Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30014623
Length (bp)1926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30014623) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30014623) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30014623) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30014623) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014623

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014623SMESG000077709.1 PL08004A2E10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30014623SMESG000077709.1 dd_Smed_v4_1644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014623SMESG000077709.1 dd_Smed_v4_1644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014623SMESG000077709.1 dd_Smed_v4_1644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 279/549 (50.82%), Postives = 375/549 (68.31%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I +E+ R G GEHG    L  +E +  +S ++ NGFN   S+ +AL RS+ DIRH +CK  +Y + LP+ SIIIPF+ E W++LLRT  S + R P  L+ EIILVDD S +E LKDKL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R++LKCK FKWFM  +A+D+ K+YP VEPP +A GE+R+   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  C D   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ ++
Sbjct:   44 TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPL--TEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMARFSK--VRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN-----LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 578          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 279/549 (50.82%), Postives = 375/549 (68.31%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I +E+ R G GEHG    L  +E +  +S ++ NGFN   S+ +AL RS+ DIRH +CK  +Y + LP+ SIIIPF+ E W++LLRT  S + R P  L+ EIILVDD S +E LKDKL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R++LKCK FKWFM  +A+D+ K+YP VEPP +A GE+R+   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  C D   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ ++
Sbjct:   61 TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPL--TEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMARFSK--VRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN-----LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 283/550 (51.45%), Postives = 361/550 (65.64%), Query Frame = 2
Query:  239 ITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISRY 1861
            + D +K  DWH+ + I  ++QR G GE G    +  +E    +  ++ NGFN   SDK++LNRS+ DIRHP+C    Y ++LP+ SIIIPF+ E WS+LLRT  S L R+P  LV EI+LVDD S +E LK  L+ Y+       VR+LR  KREGLIRTR+ GA  ATGDV+ FLDSHCE N+NWLPPLLD IA++ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ PE  K  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+  Q  +R  L CKSFKWFMT+IA+DL K YP VEPP +A GE+R+      G  LC D K     S +RL  CV+          Q F  TW ED+R      ++  C D   +   SPV LY CH  KGNQLWKY+ D K LYH V+  C+        ++M+TC  SS  Q+W  E+    V+ ++
Sbjct:   65 LGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAER--VDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA--LFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV-----GTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHT--SPVTLYDCHSMKGNQLWKYRKD-KTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKF 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 451.055 bits (1159), Expect = 1.134e-153
Identity = 220/423 (52.01%), Postives = 292/423 (69.03%), Query Frame = 2
Query:  620 EFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            E LKDKL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R++LKCK FKWFM  +A+D+ K+YP VEPP +A GE+R+   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  C D   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ ++
Sbjct:    1 EHLKDKLEEYMARFSK--VRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN-----LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 411          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 397.512 bits (1020), Expect = 6.798e-131
Identity = 207/523 (39.58%), Postives = 306/523 (58.51%), Query Frame = 2
Query:  299 QREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQS----VYMDTCTSSSNQKWYLENV 1837
             +EG GE G AV++   +    + +FK+N FN +ASD +ALNRS+ D+R   CK  +Y   LP+ S++I F+ E WSTLLRT  S + R+P  L+ E+ILVDD S ++FLK  L+ Y++N  +  V+++R ++R GLIR RL+GA  + G V+ FLD+HCE  + WL PLL  I +D +TV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G+ I +N +R+AEVWMDE++ + Y   P   + + GD++ +  +RE LKCK F W+       LE  YP  + P    + GE+R+   N      CLD    K   ++ +  C      + G Q F  ++  D  +++ D CLDV +     PVI+  CH  +GNQLW+Y  +   L HV + +CL  D P++       M  C+ S +Q+W L N+
Sbjct:   53 NQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKN-LEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWY-------LENIYPDSQIPRRYYSLGEIRNVETNQ-----CLDNMGRKENEKVGIFNC----HGMGGNQVF--SYTADKEIRTDDLCLDVSR--LNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCL--DEPSEEDKMVPTMQDCSGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 298/556 (53.60%), Postives = 389/556 (69.96%), Query Frame = 2
Query:  206 GLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKE--SIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENN-FKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYR-KYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLT-WHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQS-VYMDTCTSSSN-QKWYLENVKEDVI 1852
             L    L+P E     +KI W +     +E +REG GE G  V L   +   KE  S++K NG+N   SD ++LNRS+KDIRH +CK M+Y   LP+VS+I PF+EEH STLLR+  S + R+P  L+KEIILVDD S K  L+  L+ +++ N    IV+VLR  KREGLIR R  GA++ATG++LIFLD+H E N NWLPPLLDPIA+DYRTV CPF+DV+D +T+E R QDEGARG+FDW F YKRLPL  +D + P +PF SPVMAGG FAIS KWFWELGGYD GLDIWGGEQYELSFK+WQC G+M+D PCSR+AH+YR KYAPF +   +G+F++RNYKRVAEVWMD+Y++ LY+ +P     +AGDL     IRE+L+CKSF WFM EIAFD +K+YP+VEP  SA+GE+R+      G + C+D +F +   +  L  C  D+    GEQ   LT WH D+R K R  C D   ++ K+PVIL+ CH  KGNQL+KY++  KQ+YH ++ +CLTAD   +  ++M  C SSS+ QKW  + V  +++
Sbjct:   62 ALGDEALDPFEKYRGHEKIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKN-AGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNV-----GTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWH-DIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVDNELL 610          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 296/555 (53.33%), Postives = 387/555 (69.73%), Query Frame = 2
Query:  206 GLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKE--SIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENN-FKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYR-KYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQS-VYMDTCTSSSN-QKWYLENVKEDVI 1852
             L    L+P E     +KI W +     +E +REG GE G  V L   +   KE  S++K NG+N   SD ++LNRS+KDIRH +CK M+Y   LP+VS+I PF+EEH STLLR+  S + R+P  L+KEIILVDD S K  L+  L+ +++ N    IV+VLR  KREGLIR R  GA++ATG++LIFLD+H E N NWLPPLLDPIA+DYRTV CPF+DV+D +T+E R QDEGARG+FDW F YKRLPL  +D + P +PF SPVMAGG FAIS KWFWELGGYD GLDIWGGEQYELSFK+WQC G+M+D PCSR+AH+YR KYAPF +   +G+F++RNYKRVAEVWMD+Y++ LY+ +P     +AGDL     IRE+L+CKSF WFM EIAFD +K+YP+VEP  SA+GE+R+      G + C+D +F +   +  L  C  D+    GEQ   LT   D+R K R  C D   ++ K+PVIL+ CH  KGNQL+KY++  KQ+YH ++ +CLTAD   +  ++M  C SSS+ QKW  + V  +++
Sbjct:  143 ALGDEALDPFEKYRGHEKIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKN-AGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNV-----GTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVDNELL 691          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-7 (Probable N-acetylgalactosaminyltransferase 7 [Source:UniProtKB/Swiss-Prot;Acc:O61397])

HSP 1 Score: 377.481 bits (968), Expect = 2.060e-123
Identity = 208/534 (38.95%), Postives = 306/534 (57.30%), Query Frame = 2
Query:  272 NYKQILEESQREGVGEHGSAV-ILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRA----QDEGARGAFDWEFYYKRLPLLPEDL---KYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNF-----IARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKG--NQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKWYL 1828
            NY+    E      GEHG  V + D        +  K  GFN   SD +++NR++ DIR  +CK   Y + LP+VS+++ F+ E W+ LLRT  S L+R+P  L++++++VDD S K  LK+KLD+Y+   F G V V+R ++REGLI  R  GAK++TG+V++FLD+HCE N NWLPPLL PI ++ + +T P ID +D +++EYR+     +    G F+W   YK   +   +    K+ ++PF+SP  AGGLFAI+R WF ELG YD GL IWGGEQYELSFKIWQCGG ++  PCS + HVYR + P+    + G F     I+ N  RV + WMD+Y KY   R+P     N GD++AQ A+R++L+CKSFKW+M  +A+D+ K YP + PPN   GE R+          CLD +       +    C        G Q  L+  +   ++   + CL        + + + + H  KG  N  W Y   +KQ+ H   ++C+T       V + TCT  + ++ ++
Sbjct:   41 NYEPKEPEIPSNQPGEHGKPVPVTDEEGMAAGRAAEKEFGFNTYVSDMISMNRTIPDIRPEECKHWDYPEKLPTVSVVVVFHNEGWTPLLRTVHSVLLRSPPELIEQVVMVDDDSDKPHLKEKLDKYV-TRFNGKVIVVRTEQREGLINARSIGAKHSTGEVVLFLDAHCEVNTNWLPPLLAPIKRNRKVMTVPVIDGIDSNSWEYRSVYGSPNAHHSGIFEWGLLYKETQITERETAHRKHNSQPFRSPTHAGGLFAINRLWFKELGYYDEGLQIWGGEQYELSFKIWQCGGGIVFVPCSHVGHVYRSHMPY----SFGKFSGKPVISINMMRVVKTWMDDYSKYYLTREPQATNVNPGDISAQLALRDKLQCKSFKWYMENVAYDVLKSYPML-PPNDVWGEARNPATGK-----CLD-RMGGIPGPMGATGC----HGYGGNQ--LIRLNVQGQMAQGEWCLTA------NGIRIQANHCVKGTVNGFWSYDRKTKQIIHSQKRQCITVSESGSEVTLQTCTEDNERQKFV 550          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-7 (Probable N-acetylgalactosaminyltransferase 7 [Source:UniProtKB/Swiss-Prot;Acc:O61397])

HSP 1 Score: 376.711 bits (966), Expect = 1.193e-122
Identity = 208/534 (38.95%), Postives = 306/534 (57.30%), Query Frame = 2
Query:  272 NYKQILEESQREGVGEHGSAV-ILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRA----QDEGARGAFDWEFYYKRLPLLPEDL---KYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNF-----IARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKG--NQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKWYL 1828
            NY+    E      GEHG  V + D        +  K  GFN   SD +++NR++ DIR  +CK   Y + LP+VS+++ F+ E W+ LLRT  S L+R+P  L++++++VDD S K  LK+KLD+Y+   F G V V+R ++REGLI  R  GAK++TG+V++FLD+HCE N NWLPPLL PI ++ + +T P ID +D +++EYR+     +    G F+W   YK   +   +    K+ ++PF+SP  AGGLFAI+R WF ELG YD GL IWGGEQYELSFKIWQCGG ++  PCS + HVYR + P+    + G F     I+ N  RV + WMD+Y KY   R+P     N GD++AQ A+R++L+CKSFKW+M  +A+D+ K YP + PPN   GE R+          CLD +       +    C        G Q  L+  +   ++   + CL        + + + + H  KG  N  W Y   +KQ+ H   ++C+T       V + TCT  + ++ ++
Sbjct:   84 NYEPKEPEIPSNQPGEHGKPVPVTDEEGMAAGRAAEKEFGFNTYVSDMISMNRTIPDIRPEECKHWDYPEKLPTVSVVVVFHNEGWTPLLRTVHSVLLRSPPELIEQVVMVDDDSDKPHLKEKLDKYV-TRFNGKVIVVRTEQREGLINARSIGAKHSTGEVVLFLDAHCEVNTNWLPPLLAPIKRNRKVMTVPVIDGIDSNSWEYRSVYGSPNAHHSGIFEWGLLYKETQITERETAHRKHNSQPFRSPTHAGGLFAINRLWFKELGYYDEGLQIWGGEQYELSFKIWQCGGGIVFVPCSHVGHVYRSHMPY----SFGKFSGKPVISINMMRVVKTWMDDYSKYYLTREPQATNVNPGDISAQLALRDKLQCKSFKWYMENVAYDVLKSYPML-PPNDVWGEARNPATGK-----CLD-RMGGIPGPMGATGC----HGYGGNQ--LIRLNVQGQMAQGEWCLTA------NGIRIQANHCVKGTVNGFWSYDRKTKQIIHSQKRQCITVSESGSEVTLQTCTEDNERQKFV 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 358.221 bits (918), Expect = 3.197e-115
Identity = 213/527 (40.42%), Postives = 303/527 (57.50%), Query Frame = 2
