Nop-domain-containing

Overview
NameNop-domain-containing
Smed IDSMED30014621
Length (bp)1423
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nop-domain-containing (SMED30014621) t-SNE clustered cells

Violin plots show distribution of expression levels for Nop-domain-containing (SMED30014621) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nop-domain-containing (SMED30014621) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nop-domain-containing (SMED30014621) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Nop-domain-containing vs. Ensembl Human
Match: NOP56 (NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:15911])

HSP 1 Score: 98.2117 bits (243), Expect = 2.436e-21
Identity = 98/417 (23.50%), Postives = 183/417 (43.88%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLN--EEITDKSAVINEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            H  GY L ++ E EEI  L   V  ++ ++ KF   V+L+ F P   ++ A E  + ++E  + + L + +++  L        +G     +    +E+   N  T   + EI+R +R H    +K  T+    K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE V++ +  + ++ R      N  E   DK   + E+  D    K +  A  +  G ++   D   I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:   10 HAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEGVVHEDL-RLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIIND-NATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAV-------GARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 412          
BLAST of Nop-domain-containing vs. Ensembl Human
Match: NOP56 (NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:15911])

HSP 1 Score: 96.6709 bits (239), Expect = 1.046e-20
Identity = 98/417 (23.50%), Postives = 183/417 (43.88%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLN--EEITDKSAVINEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            H  GY L ++ E EEI  L   V  ++ ++ KF   V+L+ F P   ++ A E  + ++E  + + L + +++  L        +G     +    +E+   N  T   + EI+R +R H    +K  T+    K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE V++ +  + ++ R      N  E   DK   + E+  D    K +  A  +  G ++   D   I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:   10 HAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEGVVHEDL-RLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIIND-NATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAV-------GARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 412          
BLAST of Nop-domain-containing vs. Ensembl Human
Match: NOP58 (NOP58 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:29926])

HSP 1 Score: 67.3958 bits (163), Expect = 2.179e-11
Identity = 76/332 (22.89%), Postives = 143/332 (43.07%), Query Frame = 1
Query:  325 FKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDK----SAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSK 1269
             KEK N++ I +  V E++R IR  +   +      +     L  L+H         +A  ++  +  + +L+ +L+K LN  +   +       PE  ++  S ++++ + L     +++ D+    SA ++E+   +   +++ A     G E+ + D C I     ++I       Q      N    IAPN++ ++        +L  A+LI  AGSL  L++ A+ST+  L  + A+ R  K   D P+ G             K   + S++L+ K  LA R D F    S++     G + +++ +  L+   D    KI  T K
Sbjct:   98 IKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL-GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKII-SDNLTYCKCL-----QKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMV-------GELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSA----MGVENRAKLEARLRTLEDRGIRKISGTGK 411          
BLAST of Nop-domain-containing vs. Ensembl Human
Match: NOP56 (NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:15911])

HSP 1 Score: 55.4546 bits (132), Expect = 3.607e-8
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  796 IKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:    5 IESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVG-------ARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 153          
BLAST of Nop-domain-containing vs. Ensembl Human
Match: NOP56 (NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HGNC:15911])

HSP 1 Score: 55.4546 bits (132), Expect = 5.743e-8
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  712 FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
             D    K +  A  +  G ++   D   I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:   10 MDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVG-------ARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 186          
BLAST of Nop-domain-containing vs. Ensembl Celegans
Match: nol-56 (Nucleolar protein 56 [Source:UniProtKB/Swiss-Prot;Acc:Q21276])

HSP 1 Score: 96.6709 bits (239), Expect = 3.027e-21
Identity = 107/406 (26.35%), Postives = 177/406 (43.60%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS---IGSEFSNLSEEFKEKF-NVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRL------FDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQI--AINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQ 1194
            H +GY L  + EF++ G +++ V +A +D  KFS  V+L +F P  N   A E C++I+E      L  F+ K   +      +G   S L+    E F ++ ++    + EI+R  R H  +  K   +    K  L SL H    +        ++  V  S  L+  L+K++N     ++       PE  RL      +  L ++      +  NE + ++   I EI D  + K  QI  A  T  G ++   D   IK  +  + +     QQ      +     AP+LS L+   +        A+LI+ AGSL  L++  +ST+  L  + A+ R  K  S+ P+ G             K   R S+ L++K ++A+R+D FS     S  GEF +Q
Sbjct:   12 HAAGYALMKIKEFDDAGLILQEVDAAHADGYKFSQIVELASFDPFKNTEAALENCNSISEGLAHPDLTNFLQKSLPKKKKHVVLGINDSKLAGSLTEAFPDLKLVFGGVITEILRGTRVHFERLAKNLPHHSLSKAQL-SLGHSYSRSKVKFDVHRVDNMVIQSIALLDQLDKDINLFGMRIREWYSYHYPELFRLAPDQYKYSRLAVAILDRNKMAENENLENE---ILEILDNDSEKTAQIIEAARTSMGMDISDLDLENIKRFAARVSSLMEYRQQLHEYIKDRMDHCAPSLSALIGEQV-------GARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYGLLFHSSFIGKAGTKNKGRVSRYLANKCSIAARVDCFSETPV-STYGEFLRQ 405          
BLAST of Nop-domain-containing vs. Ensembl Celegans
Match: nol-58 (NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:O45012])

