  GAT VY I THG+ S   ++ I+++    +VVTNTI Q++ ++   KI
Sbjct:    1 MPNIKIFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVSGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNCIIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVTDRVAILVDDMADTCGTICHAADKLISAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCSKI 289          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: prpsap2 (phosphoribosyl pyrophosphate synthase-associated protein 2 [Source:NCBI gene;Acc:101168959])

HSP 1 Score: 217.238 bits (552), Expect = 3.369e-67
Identity = 133/340 (39.12%), Postives = 202/340 (59.41%), Query Frame = 3
Query:   72 SGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKE-------------------------------PREQ--IIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            S +S+  L ++I ER+G++L +  + + +N E  VQI+ESVRGKDV+++Q+   DVN  +ME+LIM+ AC+ + +  IT VLPY PYS+Q K    R  I +KL+A ++  AG  H+ITMDLH  +IQGFF++PVDNL + P  + +I++ I  +    I +    +A+R    A RL +   +I+ E ++                               P+E+  I VVGDV  RIAII+ DIID  D   ++ + L E GA  ++V+ATHG+LS      I++S I ++VVTNTI  +    +  KI  +D+S+I +EAIRR+H GES+S L+ N+
Sbjct:   15 SHASSRELGKRIAERLGVELGKVQVYQEANRETRVQIQESVRGKDVFVIQTVSKDVNTTIMEMLIMVYACRTSCARSITGVLPYFPYSKQCKM-RKRGSIVSKLMASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDQVDGRHSPPTVKTTGAIHPSMEIPLLIPKEKPPISVVGDVGGRIAIIVDDIIDDVDSFVAAAETLKERGAYKIFVMATHGLLSCEAPRFIEESAIDEVVVTNTIPHELQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNI 353          
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Match: ENSORLT00000046014.1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101162980])

HSP 1 Score: 212.231 bits (539), Expect = 4.797e-65
Identity = 135/345 (39.13%), Postives = 199/345 (57.68%), Query Frame = 3
Query:   63 RLFSGSSNFLLTE---KIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIE-----------RKEP---------------------REQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            R+FS +S    TE   KI ER+G++L ++ + + SN+E  V +KESVRG+DV+I+Q+   DVN  +MELL+M  A K+A +  I  V+PY PYS+Q K    R  +  KL+A +L  AGA+H+ITMDLH  +IQGFF  PVDNL + P  I +I++ I  +    I +   + A+R    A RL +   +++ +           R  P                     +  I VVGDV  RIAI++ DIID  +   ++ + L E GA  +Y++ATHG+LS      I++S I ++VVTNT+  +    +  KI  +DVS+I AEAIRR+H GES+S L+ N+
Sbjct:   37 RVFSANSTPASTELAKKITERLGVELGKSVVFQESNSETKVDLKESVRGQDVFIIQTIPRDVNTAIMELLVMTYALKSACARNIIGVVPYFPYSKQCKL-RKRGSVVCKLLASMLAKAGASHVITMDLHQKEIQGFFSFPVDNLRASPFLIQYIQEEIPDYRNAVIVAKSPSAAKRAQSFAERLRLGLAVMHGDAHHSESDMTDGRNSPPSTRTTAGHTGLELPLMMAKEKPPISVVGDVGGRIAIVVDDIIDDVEDFVAAAEALKERGAYKIYIMATHGLLSAEAPRLIEESAIDEVVVTNTVPHEVQKLQCSKIKTVDVSMILAEAIRRIHNGESMSYLFRNI 380          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000008469.1 (SMESG000008469.1)

HSP 1 Score: 270.011 bits (689), Expect = 1.625e-89
Identity = 131/214 (61.21%), Postives = 165/214 (77.10%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSR 686
            M NI++F+GSSN  L +KI ERIGIKL +    KFSN E  V+I+ESVRG+DVYI+Q+G  +VN++LMELLIMINACKNAS+SRITAV+P  PY+RQ KKD +R PI+AKLVA++L +AGANHIITMDLHASQIQGFFD+PVDNL +EP  + WIK NI  W +  I S     A+RV  +A+ LNV F LI+ ERK+  E  ++++VGDV  R
Sbjct:    1 MPNIKVFAGSSNTSLAQKISERIGIKLGDVISKKFSNEETCVEIRESVRGEDVYIIQTGSGEVNDNLMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLSVAGANHIITMDLHASQIQGFFDIPVDNLYAEPAVVRWIKDNIPDWNQCAIVSPDAGGAKRVTAIADHLNVDFALIHKERKKANEVDRMVLVGDVRDR 214          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000008493.1 (SMESG000008493.1)

HSP 1 Score: 268.855 bits (686), Expect = 4.612e-89