Query:  239 ITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESI-----FKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDE--GARGAFDWEFYYKRLPLLPEDLK---YPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAK--SESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDE-CLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADG 1768
            +  PK  +D ++   I ++      GE G AV++D ++ + +E          N FN  ASD ++++R++      +CK   Y ++LP  S+II F+ E WS LLRT  S L R P  L++E++LVDD S  +  K  L++Y+ + F G V++LR +KREGLIR RL+GA  ATG+VL +LDSHCE    W+ PLLD I +D  TV CP IDV+D +TFEY        + G FDW   +    +   D K    P  P +SP MAGGLF+I +K+F +LG YDPG DIWGGE  ELSFKIW CGG +   PCS + HV+RK +P+     + N + RN  R+AEVW+D+Y+ Y Y R  + +  + GD++++  +RE L CKSFKW++  I       YP +  P    A GE+R+        S CLD+   +      I   PC +      G Q ++L+   ++R   RDE C+D       S V+++ CHG KGNQ W+Y  D+ +L H V+QKCL  T DG
Sbjct:   90 LAKPKFMVDPND--PIYKKGDAAQAGELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYM-SQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGV-NVLKRNSIRLAEVWLDDYKTYYYERINN-QLGDFGDISSRKKLREDLGCKSFKWYLDNI-------YPELFVPGESVAKGELRNA-----QTSQCLDSAVGEEVENKAITPYPCHEQG----GNQYWMLSKDGEIR---RDESCVDYA----GSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDG 588          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072973)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 286/544 (52.57%), Postives = 363/544 (66.73%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILD-SSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPS-WERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYH-VVTQKCLTADGPTQSVYMDTC-TSSSNQKWYLENVKEDVISRY 1861
             D   K DWH+Y  + ++++R G+GE G A  LD  S+ +L++ +   NGFN L SD +++NRSV DIRHP C+K  Y   LP+VS+II FY E+ S L+R+  S + R+P  L+KEIILVDD S +E+L  +L+ YI  +FK  VRV+R  +R GLI  R  GA+NAT +VLIFLDSH E N NWLPPLL+PIA + RT  CPFIDV+DH  F YRAQDEGARGAFDWEF+YKRLPLLPEDLK+PA PFKSP+MAGGLFAISR++FWELGGYD GLDIWGGEQYELSFKIW CGG+M D PCSRI H+YR           G+++ +NYKRVAEVWMDEY+ YLY      +E  + GDLT Q AIR +L CKSFKWFM E+AFDL K YP V+PP+ A G ++    N    +LCLD    K  +++ +  C  +       Q + L+W  DLRL+ + ECLDV      +PV L+ CH Q GNQ W Y    KQL H    ++CL     +Q V  + C T +  Q+W   +  +  +  Y
Sbjct:  120 ADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKW-VRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQ----NVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTALDNY 658          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0333442)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 286/544 (52.57%), Postives = 363/544 (66.73%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILD-SSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPS-WERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYH-VVTQKCLTADGPTQSVYMDTC-TSSSNQKWYLENVKEDVISRY 1861
             D   K DWH+Y  + ++++R G+GE G A  LD  S+ +L++ +   NGFN L SD +++NRSV DIRHP C+K  Y   LP+VS+II FY E+ S L+R+  S + R+P  L+KEIILVDD S +E+L  +L+ YI  +FK  VRV+R  +R GLI  R  GA+NAT +VLIFLDSH E N NWLPPLL+PIA + RT  CPFIDV+DH  F YRAQDEGARGAFDWEF+YKRLPLLPEDLK+PA PFKSP+MAGGLFAISR++FWELGGYD GLDIWGGEQYELSFKIW CGG+M D PCSRI H+YR           G+++ +NYKRVAEVWMDEY+ YLY      +E  + GDLT Q AIR +L CKSFKWFM E+AFDL K YP V+PP+ A G ++    N    +LCLD    K  +++ +  C  +       Q + L+W  DLRL+ + ECLDV      +PV L+ CH Q GNQ W Y    KQL H    ++CL     +Q V  + C T +  Q+W   +  +  +  Y
Sbjct:  120 ADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKW-VRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQ----NVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTALDNY 658          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072972)

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 286/544 (52.57%), Postives = 363/544 (66.73%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILD-SSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPS-WERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYH-VVTQKCLTADGPTQSVYMDTC-TSSSNQKWYLENVKEDVISRY 1861
             D   K DWH+Y  + ++++R G+GE G A  LD  S+ +L++ +   NGFN L SD +++NRSV DIRHP C+K  Y   LP+VS+II FY E+ S L+R+  S + R+P  L+KEIILVDD S +E+L  +L+ YI  +FK  VRV+R  +R GLI  R  GA+NAT +VLIFLDSH E N NWLPPLL+PIA + RT  CPFIDV+DH  F YRAQDEGARGAFDWEF+YKRLPLLPEDLK+PA PFKSP+MAGGLFAISR++FWELGGYD GLDIWGGEQYELSFKIW CGG+M D PCSRI H+YR           G+++ +NYKRVAEVWMDEY+ YLY      +E  + GDLT Q AIR +L CKSFKWFM E+AFDL K YP V+PP+ A G ++    N    +LCLD    K  +++ +  C  +       Q + L+W  DLRL+ + ECLDV      +PV L+ CH Q GNQ W Y    KQL H    ++CL     +Q V  + C T +  Q+W   +  +  +  Y
Sbjct:  120 ADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKW-VRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQ----NVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTALDNY 658          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0333248)

HSP 1 Score: 481.871 bits (1239), Expect = 7.584e-163
Identity = 245/568 (43.13%), Postives = 356/568 (62.68%), Query Frame = 2
Query:  185 DKAWIAEGLKHNELNPDEITDPK-KKIDWHNYKQILEESQREGVGEHGSAV-ILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEY-RAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQP-SWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDE-CLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQK-CLTA--DGPTQSVYMDTCTSSSN-QKWYLENVKEDVISRY 1861
            D+  + +  + ++L    + +PK ++ DWH+Y  +  + +R G GEHG AV I +  E  L++  +++NGFNGL SD++++NRSV D+R   CK   Y   LP++S+I  F+ EH++TLLR+  S + R P  L+K+I+LVDD S  + LK  LD Y++ +F  +V ++R  +R+GLI  R+ GAK A G V++F DSH E N NWLPPL++PIA + +  TCP +D + H+ F Y     +GARG FDW+  YK+LP+LPED    + P++SPVM GGLFAI+  +FW+LGGYD  LDIWGGEQYELSFKIW CGG +LD PCSR+AH++R            NF+A+N+KRVAEVWMDEY++Y+Y+R P +++  +AGDLT Q  +RERLKCKSF WFMTE+A D    +P VEPP+ A G ++    N      CLD     +E  + +  C  + +     Q + L+   DLR+K  D  CLDV +    + V ++SCH Q GNQ W Y   +++L H    K CL    +     V  ++C + ++ Q+W    V   ++  +
Sbjct:   76 DRNSVVDIPRSDKLQGFRLPEPKGERKDWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQ----NVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLEGFVENGIAKVVANSCENGNDRQRWEFGFVNHTMLDTF 639          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0114524)

HSP 1 Score: 481.871 bits (1239), Expect = 7.584e-163
Identity = 245/568 (43.13%), Postives = 356/568 (62.68%), Query Frame = 2
Query:  185 DKAWIAEGLKHNELNPDEITDPK-KKIDWHNYKQILEESQREGVGEHGSAV-ILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEY-RAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQP-SWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDE-CLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQK-CLTA--DGPTQSVYMDTCTSSSN-QKWYLENVKEDVISRY 1861
            D+  + +  + ++L    + +PK ++ DWH+Y  +  + +R G GEHG AV I +  E  L++  +++NGFNGL SD++++NRSV D+R   CK   Y   LP++S+I  F+ EH++TLLR+  S + R P  L+K+I+LVDD S  + LK  LD Y++ +F  +V ++R  +R+GLI  R+ GAK A G V++F DSH E N NWLPPL++PIA + +  TCP +D + H+ F Y     +GARG FDW+  YK+LP+LPED    + P++SPVM GGLFAI+  +FW+LGGYD  LDIWGGEQYELSFKIW CGG +LD PCSR+AH++R            NF+A+N+KRVAEVWMDEY++Y+Y+R P +++  +AGDLT Q  +RERLKCKSF WFMTE+A D    +P VEPP+ A G ++    N      CLD     +E  + +  C  + +     Q + L+   DLR+K  D  CLDV +    + V ++SCH Q GNQ W Y   +++L H    K CL    +     V  ++C + ++ Q+W    V   ++  +
Sbjct:   76 DRNSVVDIPRSDKLQGFRLPEPKGERKDWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQ----NVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLEGFVENGIAKVVANSCENGNDRQRWEFGFVNHTMLDTF 639          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 280/550 (50.91%), Postives = 372/550 (67.64%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPE-DLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLD-VPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTC-TSSSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I ++ QR G GEHG    L   E+   +S++K NGFN   S+ +AL+RS+ DIRHP+CK+ LY ++LP+ SIIIPF+ E WS+LLRT  S   R P  L+ EIILVDD S +E LK  L +Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE NINWLPPLLD IAQ+ +T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE     P+ P++SPVMAGGLFA++R+WFWELGGYD GL+IWGGEQ+E+SFK+W CGG M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDEY +Y+Y+R+P +   + GDLTAQ  +R+ LKCK FKW+M  +A+DL K+YP VEP  +A GE+R+       + LC+D+K   + +++RL  C+K+ +  T   EQ F   W ED+R    L +R  C D + QN   SP+ LY CHG KGNQ W Y+ D K LYH+V+  C+      + ++M+ C   S  Q+W  + V   V+ ++
Sbjct:   60 TDGLRRRDWHDYESIRKDGQRVGKGEHGKPYPL--VEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSRFPK--VRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIRNA-----ASGLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQN---SPITLYDCHGMKGNQHWSYRKD-KSLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKF 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 280/550 (50.91%), Postives = 372/550 (67.64%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPE-DLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLD-VPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTC-TSSSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I ++ QR G GEHG    L   E+   +S++K NGFN   S+ +AL+RS+ DIRHP+CK+ LY ++LP+ SIIIPF+ E WS+LLRT  S   R P  L+ EIILVDD S +E LK  L +Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE NINWLPPLLD IAQ+ +T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE     P+ P++SPVMAGGLFA++R+WFWELGGYD GL+IWGGEQ+E+SFK+W CGG M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDEY +Y+Y+R+P +   + GDLTAQ  +R+ LKCK FKW+M  +A+DL K+YP VEP  +A GE+R+       + LC+D+K   + +++RL  C+K+ +  T   EQ F   W ED+R    L +R  C D + QN   SP+ LY CHG KGNQ W Y+ D K LYH+V+  C+      + ++M+ C   S  Q+W  + V   V+ ++
Sbjct:   60 TDGLRRRDWHDYESIRKDGQRVGKGEHGKPYPL--VEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSRFPK--VRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIRNA-----ASGLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQN---SPITLYDCHGMKGNQHWSYRKD-KSLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKF 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10-like [Source:NCBI gene;Acc:103910015])

HSP 1 Score: 429.483 bits (1103), Expect = 1.289e-145
Identity = 212/405 (52.35%), Postives = 275/405 (67.90%), Query Frame = 2
Query:  674 VRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSR--LTGEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYM-DTCTSSSNQKWYLENVKEDVISRY 1861
            VR+LR  KREGLIRTRL GA  A G V+ FLDSHCE N+NWLPPLLD IAQ+ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+  +  K  P+ PF SPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY ++LY+R+P +   ++GD++ Q  +R RL C+SF+WFM E+A+DL KHYP VEPP +A GE+R+      G  LC+++K   S S IRL PC++       +  Q F   W +D+R    L ++  C D   +   SPV LY CHG KGNQLW Y+ D + L+H ++  C++AD   + + M     SSS+Q+W  +N    V+  +
Sbjct:    7 VRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLDRIAQNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAQLAKPDPSEPFDSPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPGGVSLARNLKRVAEVWMDEYAEFLYQRRPEYRHLSSGDVSQQKELRSRLHCRSFRWFMEEVAWDLPKHYPPVEPPAAAWGELRNV-----GTGLCVESKHFSSGSPIRLEPCLRSRGEPSWSHGQVFTFGWRQDIRVGDPLHTKKVCFDAVSH--NSPVTLYDCHGMKGNQLWAYRKD-RSLFHPISNSCVSADAAQKRLLMSSCDASSSSQQWVFQNTNSSVLDSF 401          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 394.815 bits (1013), Expect = 6.033e-130