HSP 1 Score: 73.9442 bits (180), Expect = 6.925e-14
Identity = 90/390 (23.08%), Postives = 175/390 (44.87%), Query Frame = 1
Query:   61 SGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFL-SIYLNEEI--TDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            +GY +F +S  +++ + + ++    S  +K    ++L++F        A E  S I E K+ +TL K +     + + +    + L    KEK ++N + +  + E++R +R HI   L +     N      +++H             I+  +  + +L+ +L+K LN  +  ++       PE  +       ++A+ + +I + +    TD S+++ E  + K  +D +I++    G ++   D   IK   D++I       Q      N    +APNL+ LL        +L  A+LI+ AGSL  L++  +STI  L  + A+ R  K   D P+ G             K+  + ++ L+ K +LA+R+D  S   + +E G
Sbjct:    9 AGYAVFKLSNEKKLKN-VDNIWEEFSTAEKAQENLQLVSFKKFKTTAGAVEATSEITEGKLSKTLKKLLKSSVDETEKLAVGDAKLGNLIKEKLSLNCVHDSSINELMRGVRAHIEDLLAEHKEEMNAMNL--AVAHSLARYKVKFNPEKIDTMIVQAVSLLDDLDKELNNYVMRVREWYGWHFPELGKTIQDHQ-AYAKIIKAIGMRQNCINTDLSSILPEELEEKVKEDAEISM----GTDISDIDLIHIKGLCDQVIELSAYRAQLFDYLKNRMTALAPNLTVLL-------GELVGARLISHAGSLVSLAKAPASTIQILGAEKALFRALKTKKDTPKYGLIYHAQLITQAPPKVKGKMARKLAAKCSLATRIDALSDESATNEIG 383          
BLAST of Nop-domain-containing vs. Ensembl Fly
Match: Nop56 (gene:FBgn0038964 transcript:FBtr0084230)

HSP 1 Score: 114.775 bits (286), Expect = 2.891e-27
Identity = 109/425 (25.65%), Postives = 191/425 (44.94%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVN-EAHECCSNINENKIPQTLIKFI----IKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLII-------NLEKNLNTKLQNLKSLIQPFLPEFVRLF--DSLDISFARFLSIYLN---EEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-------------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +G+ LFSV EFEE+   +  V S+++D+ KF+  VKL  F P      A E  + I+E  +PQ L+ F+     K   +  ++G   + L     E   V       V EI+R +RFH  K +K FT+          ++   + ++ +      NV  S N+II        L+K++NT    ++       PE V++   + +    A+F+    N   +++ D   +   + D    + +  A     G ++   D   I+  ++ ++      ++  T   N    +APNL  L+        D   A+LI+ AGSL  L++  +ST+  L  + A+ R  K  S+ P+ G             K+K   R S+ L++K ++ASR+D F  + ++     FG+ LK + +  LK +  G
Sbjct:   10 HAAGFSLFSVKEFEEVSMFLPQVESSVTDLAKFNSIVKLAGFAPFKTAIAALENINAISEGIVPQDLLSFLDDFFAKLKKKKCTLGIADAKLGAAITEAIGVQCSHFGVVPEILRGVRFHFAKLVKGFTDKS------AGVAQLGLGHSYSRAKVKFNVHRSDNMIIQSIALLDQLDKDVNTFSMRIREWYSYHFPELVKIVPDNYMFAKAAKFIKDRKNLTQDQLEDLEKI---VMDSAKAQAIIDAAKMSMGMDISIVDLMNIELFAERVVKLSEYRKKLSTYLHNKMNLVAPNLQSLI-------GDQVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYGLIYHSSFIGRAGLKNK--GRISRFLANKCSIASRIDCFLEQPTSV----FGETLKQQVEDRLKFYESG 412          
BLAST of Nop-domain-containing vs. Ensembl Fly
Match: nop5 (gene:FBgn0026196 transcript:FBtr0079369)