Identity = 131/214 (61.21%), Postives = 164/214 (76.64%), Query Frame = 3
Query:   51 MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPRE--QIIVVGDVVSR 686
            M NI++F+GSSN  L +KI ERIGIKL E    KFSN E  V+I+ESVRG+DVYI+Q+G  +VN++LMELLIMINACKNAS+SRITAV+P  PY+RQ KKD +R PI+AKLVA++L +AGANHIITMDLHASQIQGFFD+PVDNL +EP  + WIK NI  W +  I S     A+RV  +A+ LN  F LI+ ERK+  E  ++++VGDV  R
Sbjct:    1 MPNIKVFAGSSNTSLAQKISERIGIKLGEVISKKFSNEETCVEIRESVRGEDVYIIQTGSGEVNDNLMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLSVAGANHIITMDLHASQIQGFFDIPVDNLYAEPAVVRWIKVNIPDWNQCAIVSPDAGGAKRVTAIADHLNADFALIHKERKKANEVDRMVLVGDVRDR 214          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 207.994 bits (528), Expect = 6.734e-64
Identity = 129/342 (37.72%), Postives = 191/342 (55.85%), Query Frame = 3
Query:   66 LFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIE----------RKEP-----------------------REQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            L +G+S+    E + + + + L + N+  +SN E  V I E++RG+DVYI+Q+G   VNN +MELLIMI  CK + +  IT  +PYMPY +QSK    R  I ++L+A +L  AG N +ITMDLHA +IQGFFDVPVDNL + P  I ++++ I  +    I + +     R    A RL +   +I+ E          R  P                       +  + VVGDV   IAII+ DIID  D   ++ + L E G   V+V+ATHG+LS     +++DS I +++VTNT+       +  KI  +DV+++ AEAIRR+H  ES+S L+ N+
Sbjct:    9 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKM-RKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQGFFDVPVDNLRASPFLIKYVEECIPDYRNAVIVARNPNAVHRATSYAERLRLPLAVIHGEEQSDSENTDGRNSPPMGDEKKSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHERGVYKVFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNI 349          
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 205.297 bits (521), Expect = 8.672e-63
Identity = 129/349 (36.96%), Postives = 191/349 (54.73%), Query Frame = 3
Query:   66 LFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRGKDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKKDNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPCQISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIE----------RKEP------------------------------REQIIVVGDVVSRXXXXXXXXXXXXXXXFSSVKKLMEVGATGVYVIATHGMLSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRRMHFGESVSCLYNNL 992
            L +G+S+    E + + + + L + N+  +SN E  V I E++RG+DVYI+Q+G   VNN +MELLIMI  CK + +  IT  +PYMPY +QSK    R  I ++L+A +L  AG N +ITMDLHA +IQGFFDVPVDNL + P  I ++++ I  +    I + +     R    A RL +   +I+ E          R  P                              +  + VVGDV   IAII+ DIID  D   ++ + L E G   V+V+ATHG+LS     +++DS I +++VTNT+       +  KI  +DV+++ AEAIRR+H  ES+S L+ N+
Sbjct:    9 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKM-RKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQGFFDVPVDNLRASPFLIKYVEECIPDYRNAVIVARNPNAVHRATSYAERLRLPLAVIHGEEQSDSENTDGRNSPPMGDEKKSSRTHKESLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHERGVYKVFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNI 356          
The following BLAST results are available for this feature:
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPS11.369e-11054.11phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
PRPS29.402e-11053.48phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
PRPS1L12.463e-10854.11phosphoribosyl pyrophosphate synthetase 1 like 1 [... [more]
PRPS1L17.808e-10854.14phosphoribosyl pyrophosphate synthetase 1 like 1 [... [more]
PRPS21.108e-10752.98phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R151.21.398e-10753.16pep chromosome:WBcel235:III:7211424:7215111:1 gene... [more]