Identity = 203/519 (39.11%), Postives = 306/519 (58.96%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            +G GE G  V++   +    + +FK+N FN +AS+ +ALNRS+ D+R   CK  +Y   LP  S++I F+ E W+TLLRT  S + R+P+ L++EI+LVDD S ++FLK +L+ Y+    +  VRV+R ++R GLIR RLKGA  +TG V+ FLD+HCE    WL PLL  I  D +TV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++ + ++R+RL+CK F W++  +  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV++  CH  KGNQLW+Y      L HV + +CL   ++  +Q   +  C+ + +Q+W L NV
Sbjct:   54 DGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRK-LEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRNV 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 394.815 bits (1013), Expect = 6.033e-130
Identity = 203/519 (39.11%), Postives = 306/519 (58.96%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            +G GE G  V++   +    + +FK+N FN +AS+ +ALNRS+ D+R   CK  +Y   LP  S++I F+ E W+TLLRT  S + R+P+ L++EI+LVDD S ++FLK +L+ Y+    +  VRV+R ++R GLIR RLKGA  +TG V+ FLD+HCE    WL PLL  I  D +TV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++ + ++R+RL+CK F W++  +  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV++  CH  KGNQLW+Y      L HV + +CL   ++  +Q   +  C+ + +Q+W L NV
Sbjct:   54 DGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRK-LEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARSQQWLLRNV 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 279/549 (50.82%), Postives = 378/549 (68.85%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I +E+ R G GEHG    L   E +  +++++ NGFN   S+K+AL RS+ DIRHP+CK  LY + LP+ SIIIPF+ E W++LLRT  S + R P  L++E+ILVDD S +E L++KL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYELSFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDEY +Y+Y+R+P +   + GD+++Q  +R+ LKCK FKW+M+E+A+D+ K YP VEPP ++ GE+R+   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  C D   +   SPV LY CHG KGNQ W Y+ D K L+H VT  C+  +   + ++M+ C   S  Q+W  E+V   ++ ++
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLTEEEQD--DTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMAYYPK--VRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEIRNVASN-----LCIDSKHGATGTELRLDTCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYRKD-KTLFHPVTNSCIDCNPAEKKLFMNRCDPLSETQQWIFEHVNMTILQKF 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 274/547 (50.09%), Postives = 369/547 (67.46%), Query Frame = 2
Query:  248 PKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENVKEDVISRY 1861
            P+KK DWHNY+QI +ES++ G GE G    +  +++   +  ++ NGFN   SDK++LNRS+ DIRH +CK   Y   LP+ S+IIPF+ E WS+LLRT  S L R+P  L+ EI+LVDD S K  LK +L++Y+ N  K  V+++R  KREGLIRTR+ GA  A+G+VL FLDSHCE N+NWLPPLLDP+ Q+Y+TV CP IDV+D D F Y  Q  +  RGAFDWE +YKR+P+ PE  K  P+ PF SPVMAGGLFAI+R+WFW+LGGYDPGL+IWGGEQYE+SFK+W CGG+M+D+PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   + GD+ AQ  +R +L+C+ FKWFM EIA+DL K+YP VE P +A GE+R+   +     +C+  K   S ++IRL  C K  +  T    Q F L W ED+R      +   C D       SPV L+ CHG KGNQLWKY+ D K +YH  +  C+  +     ++M+ C  SS  Q+W  E++   ++  +
Sbjct:   66 PEKK-DWHNYEQIRKESEQIGNGEQGKPFPMTDADH--VDQAYRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMANFPK--VKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNVRMD-----MCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQT--SPVTLFDCHGMKGNQLWKYRRD-KTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILEAF 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 274/547 (50.09%), Postives = 369/547 (67.46%), Query Frame = 2
Query:  248 PKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENVKEDVISRY 1861
            P+KK DWHNY+QI +ES++ G GE G    +  +++   +  ++ NGFN   SDK++LNRS+ DIRH +CK   Y   LP+ S+IIPF+ E WS+LLRT  S L R+P  L+ EI+LVDD S K  LK +L++Y+ N  K  V+++R  KREGLIRTR+ GA  A+G+VL FLDSHCE N+NWLPPLLDP+ Q+Y+TV CP IDV+D D F Y  Q  +  RGAFDWE +YKR+P+ PE  K  P+ PF SPVMAGGLFAI+R+WFW+LGGYDPGL+IWGGEQYE+SFK+W CGG+M+D+PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   + GD+ AQ  +R +L+C+ FKWFM EIA+DL K+YP VE P +A GE+R+   +     +C+  K   S ++IRL  C K  +  T    Q F L W ED+R      +   C D       SPV L+ CHG KGNQLWKY+ D K +YH  +  C+  +     ++M+ C  SS  Q+W  E++   ++  +
Sbjct:   66 PEKK-DWHNYEQIRKESEQIGNGEQGKPFPMTDADH--VDQAYRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMANFPK--VKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNVRMD-----MCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQT--SPVTLFDCHGMKGNQLWKYRRD-KTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILEAF 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 266/547 (48.63%), Postives = 358/547 (65.45%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I +E+ R G GEHG    L   E +  +++++ NGFN   S+K+AL RS+ DIRHP+CK  LY + LP+ SIIIPF+ E W++LLRT  S + R P  L++E+ILVDD S +E L++KL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYELSFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDEY +Y+Y+R+P +   + GD+++Q  +R+ LKCK FKW+M+E+A+D+ K YP VEPP ++ GEV+           CL                            F   W ED+R    L +R  C D   +   SPV LY CHG KGNQ W Y+ D K L+H VT  C+  +   + ++M+ C   S  Q+W  E+V   ++ ++
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLTEEEQD--DTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMAYYPK--VRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKIN---------CL----------------------------FTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYRKD-KTLFHPVTNSCIDCNPAEKKLFMNRCDPLSETQQWIFEHVNMTILQKF 560          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 508.064 bits (1307), Expect = 4.058e-174
Identity = 252/496 (50.81%), Postives = 331/496 (66.73%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYK 1711
            TD  ++ DWH+Y+ I +E+ R G GEHG    L   E +  +++++ NGFN   S+K+AL RS+ DIRHP+CK  LY + LP+ SIIIPF+ E W++LLRT  S + R P  L++E+ILVDD S +E L++KL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYELSFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDEY +Y+Y+R+P +   + GD+++Q  +R+ LKCK FKW+M+E+A+D+ K YP VEPP ++ GEV+           CL                            F   W ED+R    L +R  C D   +   SPV LY CHG KGNQ W Y+
Sbjct:   60 TDGLRRKDWHDYESIQKEALRSGKGEHGKPYPLTEEEQD--DTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMAYYPK--VRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKIN---------CL----------------------------FTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYR 510          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 280/548 (51.09%), Postives = 373/548 (68.07%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISR 1858
            TD  ++ DWH+Y+ I  ++ R G GEHG    L  +E +  +S ++ NGFN   S+ +AL RS+ DIRH +CK  +Y + LP+ SIIIPF+ E W++LLRT  S + R P+ L+ EIILVDD S +E LKDKL+ Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R+RLKCK FKWFM  +A+D+ K+YP VEP  +A GE+RS   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  CLD   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ +
Sbjct:   61 TDGLRRKDWHDYESIQRDALRSGKGEHGKPYPL--TEEDRDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDDFSDREHLKDKLEDYMARFSK--VRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN-----LCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISH--SSPVTLYDCHGMKGNQLWGYRED-RTLFHPVSNSCMDCNPSEKKIFMARCDPLSETQQWIFEHINMTVLEK 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:MGI Symbol;Acc:MGI:1890480])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 284/542 (52.40%), Postives = 358/542 (66.05%), Query Frame = 2
Query:  263 DWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISRY 1861
            DWHN + I  ++QR G GE G    +  +E    +  ++ NGFN   SDK++LNRS+ DIRHP+C   LY ++LP+ SIIIPF+ E WS+LLRT  S L R+P  LV EI+LVDD S +E LK  L+ Y+       VR+LR  KREGLIRTR+ GA  ATGDV+ FLDSHCE N+NWLPPLLD IA++ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ PE  K  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+ AQ  +R  L CKSFKWFMT+IA+DL K YP VEPP +A GE+R+      G  LC D K     S +RL  C++          Q F  TW ED+R      ++  C D   +   SPV LY CH  KGNQLWKY+ D K LYH V+  C+        V+M+TC  SS  Q+W  E+    V+  +
Sbjct:   73 DWHNKEAIRRDAQRVGYGEQGKPYPMTDAER--VDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA--LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV-----GTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYRKD-KTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENF 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 448.358 bits (1152), Expect = 8.382e-153
Identity = 221/420 (52.62%), Postives = 289/420 (68.81%), Query Frame = 2
Query:  626 LKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISR 1858
            LKDKL+ Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R+RLKCK FKWFM  +A+D+ K+YP VEP  +A GE+RS   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  CLD   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ +
Sbjct:    3 LKDKLEDYMARFSK--VRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN-----LCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISH--SSPVTLYDCHGMKGNQLWGYRED-RTLFHPVSNSCMDCNPSEKKIFMARCDPLSETQQWIFEHINMTVLEK 410          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 397.127 bits (1019), Expect = 8.397e-131
Identity = 209/528 (39.58%), Postives = 308/528 (58.33%), Query Frame = 2
Query:  284 ILEESQR--EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            +LE  Q+  EG GE G  V++   +    + +FK+N FN +AS+ +ALNRS+ D+R   CK  +Y  +LP+ S++I F+ E WSTLLRT  S + R+P+ +++EI+LVDD S ++FLK  L+ Y++   K  V V+R ++R GLIR RLKGA  + G V+ FLD+HCE    WL PLL  I  D RTV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++++  +R +L+CK F W++  I  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV +  CH  KGNQLW+Y      L HV + +CL    +  +Q   +  CT S +Q+W L NV
Sbjct:   47 VLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKK-LKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNV 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 397.127 bits (1019), Expect = 8.397e-131
Identity = 209/528 (39.58%), Postives = 308/528 (58.33%), Query Frame = 2
Query:  284 ILEESQR--EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            +LE  Q+  EG GE G  V++   +    + +FK+N FN +AS+ +ALNRS+ D+R   CK  +Y  +LP+ S++I F+ E WSTLLRT  S + R+P+ +++EI+LVDD S ++FLK  L+ Y++   K  V V+R ++R GLIR RLKGA  + G V+ FLD+HCE    WL PLL  I  D RTV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++++  +R +L+CK F W++  I  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV +  CH  KGNQLW+Y      L HV + +CL    +  +Q   +  CT S +Q+W L NV
Sbjct:   47 VLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKK-LKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNV 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O45947|GLT10_CAEEL (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=gly-10 PE=1 SV=3)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 296/555 (53.33%), Postives = 387/555 (69.73%), Query Frame = 2