HSP 1 Score: 66.6254 bits (161), Expect = 2.176e-11
Identity = 82/341 (24.05%), Postives = 145/341 (42.52%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYL---NEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKE----IAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSK 1269
            + L    K+K +V  + N  V E++R IR      L      +     L  L+H         +   I+  +  +  L+ +L+K LN  +   +       PE  ++    +I+F + + +     N   +D S ++ E  + K  +  +I++    G E+ + D   I+   DEII+    I   +T   +  K     +APNL+ L+  T+        A+LI  AGSL  L++  SST+  L  + A+ R  K   D P+ G             K   + S+ L+ K +LA+R+D F    +     E G   K + ++ L++  +G   K+  T K
Sbjct:   93 AKLGTAIKDKLSVQCVCNTGVQELMRCIRQQADSLLGGLPKREMTAMAL-GLAHSLSRYKLKFSPDKIDTMIVQAQCLLDDLDKELNNYMMRAREWYGWHFPELGKIITD-NIAFVKTIKLVGTRDNMATSDLSDILPEDVEEKVKEAAEISM----GTEISEEDVLNIQCLCDEIIS----INDYRTHLYDYLKARMMAMAPNLTVLVGDTVG-------ARLIAHAGSLINLAKHPSSTVQILGAEKALFRALKTKKDTPKYGLIYHAQLVGQASQKNKGKMSRSLAAKASLATRVDAFGEEATF----ELGAAHKVKLESRLRLLEEGNLRKLSGTGK 412          
BLAST of Nop-domain-containing vs. Ensembl Zebrafish
Match: nop56 (NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:ZDB-GENE-040109-1])

HSP 1 Score: 109.768 bits (273), Expect = 2.702e-25
Identity = 108/435 (24.83%), Postives = 184/435 (42.30%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNIN--ENKIPQTLIKFIIKCDLQGDS-----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLII-------NLEKNLNTKLQNLKSLIQPFLPEFVRLF--DSLDISFARFLS---------IYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLK 1251
            H +GY L +V E EEIG L+  V  ++ ++ KFS  VKL  F P     A     NIN     +    +K  ++ +L         +G   + L    +E+ N+++ T   V EIIR +R H    +K  T     K  L  L H              NV  + N+II        L+K++NT    ++       PE +++   +S     A+ +          +   EEIT  SA    I D         A  +  G ++   D   I+  S  +++  +  Q+ +    +   ++APNL+ L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G+  +
Sbjct:   10 HAAGYALLAVKEVEEIGMLLPQVEESVLNVGKFSSVVKLSAFFPF--KSAQGALENINAVSEGVVHADLKLFLETNLPSGGKKKPMLGVSDAKLGAALQEELNLSIQTGGVVAEIIRGVRLHFHSLVKGLTAQAASKAQL-GLGHSYSRAKVK-----FNVNRADNMIIQSIALLDQLDKDINTFSMRVREWYGYHFPELIKIVSDNSTYCKLAKLIGNRKELSEEMLEAMEEITMDSAKAQAILD---------ASRSSMGMDISPIDLINIECFSSRVVSLTDYRQELQEYLRSKMGQVAPNLAALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSEVPTSV----FGDKLRDQVEERLAFYETGEAPR 416          
BLAST of Nop-domain-containing vs. Ensembl Zebrafish
Match: nop58 (NOP58 ribonucleoprotein homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2140])

HSP 1 Score: 58.5362 bits (140), Expect = 1.088e-8
Identity = 71/306 (23.20%), Postives = 128/306 (41.83%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLF-DSLDI-SFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    KEK N++ + +  V E++R IR  +   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++  D+L      R +    N   T+ S  + E  +     ++++A     G E+ + D   I    D++I       Q      N    IAPNL+ ++        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S++L+ K ALA R D     ++N+E G
Sbjct:   93 AKLGGVIKEKLNLSCVHSPAVAELMRGIRNQMEGLITGLPAREIAAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPEIGKIITDNLAYCKTVRKIGDRTNVATTELSEFLPEEIEA----EVKLAAEISMGTEVSEEDIANIMHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMV-------GELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRRDTPKYGLIYHASLVGQTTAKNKGKISRMLAAKTALAIRYDALGE-DTNAEMG 385          
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Match: nop56 (NOP56 ribonucleoprotein [Source:NCBI gene;Acc:733535])