R151.21.398e-10753.16pep chromosome:WBcel235:III:7212735:7215111:1 gene... [more]
R151.21.398e-10753.16pep chromosome:WBcel235:III:7211442:7215111:1 gene... [more]
R151.21.398e-10753.16pep chromosome:WBcel235:III:7211436:7215226:1 gene... [more]
R151.21.331e-10653.16pep chromosome:WBcel235:III:7212531:7215111:1 gene... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG67672.084e-11154.43gene:FBgn0036030 transcript:FBtr0076415[more]
CG67672.084e-11154.43gene:FBgn0036030 transcript:FBtr0345032[more]
CG67673.539e-10953.75gene:FBgn0036030 transcript:FBtr0345034[more]
CG67673.539e-10953.75gene:FBgn0036030 transcript:FBtr0310662[more]
CG67676.292e-10953.75gene:FBgn0036030 transcript:FBtr0333856[more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prps1b4.409e-11053.16phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
prps1b4.409e-11053.16phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
prps1a4.409e-11053.48phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1a4.365e-10853.14phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1b1.112e-10451.90phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
garem19.246e-11154.11GRB2 associated regulator of MAPK1 subtype 1 [Sour... [more]
prps11.787e-10953.16phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prps12.736e-10752.50phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
rab102.276e-6739.31RAB10, member RAS oncogene family [Source:Xenbase;... [more]
lmbrd23.772e-6139.24LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prps1l37.894e-11154.11phosphoribosyl pyrophosphate synthetase 1-like 3 [... [more]
Prps19.396e-11154.11phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
Prps1l11.928e-11055.06phosphoribosyl pyrophosphate synthetase 1-like 1 [... [more]
Prps21.053e-10953.48phosphoribosyl pyrophosphate synthetase 2 [Source:... [more]
Prpsap22.498e-6839.71phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZXC9|PRPS2_XENLA1.535e-11154.11Ribose-phosphate pyrophosphokinase 2 OS=Xenopus la... [more]
sp|Q4R4U3|PRPS1_MACFA3.572e-11054.11Ribose-phosphate pyrophosphokinase 1 OS=Macaca fas... [more]
sp|Q5XGI0|PRPS2_XENTR4.898e-11054.11Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tr... [more]
sp|P60892|PRPS1_RAT6.572e-11054.11Ribose-phosphate pyrophosphokinase 1 OS=Rattus nor... [more]
sp|Q5RFJ7|PRPS1_PONAB6.572e-11054.11Ribose-phosphate pyrophosphokinase 1 OS=Pongo abel... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M1S1T00.000e+087.26Phosphoribosyl pyrophosphate synthetase 1 OS=Duges... [more]
A7M6E20.000e+087.58Ribose-phosphate pyrophosphokinase I OS=Dugesia ry... [more]
A0A0F6MV491.349e-11356.01Ribose-phosphate pyrophosphokinase 1 OS=Spirometra... [more]
A0A0X3PLP21.349e-11356.33Pribosyltran_N domain-containing protein OS=Schist... [more]
A0A4Y2IFD22.883e-11255.06Ribose-phosphate pyrophosphokinase 2 OS=Araneus ve... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prps1b1.116e-11053.48phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prps1a2.555e-10853.77ribose-phosphate pyrophosphokinase 1-like [Source:... [more]
prps1a3.227e-9653.63ribose-phosphate pyrophosphokinase 1-like [Source:... [more]
ENSAMXT00000048420.17.951e-8246.52pep primary_assembly:Astyanax_mexicanus-2.0:12:171... [more]