Query:  206 GLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKE--SIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENN-FKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYR-KYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQS-VYMDTCTSSSN-QKWYLENVKEDVI 1852
             L    L+P E     +KI W +     +E +REG GE G  V L   +   KE  S++K NG+N   SD ++LNRS+KDIRH +CK M+Y   LP+VS+I PF+EEH STLLR+  S + R+P  L+KEIILVDD S K  L+  L+ +++ N    IV+VLR  KREGLIR R  GA++ATG++LIFLD+H E N NWLPPLLDPIA+DYRTV CPF+DV+D +T+E R QDEGARG+FDW F YKRLPL  +D + P +PF SPVMAGG FAIS KWFWELGGYD GLDIWGGEQYELSFK+WQC G+M+D PCSR+AH+YR KYAPF +   +G+F++RNYKRVAEVWMD+Y++ LY+ +P     +AGDL     IRE+L+CKSF WFM EIAFD +K+YP+VEP  SA+GE+R+      G + C+D +F +   +  L  C  D+    GEQ   LT   D+R K R  C D   ++ K+PVIL+ CH  KGNQL+KY++  KQ+YH ++ +CLTAD   +  ++M  C SSS+ QKW  + V  +++
Sbjct:  124 ALGDEALDPFEKYRGHEKIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKN-AGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNV-----GTNFCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVDNELL 672          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|A8Y236|GLT10_CAEBR (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis briggsae OX=6238 GN=gly-10 PE=3 SV=2)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 297/560 (53.04%), Postives = 388/560 (69.29%), Query Frame = 2
Query:  200 AEGLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKE--SIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENN-FKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYR-KYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLT-WHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQS-VYMDTCTSSSN-QKWYLENVKEDVISR 1858
            A  L    L+P E     +KI W +     ++  REG GE G  V L   +   KE  S++K NG+N   SD ++LNRS+KDIRH +CKKM Y   LP+VS+I PF+EEH STLLR+  S + R+P  L+KEIILVDD S K  L+  L+ +++ N    IV++LR  KREGLIR R  GA+ ATG++LIFLD+H E N NWLPPLLDPIA DYRTV CPF+DV+D +T+E R QDEGARG+FDW F YKRLPL  +D + P +PF SPVMAGG FAIS KWFWELGGYD GLDIWGGEQYELSFK+WQC G+M+D PCSR+AH+YR KYAPF +   +G+F++RNYKRVAEVWMDEY++ LY+ +P     +AGDL     IRE+L+CKSF WFM EIAFD +K+YP++EP  SA+GE+R    N     LC+D +F +   +  L  C  ++    GEQ   LT WH D+R K R  C DV  ++ K+P+IL+ CH  KGNQL+KY++  KQ+YH V+ +CLTAD   +  ++M  C SSS  Q+W  + + ++++ +
Sbjct:   67 AAALGDEALDPFEKYRGHEKIKWEDEVAYEKDKAREGPGEWGKPVKLPDDKETEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKKMTYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKILRTKKREGLIRGRQLGAQEATGEILIFLDAHSECNYNWLPPLLDPIADDYRTVVCPFVDVIDCETYEIRPQDEGARGSFDWAFNYKRLPLTKKDRENPTKPFDSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGKMVDAPCSRVAHIYRCKYAPFKN-AGMGDFVSRNYKRVAEVWMDEYKETLYKHRPGIGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAIEPKASAEGEIRHVASN-----LCIDTQFKEQNQRFGLRKCASEDKDGGGEQDLRLTRWH-DIRPKGRKICFDVSTSVDKAPIILFDCHSMKGNQLFKYRMPQKQIYHPVSGQCLTADENGKGFLHMKKCDSSSKLQQWAWQTIDQELLDQ 619          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q49A17|GLTL6_HUMAN (Polypeptide N-acetylgalactosaminyltransferase-like 6 OS=Homo sapiens OX=9606 GN=GALNTL6 PE=2 SV=2)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 279/549 (50.82%), Postives = 375/549 (68.31%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+Y+ I +E+ R G GEHG    L  +E +  +S ++ NGFN   S+ +AL RS+ DIRH +CK  +Y + LP+ SIIIPF+ E W++LLRT  S + R P  L+ EIILVDD S +E LKDKL++Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCE N+NWLPPLL+ IA +++T+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ PE  +  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GD++AQ  +R++LKCK FKWFM  +A+D+ K+YP VEPP +A GE+R+   N     LC+D+K   + +++RL  CVKD S  T   EQ F   W ED+R    L +R  C D   +   SPV LY CHG KGNQLW Y+ D + L+H V+  C+  +   + ++M  C   S  Q+W  E++   V+ ++
Sbjct:   61 TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPL--TEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMARFSK--VRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN-----LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYRKD-RTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6P9S7|GLT10_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Mus musculus OX=10090 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 284/542 (52.40%), Postives = 358/542 (66.05%), Query Frame = 2
Query:  263 DWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISRY 1861
            DWHN + I  ++QR G GE G    +  +E    +  ++ NGFN   SDK++LNRS+ DIRHP+C   LY ++LP+ SIIIPF+ E WS+LLRT  S L R+P  LV EI+LVDD S +E LK  L+ Y+       VR+LR  KREGLIRTR+ GA  ATGDV+ FLDSHCE N+NWLPPLLD IA++ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ PE  K  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+ AQ  +R  L CKSFKWFMT+IA+DL K YP VEPP +A GE+R+      G  LC D K     S +RL  C++          Q F  TW ED+R      ++  C D   +   SPV LY CH  KGNQLWKY+ D K LYH V+  C+        V+M+TC  SS  Q+W  E+    V+  +
Sbjct:   73 DWHNKEAIRRDAQRVGYGEQGKPYPMTDAER--VDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA--LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV-----GTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYRKD-KTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENF 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q925R7|GLT10_RAT (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Rattus norvegicus OX=10116 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 283/542 (52.21%), Postives = 358/542 (66.05%), Query Frame = 2
Query:  263 DWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY-PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISRY 1861
            DWHN + I  ++QR G GE G    +  +E    +  ++ NGFN   SDK++LNRS+ DIRHP+C   LY ++LP+ SIIIPF+ E WS+LLRT  S L R+P  LV EI+LVDD S +E LK  L+ Y+       VR+LR  KREGLIRTR+ GA  ATGDV+ FLDSHCE N+NWLPPLLD IA++ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ PE  K  P+ PF+SPVMAGGLFA+ RKWFWELGGYDPGL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+ AQ  +R  L CKSFKWFMT+IA+DL K YP VEPP +A GE+R+      G  LC D K     S +RL  C++          Q F  TW ED+R      ++  C D   +   SPV LY CH  KGNQLWKY+ D K LYH V+  C+        ++M+TC  SS  Q+W  E+    V+  +
Sbjct:   73 DWHNKEAIRRDAQRVGNGEQGKPYPMTDAER--VDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA--LFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV-----GTGLCTDTKHGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYRKD-KTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLENF 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: R7V610 (Polypeptide N-acetylgalactosaminyltransferase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_197005 PE=3 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 338/602 (56.15%), Postives = 425/602 (70.60%), Query Frame = 2
Query:   89 MKRNCVSITKYAXXXXXXXXXXXXXYQNFFSSDKAWIA-----EGLK-------------HNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSN-QKWYLENV 1837
            M+RN +SI KY +   +         +     D   IA     EG+              H         +P +KIDWH+YK I  E QR G GE G+AVIL S E   K++++KVNGFNG ASDK++L RS+KDIRHP C+   Y   LP+VS+++PF+ EHWSTLLRT  S L+R+P  L+ EIILVDD S+KE     LD ++  ++ G V+V+ Q KREGLIRTRL GA+ ATGDVLIFLDSHCE N+NWLPPLLDPIA+DYRTV CPFIDV+D++TF YRAQDEGARGAFDWEF+YKRLPLLPEDLK+PARPFKSPVMAGGLFAIS KWFWELGGYDPGLDIWGGEQYELSFK+WQCGGQMLD PCSR+ H+YRK+APFP+   +G+F+ RNY+RVAEVWMDEY ++LY+R+P +     G++T Q AIR++L CK FKWFM EIAFDL K YP +EPP  A+GE+R+      G +LC+D +F        L  C KD   + GEQ+  +TWH+D+R   R  C DV  ++ K+PVILY+CHG KGNQ +KY  ++ Q++H +++ CL  D   + ++M +C   SN QKW  E V
Sbjct:    1 MRRNSISILKYLVLAALFLTLGPFLVKFMIPDDHDDIAPRGNAEGMPIEPGAVVRKSASDHESPEKSRADEPLQKIDWHDYKHIEIEKQRTGPGEQGAAVILSSDEEKKKDALYKVNGFNGFASDKISLQRSLKDIRHPQCRTQKYWNKLPTVSVVVPFHNEHWSTLLRTAESVLVRSPPELIHEIILVDDFSSKEHCGKPLDDHLATHYGGKVKVIHQPKREGLIRTRLAGAREATGDVLIFLDSHCEANVNWLPPLLDPIAEDYRTVVCPFIDVVDYETFAYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPARPFKSPVMAGGLFAISAKWFWELGGYDPGLDIWGGEQYELSFKLWQCGGQMLDAPCSRVGHIYRKFAPFPN-PGVGDFVGRNYRRVAEVWMDEYAEFLYKRRPQYRSIQPGNITEQLAIRKKLNCKPFKWFMEEIAFDLPKKYPPIEPPAVAEGEMRNV-----GANLCVDTRFKGQGETFGLEKCAKDEPGIGGEQRLQITWHKDIRPGKRSFCFDVSTSVEKAPVILYNCHGMKGNQWFKYDTETSQVFHPISRHCLDCDAERKEIFMSSCDKDSNTQKWKFEKV 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GGZ3 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011947g5 PE=3 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 331/531 (62.34%), Postives = 400/531 (75.33%), Query Frame = 2
Query:  233 DEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKW 1822
            D   DP + IDWH+YK I  E  R+G GE G  V LD+SEN   + +F+VNGFN L SDKM+L RS+ DIRH  C+   Y++ LP+ SIIIPF+EEHWSTLLRT +S + RAP+ LVKE+ILVDD S K FL D L++Y+  +F   VRVLR  KREGLIRTR+ GA+NATGDVLIFLDSHCE NINWLPPLL PIA +Y+TV CPFIDV+D +TF YRAQDEGARGAFDWEFYYKRLPLLPEDLK+P++PF SPVMAGGLFAIS KWFWELGGYDPGLDIWGGEQYELSFKIWQCGG+M+DT CSRI HVYRKYAPFP+   +G+FI RNY+RVAEVWMDEY +Y+Y R+P ++   AGDLT+Q  IRERL CK FKWFMT +AFDL   YP VEPP++A GE+RS        SLC+D +F        LA C+K    L+GEQ F+ T+ +D+    R  C DV Q+  K+PVILY CH QKGNQ WK   ++ QLYHV ++ CL ++     ++M++C S++  Q W
Sbjct:   63 DRTEDPNELIDWHDYKAIEAERARQGPGEQGKGVHLDASENKAADDLFRVNGFNALVSDKMSLFRSLADIRHSACQGERYRRGLPTASIIIPFHEEHWSTLLRTVVSCIHRAPRHLVKEVILVDDFSKKSFLGDPLEKYVSAHFTN-VRVLRNAKREGLIRTRIFGARNATGDVLIFLDSHCECNINWLPPLLHPIANNYKTVVCPFIDVIDFNTFAYRAQDEGARGAFDWEFYYKRLPLLPEDLKHPSKPFDSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGRMVDTGCSRIGHVYRKYAPFPN-PGVGDFIGRNYRRVAEVWMDEYAEYIYNRRPHYKSIPAGDLTSQREIRERLHCKPFKWFMTNVAFDLPLRYPPVEPPSAASGEIRSAA----DASLCIDTRFKGGMQSFGLAKCIKGGGGLSGEQNFIFTFRKDIHPADRAFCFDVSQHAVKAPVILYQCHYQKGNQHWKINPNTGQLYHVASRLCLDSEPARLEIFMNSCNSATQTQLW 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1W0WCD2 (Polypeptide N-acetylgalactosaminyltransferase OS=Hypsibius dujardini OX=232323 GN=BV898_12951 PE=3 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 326/542 (60.15%), Postives = 413/542 (76.20%), Query Frame = 2
Query:  239 ITDP-KKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISR 1858
            +T P  KKIDWHNY  I  ES+R G GEHG +VI+ + ENN K+ ++K NGFN LASDK+AL+R+VKDIRH  CKK  Y ++LP+VS+I+PF+ EHW+TLLRT +S L+R+P  L+KEIILVDD STK+FLK KLD YI+ + +  VRV+R  KREGLIR RL GA+ ATG VLIFLDSH E N+NWLPPLL+PIA++YRT TCPFID++D++TFEYRAQDEGARGAFDWE YYKRLPLLP D+K P  PFKSPVMAGGLFAISRK+FWELGGYD GLD+WGGEQYELSFKIWQCGG M+D PCSRI H+YRK+APF S   +G+F+ RNYKRVAEVWMDEY ++LY ++P +     G+L+ Q  +R+ LKCKSFKWFMTE+AFDL   YP VEPPN A GE+R+   N      C+D +F     +  L PC+KDN+   GEQ F LTWH+D+R K+R  C DV  +  KSP++LY+CH  +GNQ W+Y +++KQL+H V+ KC   D   + +++  C SS  +Q+W  E+    ++++
Sbjct:   51 VTRPLGKKIDWHNYDLIARESERTGPGEHGKSVIIPTEENNEKDELYKTNGFNALASDKIALDRAVKDIRHEGCKKKRYFENLPTVSVIVPFHNEHWTTLLRTAMSVLVRSPPALIKEIILVDDFSTKDFLKGKLDDYIKEHMQK-VRVIRAPKREGLIRARLLGAQAATGSVLIFLDSHSEPNVNWLPPLLEPIAENYRTTTCPFIDIIDYETFEYRAQDEGARGAFDWELYYKRLPLLPADIKNPTEPFKSPVMAGGLFAISRKFFWELGGYDEGLDVWGGEQYELSFKIWQCGGMMVDVPCSRIGHIYRKFAPF-SNPGVGDFVGRNYKRVAEVWMDEYAEFLYNKRPHYRNIETGNLSKQRKLRDTLKCKSFKWFMTEVAFDLMDRYPPVEPPNYAWGEIRNIASNQ-----CMDTRFKGQNERFLLEPCIKDNTENNGEQSFELTWHKDIRPKNRAVCFDVSTSDNKSPIVLYNCHNSQGNQQWRYTVETKQLFHPVSGKCADCDPERREIFVSDCDSSKLSQQWLFEHFNSTLLAK 585          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267EH10 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011947g1 PE=3 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 331/540 (61.30%), Postives = 401/540 (74.26%), Query Frame = 2