HSP 1 Score: 103.99 bits (258), Expect = 1.545e-23
Identity = 103/435 (23.68%), Postives = 193/435 (44.37%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINE---IFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLK--IDETSKIDVQVRI 1290
            H +GY LF V E EEIG LI  V  +L ++ KF+  VKL  F P  +   A E  + I+E  + + L K +++ ++        +G   + +    +E+  +   T   V EI+R IR H    +K  T     K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE +++  S + ++ R      N +   +  +      + D    + +  A  +  G ++   D   I+S S  +I+     ++ +    +   ++AP+LS L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G+  +  +D   +   +VR+
Sbjct:   15 HAAGYALFVVKEVEEIGLLIPQVEESLLNVGKFNNIVKLAAFSPFKSAQSALENVNAISEGVLHEDL-KLLLETNMPAKKKKALLGVGDAKIGAAIQEELKIPCQTGGAVAEILRGIRLHFHSLVKGLTAQSASKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELIKIV-SDNYTYCRMAKYIGNRKELSEEKLEEMEEILMDSAKAQAVLDASRSSMGMDISPIDLINIESFSSRVISLSEYRKELQEYLRSKMSQVAPSLSALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSEIPTSV----FGDKLREQVEERLAFYETGEAPRKNLDVMKEAQQEVRV 435          
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Match: nop56 (NOP56 ribonucleoprotein [Source:NCBI gene;Acc:733535])

HSP 1 Score: 103.605 bits (257), Expect = 2.939e-23
Identity = 105/438 (23.97%), Postives = 197/438 (44.98%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINE---IFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIIN---FYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLK--IDETSKIDVQVRI 1290
            H +GY LF V E EEIG LI  V  +L ++ KF+  VKL  F P  +   A E  + I+E  + + L K +++ ++        +G   + +    +E+  +   T   V EI+R IR H    +K  T     K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE +++  S + ++ R      N +   +  +      + D    + +  A  +  G ++   D   I+S S  +I+   +  E+Q+   + ++   ++AP+LS L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G+  +  +D   +   +VR+
Sbjct:   15 HAAGYALFVVKEVEEIGLLIPQVEESLLNVGKFNNIVKLAAFSPFKSAQSALENVNAISEGVLHEDL-KLLLETNMPAKKKKALLGVGDAKIGAAIQEELKIPCQTGGAVAEILRGIRLHFHSLVKGLTAQSASKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELIKIV-SDNYTYCRMAKYIGNRKELSEEKLEEMEEILMDSAKAQAVLDASRSSMGMDISPIDLINIESFSSRVISLSEYRKELQEYLRSKMS---QVAPSLSALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSEIPTSV----FGDKLREQVEERLAFYETGEAPRKNLDVMKEAQQEVRV 435          
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Match: nop56 (NOP56 ribonucleoprotein [Source:NCBI gene;Acc:733535])

HSP 1 Score: 103.219 bits (256), Expect = 3.176e-23
Identity = 102/421 (24.23%), Postives = 189/421 (44.89%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINE---IFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIIN---FYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKG 1245
            H +GY LF V E EEIG LI  V  +L ++ KF+  VKL  F P  +   A E  + I+E  + + L K +++ ++        +G   + +    +E+  +   T   V EI+R IR H    +K  T     K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE +++  S + ++ R      N +   +  +      + D    + +  A  +  G ++   D   I+S S  +I+   +  E+Q+   + ++   ++AP+LS L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G+ 
Sbjct:   10 HAAGYALFVVKEVEEIGLLIPQVEESLLNVGKFNNIVKLAAFSPFKSAQSALENVNAISEGVLHEDL-KLLLETNMPAKKKKALLGVGDAKIGAAIQEELKIPCQTGGAVAEILRGIRLHFHSLVKGLTAQSASKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELIKIV-SDNYTYCRMAKYIGNRKELSEEKLEEMEEILMDSAKAQAVLDASRSSMGMDISPIDLINIESFSSRVISLSEYRKELQEYLRSKMS---QVAPSLSALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSEIPTSV----FGDKLREQVEERLAFYETGEA 413          
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:394916])

HSP 1 Score: 66.6254 bits (161), Expect = 3.496e-11
Identity = 92/403 (22.83%), Postives = 174/403 (43.18%), Query Frame = 1
Query:   61 SGYCLFSV---SEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFI--IKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG-EFGKQLKSRF 1209
            +GY +F V   S+ +E+  + K   +     +K +  VKL +F    +  EA    + + E K+ + L K +  I      + +    + L    K+K N++ + +  V E++R IR  I   +   ++ +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++    ++++ + L   + + I   +  ++EI   +   +++ A     G E+ + D   I    D++I       Q      N    IAPNL+ L+        +L  A+LI  AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S++L+ K ALA R D     ++N+E G E   +L+SR 
Sbjct:    9 AGYAIFKVLDESKLQEVDSIWKEFETP----EKANRVVKLKHFEKFQDTTEALAASTALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGIRNQIDGLITGISSREMAAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIITD-NLAYCKCLRA-VGDRINFATFDLSEILPEEVETEVKAAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRMMAIAPNLTVLV-------GELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDAL-GEDTNAELGVETRAKLESRL 396          
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:394916])