prpsap25.262e-6739.12phosphoribosyl pyrophosphate synthetase associated... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpsap22.444e-6038.86phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRS41.084e-8445.085-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS39.826e-8444.595-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS25.213e-8344.445-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS12.173e-5641.795-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS51.703e-2752.735-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471172.149e-10652.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480237.444e-6437.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273327.396e-1638.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000008371.21.050e-10853.80ribose-phosphate pyrophosphokinase 2 [Source:NCBI ... [more]
prps1b6.689e-10853.14phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prps1b3.985e-9652.94phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
prpsap23.369e-6739.12phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000046014.14.797e-6539.13phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of Ribose-phosphate pyrophosphokinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000008469.11.625e-8961.21SMESG000008469.1[more]
SMESG000008493.14.612e-8961.21SMESG000008493.1[more]
SMESG000007561.16.734e-6437.72SMESG000007561.1[more]
SMESG000007561.18.672e-6336.96SMESG000007561.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014636 ID=SMED30014636|Name=Ribose-phosphate pyrophosphokinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1130bp
GCTCCATCAAATGATTAATGACCTTCAGCGTAAACTATGTTCCCTAAATC
ATGTTAAATATAAGATTATTTTCTGGTTCTTCGAACTTCTTATTGACAGA
AAAGATAGGAGAAAGAATTGGCATAAAACTATCTGAGGCCAATTTGAATA
AATTCAGCAATAATGAAATCAATGTTCAAATAAAGGAATCAGTAAGAGGT
AAAGACGTTTATATTTTACAATCTGGCTATATTGATGTCAATAATCATTT
GATGGAGCTACTTATTATGATAAATGCCTGTAAAAATGCCTCGTCTTCTC
GCATAACTGCGGTTTTACCGTATATGCCATATTCTCGTCAAAGCAAAAAA
GATAATAACCGAGTCCCGATAACTGCAAAACTTGTCGCAGATCTGCTTCA
TATTGCCGGTGCTAATCATATTATAACTATGGATTTGCACGCGAGTCAAA
TCCAAGGATTCTTTGATGTACCGGTAGATAATTTACTGAGCGAACCGTGC
CAAATATCGTGGATTAAGAAGAATATTTCAAAATGGGAAGAAATCACTAT
TTTTAGTTTGCACGTGACCACCGCTGAACGGGTAGCTCATATGGCTAATC
GACTCAATGTGAGATTCGGGTTAATCTATATTGAACGGAAAGAGCCCAGG
GAGCAAATCATAGTTGTTGGCGATGTTGTGTCGAGGATTGCGATTATATT
ATTGGATATAATCGACACATGTGACCTGATATTCAGTTCAGTGAAAAAAC
TAATGGAAGTTGGGGCTACAGGAGTCTATGTCATTGCTACTCATGGGATG
CTTTCAGAAAGGTTAATGACAGAAATTGATGATTCGTTTATTTCACAACT
TGTAGTCACAAATACTATTTGCCAGGACAAATATGTTCAAAAAAGTGAAA
AAATTACATGCCTTGATGTCAGCATTATATTTGCTGAAGCTATCAGAAGA
ATGCATTTTGGAGAATCCGTATCATGTTTGTACAATAACCTACAGTCTTG
ATGTCTTATGTAATATGGAGCTTACCGATCTTTCTATTTTTTGAAGACGC
TAGAATCAGTGAATCTTCTTTCCACTATACCTAAATTTTACCTCATTTAA
TAAAATCAAATGTTATTGTTTGTAAAAAAA
back to top

protein sequence of SMED30014636-orf-1

>SMED30014636-orf-1 ID=SMED30014636-orf-1|Name=SMED30014636-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MLNIRLFSGSSNFLLTEKIGERIGIKLSEANLNKFSNNEINVQIKESVRG
KDVYILQSGYIDVNNHLMELLIMINACKNASSSRITAVLPYMPYSRQSKK
DNNRVPITAKLVADLLHIAGANHIITMDLHASQIQGFFDVPVDNLLSEPC
QISWIKKNISKWEEITIFSLHVTTAERVAHMANRLNVRFGLIYIERKEPR
EQIIVVGDVVSRIAIILLDIIDTCDLIFSSVKKLMEVGATGVYVIATHGM
LSERLMTEIDDSFISQLVVTNTICQDKYVQKSEKITCLDVSIIFAEAIRR
MHFGESVSCLYNNLQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
Vocabulary: biological process
TermDefinition
GO:0009156ribonucleoside monophosphate biosynthetic process
GO:0044249cellular biosynthetic process
GO:0009165nucleotide biosynthetic process
GO:0009116nucleoside metabolic process
GO:0016310phosphorylation
Vocabulary: INTERPRO
TermDefinition
IPR029057PRTase-like
IPR005946Rib-P_diPkinase
IPR029099Pribosyltran_N
IPR000842PRib_PP_synth_CS
Vocabulary: molecular function
TermDefinition
GO:0004749ribose phosphate diphosphokinase activity
GO:0000287magnesium ion binding
GO:0016301kinase activity