Query:  233 DEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQ---KWYLENVKE 1843
            D   DP + IDWH+YK I  E  R+G GE G  V LD+SEN   + +F+VNGFN L SDKM+L RS+ DIRH  C+   Y++ LP+ SIIIPF+EEHWSTLLRT +S + RAP+ LVKE+ILVDD S K FL D L++Y+  +F   VRVLR  KREGLIRTR+ GA+NATGDVLIFLDSHCE NINWLPPLL PIA +Y+TV CPFIDV+D +TF YRAQDEGARGAFDWEFYYKRLPLLPEDLK+P++PF SPVMAGGLFAIS KWFWELGGYDPGLDIWGGEQYELSFKIWQCGG+M+DT CSRI HVYRKYAPFP+   +G+FI RNY+RVAEVWMDEY +Y+Y R+P ++   AGDLT+Q  IRERL CK FKWFMT +AFDL   YP VEPP++A GE+RS        SLC+D +F        LA C+K    L+GEQ F+ T+ +D+    R  C DV Q+  K+PVILY CH QKGNQ WK   ++ QLYHV ++ CL ++     ++M++C  +      KW   + K+
Sbjct:   63 DRTEDPNELIDWHDYKAIEAERARQGPGEQGKGVHLDASENKAADDLFRVNGFNALVSDKMSLFRSLADIRHSACQGERYRRGLPTASIIIPFHEEHWSTLLRTVVSCIHRAPRHLVKEVILVDDFSKKSFLGDPLEKYVSAHFTN-VRVLRNAKREGLIRTRIFGARNATGDVLIFLDSHCECNINWLPPLLHPIANNYKTVVCPFIDVIDFNTFAYRAQDEGARGAFDWEFYYKRLPLLPEDLKHPSKPFDSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGRMVDTGCSRIGHVYRKYAPFPN-PGVGDFIGRNYRRVAEVWMDEYAEYIYNRRPHYKSIPAGDLTSQREIRERLHCKPFKWFMTNVAFDLPLRYPPVEPPSAASGEIRSAA----DASLCIDTRFKGGMQSFGLAKCIKGGGGLSGEQNFIFTFRKDIHPADRAFCFDVSQHAVKAPVILYQCHYQKGNQHWKINPNTGQLYHVASRLCLDSEPARLEIFMNSCNPARQTQLWKWGTTDAKQ 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1S3JMP6 (Polypeptide N-acetylgalactosaminyltransferase OS=Lingula unguis OX=7574 GN=LOC106174572 PE=3 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 320/536 (59.70%), Postives = 407/536 (75.93%), Query Frame = 2
Query:  233 DEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSS-SNQKWYLENV 1837
            +E  DP  KIDWHNYKQI EE +R+G GE GSAVIL   E   K  ++KVNGFN  ASDK++L+R++ DIRHPDCK   Y   LP+ S++IPF+ EHW+TLLR   S + R+PK L+ E+IL DD STK+FL  KLD Y++ +F   VR +R  KREGLIRTRL GAK ATGDVLIFLDSHCE N+NWLPPLL+PIAQ+ RT  CPFIDV+D + F YRAQDEGARGAFDWEF+YKRLPLLPEDL++P+ PFKSPVMAGGLFAI RKWFWELGGYDPGLDIWGGEQYELSFKIWQC GQM+D PCSR+ H+YRK+APFP+   IG+F+ +NY+RVA VWMDEY ++LYRR+P ++  + GDLT Q AIR++LKCK FK+FM E+AFDL+K+YP VEPP  A+GEVR+      G+ LC+D +F     +  L  C+ ++ +  GEQ+  L+WH+D+R K R+ C DV  ++ K+PVIL+ CHG +GNQL+KY   +KQ++H ++  CL +D   + ++M  C  +  +QKW  E +
Sbjct:   68 NEPVDPNAKIDWHNYKQIAEEKERKGPGEQGSAVILSPEEEQKKNDLYKVNGFNAYASDKISLDRALVDIRHPDCKHKKYLAKLPTASVVIPFHNEHWTTLLRNVHSLINRSPKSLLHEVILADDASTKDFLGQKLDDYLKEHFTN-VRTVRAKKREGLIRTRLLGAKAATGDVLIFLDSHCEANVNWLPPLLEPIAQNRRTAVCPFIDVIDFENFAYRAQDEGARGAFDWEFFYKRLPLLPEDLRHPSEPFKSPVMAGGLFAIDRKWFWELGGYDPGLDIWGGEQYELSFKIWQCHGQMVDAPCSRVGHIYRKFAPFPN-PGIGDFVGKNYRRVAVVWMDEYAEHLYRRRPHYKNIDPGDLTEQKAIRQKLKCKPFKYFMEEVAFDLKKYYPPVEPPPFAEGEVRNL-----GSGLCIDTRFRGQNEKFGLETCISESPKGGGEQQLELSWHKDIRPKKRNVCFDVSSSVHKAPVILFGCHGMQGNQLFKYNSKTKQIFHPISNHCLDSDSGNKEIFMTQCDENLQSQKWTFEKL 596          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: si:ch211-15e22.3 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:103040570])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 275/550 (50.00%), Postives = 370/550 (67.27%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY--PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENVKEDVISRY 1861
            TD  ++ DWH+ + I  +  R G GEHG    L  +E+   +S++K NGFN   S+ +AL+RS+ DIRHP+CK+ LY ++LP+ SIIIPF+ E WS+LLRT  S + R P  L+ EIILVDD S ++ L  +L+ Y+    K  VR++R  KREGLIRTRL GA  A G+VL FLDSHCETNINWLPPLLD IAQ+ RT+ CP IDV+DH+ F Y AQ  +  RGAFDWE YYKR+P+ P +L+   P+ P++SPVMAGGLFA+ R+WFWELGGYD GL+IWGGEQYE+SFK+W CGG M D PCSR+ H+YRKY P+   V  G  +ARN KRVAE WMDE+ +Y+Y+R+P +   + GDLTAQ  +R+ LKCK FKW+M  +A+DL K+YP VEP  +A GE+R+       + LC+D+K   + +++RL  C+K+ +  T   EQ F   W ED+R    L +R  C D       SPV LY CHG +GNQ W Y+ D K LYH+V+  C+      + ++M+ C   S  Q+W  + V   ++ ++
Sbjct:   60 TDGLRRRDWHDNESIRRDELRVGKGEHGKPYPL--AEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTIHSIVNRTPDHLIAEIILVDDYSDRDHLGARLEDYMSRFPK--VRIVRTKKREGLIRTRLLGASVAKGEVLTFLDSHCETNINWLPPLLDQIAQNPRTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPI-PLELQGSDPSNPYESPVMAGGLFAVRRQWFWELGGYDTGLEIWGGEQYEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK--VPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIRNA-----ASGLCVDSKHGSTGTELRLDTCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQ--SSPVTLYDCHGMRGNQHWSYRKD-KSLYHLVSSGCMDCSPADKRIFMNKCNPQSETQQWLFQRVNTTILDKF 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 266/509 (52.26%), Postives = 351/509 (68.96%), Query Frame = 2
Query:  365 ESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY--PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRL--TGEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSS-SNQKWYLENVKEDVISRY 1861
            +  ++ NGFN   S++++LNRS+ DIRHP+CK  LY + LP+ SIIIPF+ E WS+LLRT  S L R+P  L+ EIILVDD S +E LK  L+ Y+    K  VR+LR  KREGLIRTRL GA  A G+V+ FLDSHCE N+NWLPPLLD IAQ+ + + CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ P +L+   P+ PF+SPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+T Q  +R RL CK+FKWFMT++A+DL KHYP VEPP +A GE+R+      G+ LC+++K   S + +R+  CVK       +  Q F   W ED+R    L ++  C D   +   SPV LY CHG KGNQLW+Y+ D K LYH ++  C+  +   + V+M++C +S + Q+W  E     V+ ++
Sbjct:    8 DQAYRENGFNIYVSNRISLNRSLPDIRHPNCKLKLYSERLPNTSIIIPFHNEGWSSLLRTVHSILNRSPPELIAEIILVDDFSDREHLKASLEDYMVRMPK--VRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANVNWLPPLLDRIAQNRKAIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPI-PAELQKDDPSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPGGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVTTQKELRARLNCKNFKWFMTDVAWDLPKHYPPVEPPAAAWGELRNV-----GSGLCMESKHFSSGTPLRMEVCVKGRGETAWSHGQVFTFGWREDIRVGDPLHTKKVCFDAISH--NSPVTLYDCHGMKGNQLWRYRKD-KTLYHPISNSCIDHNPNEKRVFMNSCDASIATQQWVFERTNSTVLDQF 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 400.979 bits (1029), Expect = 2.701e-132
Identity = 209/519 (40.27%), Postives = 299/519 (57.61%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDT---CTSSSNQKWYLEN 1834
            EG GE G AVI+   +    + +FK+N FN +ASD +ALNRS+ D+R   CK  +Y   LP+ SI+I F+ E WSTLLRT  S + R+P+ L+ EI+LVDD S ++FLK KL+ Y++   +  VR+LR ++R GLIR RL+GA    G V+ FLD+HCE  + WL PLL  I +D + V CP IDV+  +TFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YDPG+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   R + GD++A+ A+RE L+CK F W+       LE  YP  + P    + GE+R+   N      C+D    K   ++    C      + G Q F  ++  D  +++ D CLDV +     PV++  CH  KGNQ+++Y  +     H++TQ CLT        Y  T   C  S  Q W L N
Sbjct:   55 EGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKT-LEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWY-------LENIYPDSQIPRRYFSLGEIRNVETNQ-----CVDNMGRKENEKVGFFNC----HGMGGNQVF--SYTADKEIRTDDLCLDVSR--LNGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGPTVEYCDDSPLQTWVLRN 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 400.208 bits (1027), Expect = 3.693e-132
Identity = 205/519 (39.50%), Postives = 308/519 (59.34%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            +G GE G  V++   ++   + +FK+N FN +AS+ +ALNRS+ D+R   CK  +Y   LP  S++I F+ E W+TLLRT  S + R+P+ L++E++LVDD S ++FLK KL+QY+    +  VR++R ++R GLIR RLKGA  +TG V+ FLD+HCE  + WL PLL  I QD +TV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD+  + ++R++L+CK F W++  +  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV++  CH  KGNQLW Y      L HV + +CL   ++  +Q   +  CT S +Q+W L NV
Sbjct:   54 DGPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRK-LEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIPRHYYSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRSQQWLLRNV 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 397.897 bits (1021), Expect = 2.434e-131
Identity = 209/521 (40.12%), Postives = 304/521 (58.35%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYM----DTCTSSSNQKWYLENV 1837
            EG GE G AVI+   +    + +FK+N FN +ASD +ALNRS+ D+R   CK  +Y   LP+ SI+I F+ E WSTLLRT  S + R+P+ L+ EI+LVDD S ++FLK KL+ Y++   +  VR+LR ++R GLIR RL+GA    G V+ FLD+HCE  + WL PLL  I +D + V CP IDV+  +TFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YDPG+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   R + GD++A+ A+RE L+CK F W+       LE  YP  + P    + GE+R+   N      C+D    K   ++    C      + G Q F  ++  D  +++ D CLDV +     PV++  CH  KGNQ+++Y  +   L HV + +CL  D P++   M      C  S +Q+W L N+
Sbjct:   55 EGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKT-LEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWY-------LENIYPDSQIPRRYFSLGEIRNVETNQ-----CVDNMGRKENEKVGFFNC----HGMGGNQVF--SYTADKEIRTDDLCLDVSR--LNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCL--DMPSEEDKMVPTLRDCNGSRSQQWLLRNM 552          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 345.125 bits (884), Expect = 9.196e-113
Identity = 187/477 (39.20%), Postives = 264/477 (55.35%), Query Frame = 2
Query:  455 CKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLY--HVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENVKEDVIS 1855
            CK  +Y   LP  S++I F+ E WSTLLRT  S + R+P+ +++EIILVDD S ++FLK  L++Y  +     V ++R + R GLIR RL+GA  + G V+ FLD+HCE    WL PLL  I  D + V CP IDV+  +TFEY A  +   G F+W+  ++  P+   ++         P +SP MAGGLFAI R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMD ++ + Y   P   +   GD++ + A+R+RLKCK F WF       LE  YP+ + P    + GEVR+   N      CLD    K   +I +  C      + G Q F  ++  D  L++ D CLDV +     PV++  CH  KGNQLW Y    ++L   H  + +CL    +   Q   M  C    +Q+W L N+    IS
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEY-ASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWF-------LENVYPNSQIPRHYYSLGEVRNVETNQ-----CLDNMGRKENEKIGIFNC----HSMGGNQVF--SYTADKELRTDDLCLDVSR--MNGPVLMLKCHHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMRECDGGRSQQWILRNMTVAAIS 456          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 337.421 bits (864), Expect = 3.312e-109
Identity = 189/511 (36.99%), Postives = 283/511 (55.38%), Query Frame = 2
Query:  329 AVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP---ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSD-----GNSLCLDAKFAKSE--SQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQ---SVYMDTCTSSSNQKW 1822
             +I    +   ++  ++ + FN L S+++  +R++ D RHP C    Y   LP+ S++I FY E  S LLRT  S   R P  L+ E++LVDD S    L++ L++ ++  F   V+++R +KREGLIR R+ GA +ATGDVL+FLDSHCE N+ WL PLL  +A++  TV CP ID+++ DTF Y A     RG F+W  +++  P+    L  P     P KSP MAGGLFA+ RK+F +LG YD G+DIWGGE  E+SF+IW CGG +   PCSRI H++RK  P+ S     + ++RN  R+A VW+DEY++     +P       GD++ + A+RERL C+ F+W++  +  ++E   P +     +    R K              CL A    SE    + + PC  D+  +  EQ ++    ++L+L +   CLD+P+   ++   L  CHG  G+Q W       +LY V   +CL     T     V M+ C  S  Q+W