HSP 1 Score: 66.6254 bits (161), Expect = 3.650e-11
Identity = 92/403 (22.83%), Postives = 174/403 (43.18%), Query Frame = 1
Query:   61 SGYCLFSV---SEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFI--IKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG-EFGKQLKSRF 1209
            +GY +F V   S+ +E+  + K   +     +K +  VKL +F    +  EA    + + E K+ + L K +  I      + +    + L    K+K N++ + +  V E++R IR  I   +   ++ +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++    ++++ + L   + + I   +  ++EI   +   +++ A     G E+ + D   I    D++I       Q      N    IAPNL+ L+        +L  A+LI  AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S++L+ K ALA R D     ++N+E G E   +L+SR 
Sbjct:    9 AGYAIFKVLDESKLQEVDSIWKEFETP----EKANRVVKLKHFEKFQDTTEALAASTALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGIRNQIDGLITGISSREMAAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIITD-NLAYCKCLRA-VGDRINFATFDLSEILPEEVETEVKAAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRMMAIAPNLTVLV-------GELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGE-DTNAELGVETRAKLESRL 396          
BLAST of Nop-domain-containing vs. Ensembl Mouse
Match: Nop56 (NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1914384])

HSP 1 Score: 95.1301 bits (235), Expect = 2.346e-20
Identity = 94/417 (22.54%), Postives = 181/417 (43.41%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINE---IFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            H  GY L ++ E EEI  L+  V   + ++ KF   V+L+ F P + ++ A E  + ++E  + + L + +++  L        +G     +    +E+   N  T   + EI+R +R H    +K  T+    K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE V++ +  + ++ R      N    ++  +        D    K +  A  +  G ++   D   I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:   10 HAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDL-RLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVND-NATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAV-------GARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 412          
BLAST of Nop-domain-containing vs. Ensembl Mouse
Match: Nop58 (NOP58 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1933184])

HSP 1 Score: 68.5514 bits (166), Expect = 6.127e-12
Identity = 77/338 (22.78%), Postives = 145/338 (42.90%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDK----SAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSK 1269
            + L    KEK N++ I +  V E++R IR  +   +      +     L  L+H         +A  ++  +  + +L+ +L+K LN  +   +       PE  ++  S ++++ + L     +++ D+    SA ++E    +   +++ A     G E+ + D C I     ++I       Q      N    IAPN++ ++        +L  A+LI  AGSL  L++ A+ST+  L  + A+ R  K   D P+ G             K   + S++L+ K  LA R D F    S++     G + +++ +  L++  D    KI  T K
Sbjct:   92 AKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL-GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKII-SDNLTYCKCL-----QKVGDRKNYASASLSEFLSEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMV-------GELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSA----MGIENRAKLEARLRILEDRGIRKISGTGK 411          
BLAST of Nop-domain-containing vs. Ensembl Mouse
Match: Nop58 (NOP58 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1933184])

HSP 1 Score: 67.781 bits (164), Expect = 1.386e-11
Identity = 77/338 (22.78%), Postives = 145/338 (42.90%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDK----SAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSK 1269
            + L    KEK N++ I +  V E++R IR  +   +      +     L  L+H         +A  ++  +  + +L+ +L+K LN  +   +       PE  ++  S ++++ + L     +++ D+    SA ++E    +   +++ A     G E+ + D C I     ++I       Q      N    IAPN++ ++        +L  A+LI  AGSL  L++ A+ST+  L  + A+ R  K   D P+ G             K   + S++L+ K  LA R D F    S++     G + +++ +  L++  D    KI  T K
Sbjct:   92 AKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL-GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKII-SDNLTYCKCL-----QKVGDRKNYASASLSEFLSEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMV-------GELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSA----MGIENRAKLEARLRILEDRGIRKISGTGK 411          
BLAST of Nop-domain-containing vs. Ensembl Mouse
Match: Nop56 (NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1914384])

HSP 1 Score: 55.8398 bits (133), Expect = 2.255e-8
Identity = 42/160 (26.25%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  796 IKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:    9 IESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVG-------ARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 157          
BLAST of Nop-domain-containing vs. Ensembl Mouse
Match: Nop56 (NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI:1914384])