Sbjct:    1 GMIYSREDQETRDLGYQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKVKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLYSASPL-VRGGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAG-ADTMSRNSLRLAHVWLDEYKEQYLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPEIEVGRPQLPQAVLSKMHKRPKPVQRGRLRHLQTGKCLVAHNDPSEKGGLVVVRPC--DSGDI--EQVWVYNEGQELQLANL-LCLDMPEMEPRASPRLMKCHGSGGSQQWTMG-KFNRLYQVSLGQCLQVKSMTDVKGRVVMEICNGSEQQQW 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 333.954 bits (855), Expect = 1.455e-107
Identity = 202/524 (38.55%), Postives = 290/524 (55.34%), Query Frame = 2
Query:  308 GVGEHGSAVILDSSENNLKESIFKVNG--FNGLASDKMALNRSVKDIRHPDCKKMLYQ-KSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWE--FYYKRLPLLPEDL-KYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFL-LTWHEDLRLKSR--DECLDVPQNMFKSPVILYSCHGQKG----NQLWKYKLDSKQLYHVVTQKCLTA-----DGPTQSVYMDTCTSSSNQKW 1822
             +GE G AV L+      ++    +N    N   SD+++L+R + +  +P C++  Y  + LP+ S++I FY E WSTLLRT  S L  +P  L+ EIILVDD S +E L+D+L+QYI    K  VR++R  KREGL+R RL GA  ATGDVL FLD HCE ++ WL PLL+ IA++   V CP IDV++ +TFEY     E   G FDW   F +  +P   +   K P    +SP MAGGLFA+S+K+F  LG YD G+++WGGE  E SF+IWQCGG +   PCS + HV+ K AP+     + N +     R AEVWMD Y++  Y R P    E  GD+T +  +RERL+CK+FKWF       LE  YP +  P    G+    + N   ++ C D      E+Q+     +       G+ +F   T  +++R  +R  + C  V   M    + +Y CH +      NQ + ++ D   ++H++TQKCL A      GP     + TC  ++ Q+W
Sbjct:   26 ALGEMGKAVRLNLEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIATLRK--VRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYSRSKALANSV-----RAAEVWMDGYKELYYHRNPHARMEPFGDVTERRNLRERLQCKTFKWF-------LENVYPDIHVPEDRPGKF-GMLKNRGLSNYCFDYN-PPDENQVTGQRIILYGCHGMGQNQFFEYTSEQEIRYNTRQPEACAAVDNGM--DYLTMYYCHSKNSPVTENQKFDFREDGS-IFHILTQKCLEAVEQPNSGPLP--LLRTCDGNTRQRW 528          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 314.694 bits (805), Expect = 1.467e-99
Identity = 197/529 (37.24%), Postives = 278/529 (52.55%), Query Frame = 2
Query:  308 GVGEHGSAVILD----SSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQ-KSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKYPA---RPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFA---KSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDE-CLDVPQNMFKSPVILYSC----HGQKGNQLWKYKLDSKQLYHVVTQKCLTA----DGPTQSVYMDTCTSSSNQKWYLE 1831
             +GE   A  L+    SSE  L+E   +    N   SD+++L+R + D R  +CK   +  + LP+ S++I FY E WSTLLRT  S L  +P  L++EIILVDD S + +LK  L+ YI    +  VR++R  +REGL+R RL GA +ATG VL FLD HCE    W+ PLL  I +    V CP ID +D +TFE+  Q  E A G FDW   ++   +   +    A    P +SP MAGGLFA+S+K+F  +G YD G+++WGGE  ELSF++WQCGG +   PCS + HV+ K AP+P    + N +     R AEVWMD Y+++ Y R P   +E  GDL+ +  +RE+L CKSF+W++  I  DL  H P   P     G +++K   S+    C+D        + + + L PC        G Q F  T  +DLR  S  E C +V     K  V +  C         + +W ++ D   +Y+     CLTA    DG              NQ W  +
Sbjct:   76 ALGEWAKAARLNLPEGSSERKLEEESIERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTLER--VRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYPRPRFLQNTV-----RAAEVWMDSYKEHFYNRNPPGRKEKYGDLSERKTLREKLGCKSFEWYLKNIYPDL--HVPEDRP--GFHGAIQNKGIQSE----CIDYNAPDNNPTGAMLSLYPCHGQG----GNQFFEYTTRKDLRFNSATELCAEVRDG--KPQVAMRHCPPDSQSNPPSVMWDFREDGT-VYNAHRNACLTAFRKPDGRADIEIRPCMPDDKNQMWTFQ 582          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008097.1 (pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1 gene:ENSPMAG00000007303.1 transcript:ENSPMAT00000008097.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.597 bits (771), Expect = 7.016e-94
Identity = 198/529 (37.43%), Postives = 298/529 (56.33%), Query Frame = 2
Query:  338 LDSSENNLKESIFKVNGFNGLASDKMALNRSV-KDIRHPDCKKMLYQK--SLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGA----RGAFDWEFYYKRLPL------LPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAP--FPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSW----ERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSE--SQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLK-SRDECLDVPQNMFKSPVILYSCHGQKGN------QLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTS-SSNQKW-YLEN 1834
            L   E  +KE   + + FN  ASDK++L+R +  D R P+C +  +++  S+PS S+II F+ E WSTLLRT  S +  +P  L+KEIILVDD S  ++LK  LD+Y++    GIV+V+RQ +R+GLI  RL GA  A G+VL FLD+HCE    WL PLL  I Q+  +V  P I  +D +TFE       +    RG FDW   +   P+      L +D  YP R   SP  AGGLF+IS+K+F  LG YD  ++IWGGE  E+SF++WQCGGQ+   PCS + HV+R  +P  FP  V++   I RN  R+AEVWMD+Y+   YRR        + +  GD+T +  +R++L+CK+F W++T +    E   P + P  +  G +++K   + GN  CLD    ++E    + L PC      + G Q F  +  ++LR   +++ CL            L  C  + G+      +LW+ + + K  +++ TQ+CLT+ G  ++  M  C     +Q+W +++N
Sbjct:  133 LSPEEKAIKEKGMEKHCFNVYASDKVSLHRDLGPDTRPPECIEQKFKRCPSMPSTSVIIVFHNEAWSTLLRTVHSVMYTSPSVLLKEIILVDDASVDDYLKGPLDEYVKQF--GIVKVVRQQERKGLITARLLGASVAQGEVLTFLDAHCECFNGWLEPLLARIRQNETSVVSPDISTIDMNTFEVNKPSAYSPAHNRGNFDWGLTFGWEPIPSRERTLRKDQTYPIR---SPTFAGGLFSISKKYFEYLGTYDDQMEIWGGENIEMSFRVWQCGGQLEIIPCSIVGHVFRTKSPHTFPQGVSV---ITRNLVRLAEVWMDDYKDIFYRRNSQAAEIVKNKAYGDVTWRKRLRDKLQCKNFTWYLTNVY--PEMFVPDLHP--NIFGAIKNK---AKGN--CLDTGSFQNEVGKPLILYPC----HGMGGNQYFEYSSQKELRHNVAKEMCLHAAMGAMH----LEDCKYKGGSSLPPTYELWELRPE-KLFFNMGTQQCLTSKG--ENPTMAPCDHMDEHQQWEFIQN 633          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 405.216 bits (1040), Expect = 5.379e-136
Identity = 202/466 (43.35%), Postives = 300/466 (64.38%), Query Frame = 2
Query:  308 GVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDL---KYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQ 1696
            G GE+G  V   + + + K++ +   GFN   SD+++L R++ D RH  CK+  Y  +LP  S++I F+ E WSTL+RT  + L+R+P  +++EI++VDD S K+FLK KLD Y +    G ++++R  +R GLI+ R+ GA NA G+V+IFLD+HCE N  WLPPLL+ IA + RT  CP ID +DH TF+Y+  D   RG F+W F YK   + PE++   + P +  KSPVMAGGLFAI+R++F ELG YDPG+ IWGGEQYE+SFK+WQCGGQ+ + PCSR+ HVYR + P+    +    +  N++RVAEVWMDEY+ +LY ++P  +  + GD++ + A+R+RLKCKSFKW++  +A D      +V+    A  +VR++     G ++CLD+   + +  + LA C      + G Q F  T+  +LR  + + C DV ++   + V  + CH  KGNQ
Sbjct:    1 GPGENGEPVETKAEDESKKDAAYSEFGFNQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDYTKK--LGKIKIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPMDPYIRGTFNWRFDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHVYRHHVPYTYPKHDATLV--NFRRVAEVWMDEYKDWLYDKRPEIKSVDYGDISDRIALRKRLKCKSFKWYLENVAND------TVKTKLCACFQVRNQ-----GKNMCLDS-MGRKDGHVGLASC----HNMGGNQAFQYTYIRELR--TDETCFDVHESFPGAKVHFFPCHEMKGNQ 444          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 377.096 bits (967), Expect = 3.632e-124
Identity = 207/523 (39.58%), Postives = 297/523 (56.79%), Query Frame = 2
Query:  311 VGEHGSAVILDSSENN-LKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKM--LYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEG-ARGAFDWEFYYKRLPLLPEDLKY---PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKY-APFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFL---LTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPT-QSVYMDTCTSSSNQKWYLENVKE 1843
            +G  G    L+S EN  L E  F  + FN L SDK++L+R++ D+R   CK     Y   LP+ S+II F++E  S LLRT  S + R P  L+ E+I+VDD S    L   LD ++    K  V+VLR  KREGL+R RL+GA  A GDVL FLDSHCE    W  PLL  IA D R V CP I+V++ DTF Y+       RG F W+ ++K   + PE+ K     + P ++P MAGGLF+I R++F+++G YD  +DIWGGE  ELSF++W CGG++    CSR+ HV+RKY +P+     +   + +N+ R+AEVWMDEY+   Y ++P  +  + GD++ +  +R+RLKCKSFKW++  I  D++   P ++PP  A GEVR+   N      CLD+  AK E   R+              K++   L + E       + C DV +    +PV L  CHG +GNQ WK+  +   L H  TQ+CL    P+ Q   M+ C    +Q+W   + ++
Sbjct:    7 LGGGGKPAFLESEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCKAKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQFTK--VKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDSDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDVQ--MPELDPP--ARGEVRNPSSNQ-----CLDSLGAKPEHNARVGIYTCHGQGGNQVSKYMPRELIFEE-------ENCFDVSKTHPGAPVELMKCHGMRGNQEWKHDREKGTLMHFTTQQCLDRGSPSDQYAVMNPCDGRESQRWVFSHYRQ 511          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 368.622 bits (945), Expect = 4.517e-121
Identity = 208/513 (40.55%), Postives = 300/513 (58.48%), Query Frame = 2
Query:  308 GVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKM--LYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDE-GARGAFDWEFYY--KRLPLLPEDLKYPARPF-KSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKY-APFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERE-NAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKW 1822
            G+G+ G A  L +         F  + FN + SD+++L+R +KD+R P CK+   LY ++LP+ S+II F+ E  S LLRT  S L  +P  L+ +IILVDD S  + LK  L  +I    K  V+++R   R+GL+  RL+GA+ A G+VL FLDSHCE    WL PLL  IA+D R V CP I+V++ D F Y+A D    RG F W+ ++  K +P   +  +     + +SP MAGGLFAI +K+F++LG YD  ++IWGGE  E+SF+IW CGGQ+   PCSR+ HV+RKY +P+         +ARN+ R+AEVWMDEY+ + YR++   ER  + GD++ + A+R+RL CKSFKW++  I  D+        PP S    + S    +  +SLCLD    K+  ++ L  C      + G Q F LT   ++ L + D+CLD P     S V + +CHG KGNQ WK+      + HV T+ CL      Q + ++ C  SS Q+W
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISMLNK--VKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKL----PPKSY---LYSHQIRNKESSLCLDTLGEKNIKRVGLYTC----HGMGGNQFFTLTKSNEI-LFNDDKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCLDISQDGQFIIVNPCDGSSTQRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO34355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN9])

HSP 1 Score: 366.696 bits (940), Expect = 3.848e-120
Identity = 204/521 (39.16%), Postives = 292/521 (56.05%), Query Frame = 2
Query:  329 AVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP---ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEV-------------RSKVF-----NSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPT--QSVYMDTCTSSSNQKW 1822
             ++ +S +   +E  +  +GFN L S++++L+R++KD RH  C+   Y K+LP  SI+I FY E W+ LLRT  S L R P   + EIILVDD S    LK KLD+Y+    K  +R++R +KREGLIR R+ GA+ ATG VL+FLDSHCE NINWL PLL  I  D + V CP IDV+  DTFEY +     RG F+W  ++   P+ P  L  P    +P +SP MAGGLFA+ R++F +LG YD G+DIWG E  E+SF+IW CGG +   PCSR+ H++R++ P+ S    G+ ++RN  R+AEVW+D Y+KY Y+ +   E +  GD++ +  +R+ L+CKSF+W++  I       YP ++PP    G               + KV       S  +  CLD+    SE +   A  V      T  + + L    +L+++S   CL+      K  + L  CH Q G Q WK+      LYH  T  CL  +      +  M  C  S +Q+W
Sbjct:    3 GIVKNSDDIRTREEGYSAHGFNLLISNRLSLHRTIKDTRHELCRGKTYPKNLPVASIVICFYNEAWTILLRTIHSVLDRTPHQFLHEIILVDDFSNMLELKSKLDRYLSTMPK--IRIVRNNKREGLIRGRIIGAEAATGQVLVFLDSHCEVNINWLQPLLQHIHDDQKAVACPVIDVISSDTFEY-SSSPMVRGGFNWGLHFTWEPIPPSLLVKPEDYVKPIRSPTMAGGLFAVDREYFTQLGKYDSGMDIWGAENLEISFRIWMCGGSLDILPCSRVGHLFRRFRPYGSDSK-GDTMSRNSMRLAEVWLDGYKKYFYQIRHDLEGKKFGDISQRIKLRKSLQCKSFEWYLKNI-------YPELKPPGQPGGGAFYPIDRRPQVVIWKGKVICIQLQTSFDDGYCLDSPGHPSEKK---ASAVIHQCESTKSRFWSLNEDGELKIESL-LCLEASGYQSKLGLRLMKCHAQGGGQQWKFLNKKSVLYHPATGLCLGVNESRTYSTPGMQICDYSIHQQW 508          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO38151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDQ3])

HSP 1 Score: 325.094 bits (832), Expect = 2.804e-103
Identity = 192/502 (38.25%), Postives = 269/502 (53.59%), Query Frame = 2
Query:  350 ENNLKES--IFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYK--RLP--LLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADG-PTQSVYMDTCTSSS-NQKWYLE 1831
            EN   E    +  N +N   SD++ ++R V D+R   CK  ++   LP+ +III F+ E  S LLRT ISAL R+P  L+KEIILVDD S+      +L +  +      V+++R  KREGLIR+R+KGA  A G+VL FLDSHCE N NWL PLL  I +  +T+  P IDV++ DTF+Y       RG F W   +K   LP  +L E    P  P KSPV+AGGLF++++KWF  LG YD  +D+WGGE  E+SF+ WQCGG M   PCSR+ HV+R   P+       N   +N +R  EVWMD+Y++Y Y   P  +    GD+  +  +R +L+C+ FKW++  +       YP ++ P  +D   +S      GN  C+D         I L  C        G Q + LT  +   LK    CL V       PV L  C      Q W+Y+  + +L H  T  CL++D   T  + ++ C  S+ +Q W  E
Sbjct:   93 ENGFHEGDDAYAKNAYNIKKSDQLPVDREVPDVRDQQCKSQVWPHDLPTTTIIICFHNEGRSALLRTVISALNRSPPHLLKEIILVDDFSSDPKDGRRLLKLPK------VKLIRNTKREGLIRSRVKGANLARGEVLTFLDSHCECNKNWLEPLLLRIKESPKTIVSPIIDVINLDTFDYLGSSADLRGGFGWNLNFKWDFLPPHILAERQGKPTLPIKSPVIAGGLFSVAKKWFETLGKYDMQMDVWGGENLEISFRTWQCGGAMEIIPCSRVGHVFRNRHPYQFPGGSMNVFQKNTRRAVEVWMDDYKRYYYAAVPYAKNTPYGDIEERVELRRKLRCRPFKWYVQNV-------YPELKLP--SDESTKSFGEIKQGNQ-CVDTLGHMRGQTIGLFEC----HGAGGNQMWSLT--KSSLLKHETMCLGVNDGKATEPVQLLDCDENNSMQHWEYEKATSRLRHKPTSLCLSSDKHKTSGLTLEQCNGSAFSQHWAFE 572          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101171188])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 285/546 (52.20%), Postives = 372/546 (68.13%), Query Frame = 2
Query:  254 KKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY--PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLT--GEQKFLLTWHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENVKEDVISRY 1861
            +K DWH+Y+ I  ++ R G GE G A  L  ++    +  ++ NGFN   SD+++LNRSV DIRHP+CK+ LY + LP+ SIIIPF+ E WS+LLRT  S L R+P  L+ EIILVDD S K+ LK  L++Y+    K  VR+LR  KREGLIRTRL GA  A G+V+ FLDSHCE NINWLPPLLD IA + +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ P +L+   P+ PF+SPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +ARN KRVAEVWMDEY +Y+Y+R+P +   +AGD+ AQ  +R  L CKSFKWFM E+A+DL KHYP VEPP +A GEVRS       + LCL++K   S + IRL  CVK  + ++    Q F   W ED+R    + ++  C D   +   SPV LY CHG +GNQLW+Y+ D K LYH V+  C+ ++   + V+M+ C  +S++Q+W  E     V+  +
Sbjct:   69 RKKDWHDYEAIRRDATRSGNGEQGKAFPLTDADR--VDQAYRENGFNIFVSDRISLNRSVPDIRHPNCKQKLYAERLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPQLIAEIILVDDFSDKDHLKGALEEYMVRLPK--VRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANINWLPPLLDRIALNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPI-PAELQKNDPSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPGGVSLARNLKRVAEVWMDEYAEYVYQRRPEYRHLSAGDVAAQKELRSTLNCKSFKWFMKEVAWDLPKHYPPVEPPAAAWGEVRSA-----ASGLCLESKHFVSGTPIRLESCVKGRADVSWGHGQVFTFGWREDIRVGDPMHTKKVCFDAVSH--HSPVTLYDCHGMRGNQLWRYRKD-KSLYHPVSNSCVDSNASERRVFMNVCNPASASQQWLFEKTNATVLELF 599          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101160340])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 278/550 (50.55%), Postives = 376/550 (68.36%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQ-DEGARGAFDWEFYYKRLPLLPEDLKY--PARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLT--WHEDLR----LKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSS-NQKWYLENVKEDVISRY 1861
            +D  ++IDWH+YK +  ++ R G GE G    +  +E +  +  ++ NGFN   S++++LNRS+ DIRH +C++ LY + LP+ +IIIPF+ E WS+LLRT  S + R+P  LV EIILVDD S KE LK  L++Y++   K  VR+LR  KREGLIRTRL GA  A G+V+ FLDSHCE N+NWLPPLLD I Q+ +T+ CP IDV+DHD F Y  Q  +  RGAFDWE YYKR+P+ P +++   P  PF+SPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D PCSR+ H+YRKY P+   V  G  +A+N KRVAEVWMDEY +Y+Y+R+P +   +AGD++AQ  +R  L CK+F+WFM E+A+DL KHYP VEPP +A GE+RS      G+ +C++ K   S S IRL  CVK    ++     +LT  W ED+R    + +R  C D   +   SPV LY CHG KGNQLW+Y+ D K L+H V+  C+ +    + V+M+TC  +S +Q+W  E   + V+ R+
Sbjct:   64 SDGVRRIDWHDYKAMRRDAARAGNGEQGKPFPV--TETDRVDQAYRENGFNIYVSNRISLNRSLPDIRHENCRQKLYAEKLPNTTIIIPFHNEGWSSLLRTVHSVINRSPPRLVAEIILVDDFSDKEHLKVALEEYMKRFPK--VRILRTKKREGLIRTRLLGAGAAKGEVITFLDSHCEANVNWLPPLLDRIVQNRKTIVCPMIDVIDHDNFGYDTQAGDAMRGAFDWEMYYKRIPI-PAEMRTDDPTEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK--VPGGISLAKNLKRVAEVWMDEYAEYVYQRRPEYRHLSAGDMSAQKELRSHLNCKNFRWFMEEVAWDLPKHYPPVEPPAAAWGEIRSV-----GSGMCMEIKHFVSGSPIRLESCVKGRGDVSWSHGQVLTFGWREDIRVGDPMHTRKVCFDAVSH--HSPVTLYDCHGMKGNQLWRYRKD-KSLFHPVSNSCIDSSASERRVFMNTCDPTSLSQQWLFERTNDTVLERF 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 403.675 bits (1036), Expect = 1.598e-133
Identity = 210/520 (40.38%), Postives = 308/520 (59.23%), Query Frame = 2
Query:  302 REGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            R+G GE G  V++        + +FK+N FN +AS+ +ALNRS+ D+R   CK  LY   LP  S++I F+ E WSTLLRT  S + R+P+ L++EI+LVDD S ++FLK +L+QY+    +  VRV+R ++R GLIR RLKGA  +TG V+ FLD+HCE  + WL PLL  I QD RTV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++ + ++R++L+CK F W++  I  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV++  CH  KGNQLW+Y      L HV + +CL   ++  +Q   +  CT   +Q+W L NV
Sbjct:   53 RDGPGEGGKPVVIPKENQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRR-LEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDCTHVRSQQWLLRNV 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 403.675 bits (1036), Expect = 1.598e-133
Identity = 210/520 (40.38%), Postives = 308/520 (59.23%), Query Frame = 2
Query:  302 REGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFD--LEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL--TADGPTQSVYMDTCTSSSNQKWYLENV 1837
            R+G GE G  V++        + +FK+N FN +AS+ +ALNRS+ D+R   CK  LY   LP  S++I F+ E WSTLLRT  S + R+P+ L++EI+LVDD S ++FLK +L+QY+    +  VRV+R ++R GLIR RLKGA  +TG V+ FLD+HCE  + WL PLL  I QD RTV CP IDV+  DTFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   + + GD++ + ++R++L+CK F W++  I  D  + +HY S+       GE+R+   N      CLD    K   ++ +  C      + G Q F  T ++++R  + D CLDV +     PV++  CH  KGNQLW+Y      L HV + +CL   ++  +Q   +  CT   +Q+W L NV
Sbjct:   53 RDGPGEGGKPVVIPKENQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRR-LEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSL-------GEIRNVETNQ-----CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIR--TDDLCLDVSK--LNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDCTHVRSQQWLLRNV 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 397.512 bits (1020), Expect = 6.632e-131
Identity = 208/528 (39.39%), Postives = 301/528 (57.01%), Query Frame = 2
Query:  305 EGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYP----ARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNS--ADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDT---CTSSSNQKWYLENVKEDVISRY 1861
            EG GE G AV +   +    + +FK+N FN +ASD +ALNRS+ D+R   CK  +Y   LP+ SI+I F+ E WSTLLRT  S + R+P+ L+ EI+LVDD S ++FLK KL+ Y+    +  V++LR ++R GLIR RL+GA   TG V+ FLD+HCE    WL PLL  I +D   V CP IDV+  +TFEY A  +   G F+W+  ++  P+   ++         P ++P MAGGLF+I + +F E+G YDPG+DIWGGE  E+SF+IWQCGG +    CS + HV+RK  P+      G  I +N +R+AEVWMDE++ + Y   P   R + GD++++ A+RE LKCK F W+       LE  YP  + P    + GE+R+   N      C+D    K   ++    C      + G Q F  ++  D  +++ D CLDV +     PV++  CH  KGNQ+++Y  +     H++TQ CLT        Y  T   C +S  Q W L N     ++R+
Sbjct:   55 EGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRT-LEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWY-------LENIYPDSQIPRRYYSLGEIRNVETNQ-----CVDNMGRKENEKVGFFNC----HGMGGNQVF--SYTADKEIRTDDLCLDVSR--LNGPVVMLKCHHMKGNQMFEYDAEKHSFLHIITQSCLTISRLEDGTYGPTVEYCDNSPAQSWILRNYTRLEVARH 561          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000077709.1 (SMESG000077709.1)

HSP 1 Score: 1199.5 bits (3102), Expect = 0.000e+0
Identity = 590/591 (99.83%), Postives = 590/591 (99.83%), Query Frame = 2
Query:   89 MKRNCVSITKYAXXXXXXXXXXXXXYQNFFSSDKAWIAEGLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKWYLENVKEDVISRY 1861
            MKRNCVSITKYAITFLICFLFLIIFYQNFFSSDKAWIAEGLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCE NINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKWYLENVKEDVISRY
Sbjct:    1 MKRNCVSITKYAITFLICFLFLIIFYQNFFSSDKAWIAEGLKHNELNPDEITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCEANINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSSSNQKWYLENVKEDVISRY 591          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000070134.1 (SMESG000070134.1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 298/527 (56.55%), Postives = 395/527 (74.95%), Query Frame = 2
Query:  260 IDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSS-SNQKWYLENV 1837
            +DWHNY QI EE +R G GE GS V +  +E   ++ I+K NG++G ASDK+++ RS++DIRHP CK + Y KSLPSVS+IIPF++EHWS L+RT  S + RAP GL+KE+ILVDD S K FL+  L+ +++ ++  I +VLR + R+GLIRTR+ GAK A GDVLIFLDSH E N+NWLPPLL+PIA++Y+TVTCPFIDV+++DTFEY +QDEGARG FDW F YKR+P    D  +PA PF+SPVMAGGLFAISRKWFWELGGYD GLDIWGGEQYE+SFK+WQCGG+MLD PCSRI HVYRKY+PFP+    GNFI+RN+KRVAEVWMDE+++YLY R+P+   E+  +LT QFAIRE+L CK+F WFM E+AFDL  +YP +EP     GE+  K+ N +  S+C+D KF  S   + L+PC+  N +  GEQ F+L+W  +++ K RD C+D   ++    V+L+ CHG +GNQ +KYKL+S+Q+  V +  CL  D  ++ + + TC  + ++QKW   +V
Sbjct:   66 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYP-IAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDVPCSRIGHVYRKYSPFPNNAK-GNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEI--KLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSV 588          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000027520.1 (SMESG000027520.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 273/536 (50.93%), Postives = 368/536 (68.66%), Query Frame = 2
Query:  242 TDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRR-QPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYP-SVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDT--CTSSSNQKWYLENV 1837
            +D + KIDW N+  I EE+ R G GE G  V L ++EN   + + + NG+N LASDK++++RS+KD+R   CK + Y   LP  SIIIPF+ EHWSTLLRT  S L R+P  LVKEIILVDD STKEFL +KL+QY+  +F   VR+LR  KREGLIR RL GA  A G VLIF+DSHCE  INWLPPLL PI   Y+T++CPFIDV+ ++ F  R QDEG RGAFDW F YKRLP L +D  +P +PF +P+MAGGLFAIS+ WF ELGGYD GLD+WGGEQYELSFK+W CGG+M+D PCSR+ HVYRK+ PF +VV +GN++ARN+KR+AEVWMD++++Y+Y++ Q  +   + GDLT Q  +R+ L C SF WFM +IA+DL + YP   +P N + G+++S++       LC D          R++ C    + ++ EQ    TW  +++ + RD CLD P+      + ++SCHG  GNQ W Y  +S Q+ HVV++KC+      +S+ ++   C+  S+QKW LEN+
Sbjct:   57 SDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTK-VRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPF-AVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEI----NPHLCFDFNLGNPGDPFRISNC----TDVSNEQNLAFTWEMEIKPQKRDICLDYPRK--GEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKSSQKWILENM 580          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 410.223 bits (1053), Expect = 4.955e-136
Identity = 199/485 (41.03%), Postives = 309/485 (63.71%), Query Frame = 2
Query:  392 NGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQ-PSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVK-DNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENV 1837