HSP 1 Score: 53.5286 bits (127), Expect = 1.755e-7
Identity = 45/198 (22.73%), Postives = 88/198 (44.44%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFD 627
            H  GY L ++ E EEI  L+  V   + ++ KF   V+L+ F P + ++ A E  + ++E  + + L + +++  L        +G     +    +E+   N  T   + EI+R +R H    +K  T+    K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE V++ +
Sbjct:   10 HAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDL-RLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQL-GLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVN 205          
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Match: sp|Q54MT2|NOP56_DICDI (Nucleolar protein 56 OS=Dictyostelium discoideum OX=44689 GN=nop56 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.221e-24
Identity = 107/413 (25.91%), Postives = 192/413 (46.49%), Query Frame = 1
Query:   61 SGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKC---DLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEE-ITDKSA-VINEIFDCKN--VKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            +G+ +F +S  E I      V+ ++ D  KFS   K++  +P    E A E  ++I+E  + ++L  F+ +      +G  +G   + LS    ++  ++ ++N    EIIR IR HI  +  K  +AD  K  L  L H    +        ++  +  S  L+  L+K+LNT    L+       PE +++ +S  + FA+   +  N++ +T++S   I EI +      KD+  A     G ++ Q D   +   +D +I+                ++IAPNLS L+        D   AKLI++AGSL  L++  +ST+  L  + A+ R  K     P+ G          + K   R ++ LS+K+++A+R+D F    S++   +FG  LK +    +K + +G
Sbjct:   11 TGFNIFQLSGMESIAEFTDQVQKSMQDFSKFSKVCKMVGSLPFTSAENALENINSISEGILTESLHDFLKQTFSKKTEGVVLGVCDNKLSASIGDELKISCLSNSHTSEIIRCIRNHI-SEFTKLKSADLLKAQL-GLGHSYSRSKVKFNVHKVDNMIIQSICLLEQLDKDLNTFFMRLREWYSWHFPELLKIIES-QVHFAKLAKLIQNKKNLTEESLDEIKEILEDNESLAKDVLSAAKASMGGDISQIDLVTVMHFADRVISLDEYRTNLTQYLAKKMQDIAPNLSALV-------GDRIGAKLISRAGSLTSLAKYPASTVQILGAEKALFRAMKVRGKTPKYGIIFNASAVSSETKNKGRIARCLSNKISIATRIDCF----SDNPTAKFGVALKQQVADRIKFFNNG 409          
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Match: sp|Q12460|NOP56_YEAST (Nucleolar protein 56 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP56 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.234e-21
Identity = 107/423 (25.30%), Postives = 195/423 (46.10%), Query Frame = 1
Query:   61 SGYCLFSVS-EFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS-------IGSEFSNLSEEFKEKFN-VNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNT--TITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFL-----SIYLNEE-ITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            +GY +F V  + ++IG  +K V+  ++D   F+  ++L++F P     EA E  ++I+E  + ++L K I+  +L   S       +     NL    KE+F  V+ I+N    ++IR +R H  K  K   + D E+  L  L H         ++  +  ++  +  L+  L+K++NT    +K       PE  +L    + +FA+ +        LN++ + D +A++NE  D    + +        G+++ ++D   +   +  + +  +  +Q           +APNLS L+   I        A+LI+ AGSL  LS+ A+ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D +S   SN     FG  LK + +  L+ +  GK
Sbjct:   13 TGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESL-KAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQL-GLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPD-NYTFAKLVLFIKDKASLNDDSLHDLAALLNE--DSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG-------ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNV----FGSVLKKQVEQRLEFYNTGK 419          
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Match: sp|O94514|NOP56_SCHPO (Nucleolar protein 56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop56 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.099e-20
Identity = 109/427 (25.53%), Postives = 196/427 (45.90%), Query Frame = 1
Query:   61 SGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGD------SIGSEFSNLSEEFKEKFN-VNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHK--------NVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIY-----LNEE-ITDKSAVINEIFDCKNVKDLQIAINTV-YGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            +GY LF V   ++I    K V+ +L DI KF   V+L +F+P  N   A E  ++I+E  +    +K  ++ +L         S+G +  NL+   K + + +   T+    +++R IRFH  K LK+ +  D E+  L  L H         NV  N  +    I + +       L+K++NT    +K       PE  ++    +  +A  +++      +N+E + D +AV++   D K++    I    V  G+++ + D   I S ++ +I   N  +Q     +     +APNL+ L+        ++  A+LI+ AGSL  LS+  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   + +    FG+ L+ + +  L  +  G