            N    +K++L R++ +++   CK + + K+LPSVSIII FY+  W TL++T    L+R+P+ L+KEI+++DD +    ++ K++ Y+  +F   VRV+ + KREGLI+ RL GAK A G VL+F+DSHC   + WLPPLL+PI ++Y+TVTCPFID+ D DT  Y +QDEGARGAFDW F Y RLP L  +   P  PF +P+M G +FAI+R WFWELGGYD GL+IWGGEQ+ELSFKIW CGG+M++ PCSRI  +++    F   ++    I +NYKR+AE+WMD ++K++Y+R    +   + GD++ Q  ++++L CKSF WFM  +A+D+   Y    PP +   ++   +     +S+C+D+K+ K   ++ +  C +   S    EQ+F  T   ++R   R+ C D   +     ++L  C     NQ W+Y   S Q+ ++ +QKC+  +  +  + ++ C+ SS+ QKW +++ 
Sbjct:   70 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTN-VRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLY----PPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQDA 545          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 377.481 bits (968), Expect = 1.237e-123
Identity = 187/485 (38.56%), Postives = 295/485 (60.82%), Query Frame = 2
Query:  392 NGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQ-PSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVK-DNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCT-SSSNQKWYLENV 1837
            N    +K++L R++ +++   CK + + K+LPSVSIII FY+  W TL++T    L+R+P+ L+KEI+++DD +    ++ K++ Y+  +F   VRV+ + KREGLI+ RL GAK A G VL+F+DSHC   + WLPPLL+PI ++Y+T                   DEGARGAFDW F Y RLP L  +   P  PF +P+M G +FAI+R WFWELGGYD GL+IWGGEQ+ELSFKIW CGG+M++ PCSRI  +++    F   ++    I +NYKR+AE+WMD ++K++Y+R    +   + GD++ Q  ++++L CKSF WFM  +A+D+   Y    PP +   ++   +     +S+C+D+K+ K   ++ +  C +   S    EQ+F  T   ++R   R+ C D   +     ++L  C     NQ W+Y   S Q+ ++ +QKC+  +  +  + ++ C+ SS+ QKW +++ 
Sbjct:   70 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTN-VRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKT-------------------DEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLY----PPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQDA 527          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL60.000e+050.82polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL60.000e+050.82polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT100.000e+051.45polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL61.134e-15352.01polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT136.798e-13139.58polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-100.000e+053.60Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-100.000e+053.33Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-72.060e-12338.95Probable N-acetylgalactosaminyltransferase 7 [Sou... [more]
gly-71.193e-12238.95Probable N-acetylgalactosaminyltransferase 7 [Sou... [more]
gly-53.197e-11540.42Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant60.000e+052.57gene:FBgn0035375 transcript:FBtr0072973[more]
Pgant60.000e+052.57gene:FBgn0035375 transcript:FBtr0333442[more]
Pgant60.000e+052.57gene:FBgn0035375 transcript:FBtr0072972[more]
Pgant47.584e-16343.13gene:FBgn0051956 transcript:FBtr0333248[more]
Pgant47.584e-16343.13gene:FBgn0051956 transcript:FBtr0114524[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL60.000e+050.91si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNTL60.000e+050.91si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNT101.289e-14552.35polypeptide N-acetylgalactosaminyltransferase 10-l... [more]
galnt16.033e-13039.11UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt16.033e-13039.11UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL60.000e+050.82polypeptide N-acetylgalactosaminyltransferase like... [more]
galnt100.000e+050.09polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt100.000e+050.09polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL60.000e+048.63polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL64.058e-17450.81polypeptide N-acetylgalactosaminyltransferase like... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galntl60.000e+051.09UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galnt100.000e+052.40polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
Galntl68.382e-15352.62UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galnt18.397e-13139.58polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt18.397e-13139.58polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O45947|GLT10_CAEEL0.000e+053.33Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|A8Y236|GLT10_CAEBR0.000e+053.04Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|Q49A17|GLTL6_HUMAN0.000e+050.82Polypeptide N-acetylgalactosaminyltransferase-like... [more]
sp|Q6P9S7|GLT10_MOUSE0.000e+052.40Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q925R7|GLT10_RAT0.000e+052.21Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V6100.000e+056.15Polypeptide N-acetylgalactosaminyltransferase OS=C... [more]
A0A1I8GGZ30.000e+062.34Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1W0WCD20.000e+060.15Polypeptide N-acetylgalactosaminyltransferase OS=H... [more]
A0A267EH100.000e+061.30Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A1S3JMP60.000e+059.70Polypeptide N-acetylgalactosaminyltransferase OS=L... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-15e22.30.000e+050.00polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT100.000e+052.26polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt132.701e-13240.27polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt13.693e-13239.50polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt132.434e-13140.12polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000477.19.196e-11339.20pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
galnt113.312e-10936.99UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt121.455e-10738.55UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
poc1bl1.467e-9937.24POC1 centriolar protein homolog B (Chlamydomonas),... [more]
ENSPMAT00000008097.17.016e-9437.43pep scaffold:Pmarinus_7.0:GL476358:506472:520895:1... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310355.379e-13643.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458293.632e-12439.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372664.517e-12140.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343553.848e-12039.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381512.804e-10338.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT100.000e+052.20polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNT100.000e+050.55polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt11.598e-13340.38polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt11.598e-13340.38polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt136.632e-13139.39polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077709.10.000e+099.83SMESG000077709.1[more]
SMESG000070134.10.000e+056.55SMESG000070134.1[more]
SMESG000027520.10.000e+050.93SMESG000027520.1[more]
SMESG000021519.14.955e-13641.03SMESG000021519.1[more]
SMESG000021519.11.237e-12338.56SMESG000021519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014623 ID=SMED30014623|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1926bp
TGATAAAATTAAGATTTTTTGGTATAAAATCCGAACTAGCACTTGCTAAC
TGACACTTAGTTTCATCTGAAAATAAATATTAGATCAAATGAAACGAAAT
TGTGTATCTATTACAAAATATGCCATAACATTTTTGATTTGTTTTTTGTT
TTTAATTATTTTCTATCAGAATTTCTTTAGTAGCGATAAGGCATGGATCG
CTGAAGGATTAAAGCACAATGAACTCAACCCAGATGAAATAACTGACCCA
AAGAAAAAAATTGATTGGCACAATTATAAACAGATTTTAGAAGAATCACA
AAGAGAAGGTGTTGGAGAACATGGTTCTGCAGTGATTTTGGATTCATCAG
AAAACAATTTAAAAGAATCTATTTTTAAAGTAAACGGATTTAATGGATTA
GCTAGTGATAAAATGGCATTAAATCGATCAGTTAAAGATATTCGGCATCC
AGATTGTAAGAAGATGCTGTATCAAAAATCTCTTCCTTCAGTTTCGATTA
TTATTCCATTTTACGAAGAACATTGGTCAACATTGTTGCGTACATTCATA
TCAGCCTTAATTCGTGCACCGAAAGGCCTCGTTAAAGAAATCATTTTAGT
TGATGATTGTAGTACTAAAGAATTTCTCAAAGATAAACTTGATCAATATA
TTGAAAATAACTTCAAAGGAATTGTGAGAGTTCTTCGTCAAGACAAACGA
GAAGGATTAATTAGAACCAGATTGAAAGGCGCTAAAAATGCAACAGGAGA
CGTATTGATATTTCTAGATTCTCATTGTGAAACCAACATCAATTGGCTGC
CTCCACTGTTGGATCCAATTGCTCAAGATTATCGAACTGTCACATGTCCG
TTTATCGATGTATTAGATCATGACACTTTTGAATATCGAGCCCAAGATGA
AGGAGCCAGGGGTGCTTTTGATTGGGAATTTTATTACAAGCGCTTGCCAT
TGTTGCCTGAAGACCTGAAATATCCCGCTCGACCATTCAAAAGCCCAGTA
ATGGCAGGAGGATTATTTGCAATCAGTAGAAAATGGTTCTGGGAGCTTGG
TGGCTATGATCCTGGGTTGGATATTTGGGGTGGTGAGCAGTACGAATTGT
CGTTCAAGATCTGGCAGTGTGGGGGACAAATGTTAGATACACCTTGTTCG
AGAATTGCCCACGTCTATAGGAAATATGCTCCCTTTCCCAGTGTTGTCAA
TATTGGCAATTTCATTGCTAGAAATTACAAGAGAGTGGCTGAAGTTTGGA
TGGACGAGTATAGAAAATACTTATATCGGCGACAACCCAGTTGGGAGCGG
GAAAATGCCGGTGACCTAACCGCTCAATTTGCTATCCGAGAACGGTTGAA
ATGTAAATCATTTAAGTGGTTTATGACAGAAATTGCATTTGATTTGGAGA
AGCATTATCCATCCGTTGAACCTCCGAATAGTGCCGATGGTGAAGTAAGA
AGCAAGGTTTTTAATTCTGATGGAAATTCTCTTTGTCTCGATGCTAAATT
TGCAAAATCAGAAAGTCAAATTCGATTGGCTCCTTGTGTAAAAGATAATT
CTCGATTGACTGGTGAACAAAAATTCCTGTTGACATGGCATGAAGATTTG
CGTCTTAAAAGTCGGGATGAGTGTCTTGATGTGCCGCAAAATATGTTCAA
ATCTCCGGTTATTCTCTATTCTTGTCATGGACAAAAGGGCAACCAGCTAT
GGAAATATAAATTAGACAGCAAGCAGCTGTATCATGTTGTCACTCAAAAA
TGCCTTACTGCAGACGGTCCAACGCAGTCGGTCTACATGGATACGTGCAC
TTCATCTAGTAATCAGAAATGGTATTTGGAAAATGTTAAAGAAGATGTTA
TCAGTAGATATAATTTAAATTTGTAATTTTGCTCAATTTTTTTTCTTTTC
TAAATATATGTATTCAAGGACAAAAA
back to top

protein sequence of SMED30014623-orf-1

>SMED30014623-orf-1 ID=SMED30014623-orf-1|Name=SMED30014623-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=596bp
MKRNCVSITKYAITFLICFLFLIIFYQNFFSSDKAWIAEGLKHNELNPDE
ITDPKKKIDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNG
FNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLL
RTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLR
QDKREGLIRTRLKGAKNATGDVLIFLDSHCETNINWLPPLLDPIAQDYRT
VTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPF
KSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLD
TPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQP
SWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSAD
GEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTW
HEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHV
VTQKCLTADGPTQSVYMDTCTSSSNQKWYLENVKEDVISRYNLNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR001173Glyco_trans_2-like
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 454..581
e-value: 2.6E-25
score: 100.1
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 460..578
e-value: 1.9E-24
score: 86.3
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 449..581
score: 24.442
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 456..580
e-value: 2.93026E-26
score: 101.813
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 136..321
e-value: 1.5E-30
score: 106.3
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 54..443
e-value: 1.9E-164
score: 549.0
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 112..435
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 444..594
e-value: 3.5E-32
score: 113.3
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 48..587
NoneNo IPR availablePANTHERPTHR11675:SF23N-ACETYLGALACTOSAMINYLTRANSFERASE 4-RELATEDcoord: 48..587
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 136..433
e-value: 1.44164E-171
score: 487.097
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 461..582