Sbjct:   11 TGYSLFDVVGADQIAAKTKEVQLSLQDISKFGKVVQLRSFIPFKNAAHALENANDISEG-VLNDFLKNFLELNLPKASKKKKVSLGVQDKNLATSIKSEIDAIECDTSELTQDLLRGIRFHGDKLLKQLSPGDFERAQL-GLGHSYSRAKVKFNVNRNDNMIIQAIAILD------QLDKDINTFAMRMKEWYSWHFPELSKIVGD-NYKYAVIVTLVGDKTTINDEMLHDLAAVVD---DDKDIAQSIINAGKVSMGQDISEIDLENILSFAERVIKLSNYRKQLHNYLVQKMNVVAPNLAELI-------GEMVGARLISHAGSLTNLSKCPASTVQILGAEKALFRALKTRGNTPKYGIIYHSSFIGKAGAKNKGRISRFLANKCSIASRIDNFSDAPTTA----FGQVLRRQVEERLNFFDTG 414          
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Match: sp|Q5RA29|NOP56_PONAB (Nucleolar protein 56 OS=Pongo abelii OX=9601 GN=NOP56 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.438e-20
Identity = 98/417 (23.50%), Postives = 183/417 (43.88%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNE-AHECCSNINENKIPQTLIKFIIKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLN--EEITDKSAVINEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            H  GY L ++ E EEI  L   V  ++ ++ KF   V+L+ F P   ++ A E  + ++E  + + L + +++  L        +G     +    +E+   N  T   + EI+R +R H    +K  T+    K  L  L H           + ++  +  S +L+  L+K++NT    ++       PE V++ +  + ++ R      N  E   DK   + E+  D    K +  A  +  G ++   D   I+S S  +++     Q   T   +   ++AP+LS L+   +        A+LI  AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG++L+ + +  L  +  G+
Sbjct:   10 HAVGYALLALKEVEEISLLQPQVEESVLNLGKFHNIVRLVAFCPFASSQVALENANAVSEGVVHEDL-RLLLETHLPSKKKRVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQL-GLGHSYSRTKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIIND-NATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAV-------GARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSV----FGEKLREQVEERLSFYETGE 412          
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Match: sp|Q21276|NOP56_CAEEL (Nucleolar protein 56 OS=Caenorhabditis elegans OX=6239 GN=nol-56 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.850e-20
Identity = 107/406 (26.35%), Postives = 177/406 (43.60%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS---IGSEFSNLSEEFKEKF-NVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRL------FDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQI--AINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQ 1194
            H +GY L  + EF++ G +++ V +A +D  KFS  V+L +F P  N   A E C++I+E      L  F+ K   +      +G   S L+    E F ++ ++    + EI+R  R H  +  K   +    K  L SL H    +        ++  V  S  L+  L+K++N     ++       PE  RL      +  L ++      +  NE + ++   I EI D  + K  QI  A  T  G ++   D   IK  +  + +     QQ      +     AP+LS L+   +        A+LI+ AGSL  L++  +ST+  L  + A+ R  K  S+ P+ G             K   R S+ L++K ++A+R+D FS     S  GEF +Q
Sbjct:   12 HAAGYALMKIKEFDDAGLILQEVDAAHADGYKFSQIVELASFDPFKNTEAALENCNSISEGLAHPDLTNFLQKSLPKKKKHVVLGINDSKLAGSLTEAFPDLKLVFGGVITEILRGTRVHFERLAKNLPHHSLSKAQL-SLGHSYSRSKVKFDVHRVDNMVIQSIALLDQLDKDINLFGMRIREWYSYHYPELFRLAPDQYKYSRLAVAILDRNKMAENENLENE---ILEILDNDSEKTAQIIEAARTSMGMDISDLDLENIKRFAARVSSLMEYRQQLHEYIKDRMDHCAPSLSALIGEQV-------GARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRSNTPKYGLLFHSSFIGKAGTKNKGRVSRYLANKCSIAARVDCFSETPV-STYGEFLRQ 405          
BLAST of Nop-domain-containing vs. TrEMBL
Match: J9FCX6 (Nop multi-domain protein OS=Oxytricha trifallax OX=1172189 GN=OXYTRI_02485 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.367e-30
Identity = 115/425 (27.06%), Postives = 205/425 (48.24%), Query Frame = 1
Query:   61 SGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLN-VNEAHECCSNINENKIPQTLIKFII-------KCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN-----VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIY-----LNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEI---INFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            SGY LF   +F+E+G  +K+++ ++S +++FS  VKL  F P     EA E    I +NK+ +TL  F+I           Q   +G     + ++   +  +    N  + E++R IR H+ K LKK +  D +K  L  L+H   + +  + A+ +N     +  +  LI  ++KN+NT    LK       PE  ++  S ++ F++ +        +NE++ D  A I  + D    +++  A     G+E+ ++D   +KS S+ +   I F   +Q+   T +N    +APNL+ L+        ++  +KLI+ +G L  L++  +STI  L  + A+ R  K     P+ G             K   R S+ L++K A+A+R+D F+  E   +   FG++LKS+ +  L+  A G
Sbjct:   11 SGYALFEKEDFDELGGQLKAIQKSISSLERFSKMVKLAAFQPFQTAEEALENIQAIAQNKVAETLKNFLITNLPATKSSKKQKFLLGIAEPMMGQQVFAETGITASYNESIEELLRGIRTHLPKILKKVSEEDTKKAQL-GLAH---QYSRFMCAADVNRQDKPIIQAIALIETMDKNINTFCMRLKEWFSWHFPELSKIV-SDNLIFSKLVHFIEKRENINEDMKDGLAAI--VLDEDKAQEIIEAAKISMGQEMSETDVLQVKSFSERVVEQIEFRERLQEYLRTRMNA---VAPNLTALI-------GEIVGSKLISHSGGLTNLAKYPASTIQILGAEKALFRALKTKGKTPKYGLIFNSSFIGRAGQKNKGRISRYLANKCAIAARIDSFT--EGTHQTNLFGEKLKSQMEERLQFLASG 416          
BLAST of Nop-domain-containing vs. TrEMBL
Match: A0A078AP59 (Nop domain-containing protein OS=Stylonychia lemnae OX=5949 GN=Contig7753.g8264 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.863e-29
Identity = 111/426 (26.06%), Postives = 203/426 (47.65%), Query Frame = 1
Query:   61 SGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLN-VNEAHECCSNINENKIPQTLIKFIIKCDLQGDS--------IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN-----VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIY-----LNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIIN---FYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            SGY LF   +F+E+G  +K+++ ++S +++FS  VKL  F P     EA +  + I +NK+P+TL  F ++ +L            +G     + +E   +       N  + E++R IR H+ K LKK +  D+ +  L  L+H+         A+ +N     +  +  LI  ++KN+NT    LK       PE  R+ +  ++ FA+ +        +NE++ D    I  + D +  + +  A     G+E+ ++D   +KS S+ +++   F   +Q+     +N    +APNL+ L+        ++  +KLI+ +GSL  L++  +STI  L  + A+ R  K     P+ G             K   R S+ L++K A+A+R+D F+  E   +   FG++L+ + +  L   A G
Sbjct:   11 SGYALFEKEDFDELGGQMKAIQKSISSLERFSKMVKLAAFQPFQTAEEALDNITAIAQNKVPKTLKNF-LQTNLPATKSSKKQKFLLGIAEPKMGQEIFAESGFTAAYNESIEELLRGIRTHLPKILKKVSEEDSRRAQL-GLAHQYSRQQ---CAADVNRQDKPIIQAIALIETMDKNINTFCMRLKEWFSWHFPELNRIVND-NLIFAKLVHFIEKRENINEDMKDGLTAI--VLDEEKAQQIIEAAKISMGQEMSETDVLQVKSFSERVVDQIEFRERLQEYLKNRMNA---VAPNLTALI-------GEMVGSKLISHSGSLTNLAKCPASTIQILGAEKALFRALKTRGKTPKYGLIFNSSFIGRAGQKNKGRISRYLANKCAIAARIDSFT--EGTHQTNLFGEKLRQQMEERLLFLASG 416          
BLAST of Nop-domain-containing vs. TrEMBL
Match: A0A482XBS1 (Nop domain-containing protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR001676 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.967e-29
Identity = 117/421 (27.79%), Postives = 195/421 (46.32%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGD-----SIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAV--INEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLK 1251
            H SGY LF V+EFEE+G L+  + S+++++ KF   VKL++F P  N   A E  ++I+E  +P+ L  F+ K           S+G   + L+    E   V       V EI+R IR H    +K FT+       L  LSH           + ++  V  S  L+  L+K++NT    ++       PE V+L    +  +A+      +  + D S +  + EI  D K   D+  A  +  G ++   D   I+  +  + +  +  +   T   +    IAPNLS L+        D   A+LI++AGSL  L++  +ST+  L  + A+ R  K   + P+ G           + K+  R S+ L++K ++ASR+D F+   SN     FG++LK + +  LK +  G+  K
Sbjct:   10 HASGYGLFKVTEFEEVGMLLPQLESSVTNLGKFKQLVKLVSFSPFKNAIVALEGINSISEGIVPEDLQIFLEKSLPSPSKKNPVSLGVFDTKLASALAESLAVKCECTGVVPEILRGIRLHFPNLVKDFTDKTQSVAQL-GLSHSYSRAKIKFNVNRVDNMVIQSIALLDQLDKDINTFAMRIREWYSYHFPELVKLVPD-NYLYAKVAQAIKDRTLLDSSRIDDLEEIVLDRKLATDIVSAAESSMGMDISPVDLINIEHFASRVTSLADYRKSLHTYLKSKMAGIAPNLSTLI-------GDQVGARLISQAGSLTNLAKHPASTVQILGAEKALFRALKTKGNTPKYGLLFHTSFIGRAQTKIKGRISRYLANKCSIASRIDCFAENPSNV----FGEKLKQQVEDRLKYYETGEKPK 417          
BLAST of Nop-domain-containing vs. TrEMBL
Match: A0A1Y1KXF5 (Nop domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_11863 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.902e-27
Identity = 113/417 (27.10%), Postives = 187/417 (44.84%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFI-IKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAV--INEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +GY +F V EFEEIG L+  V +++SD+ +F+  VKL+ F P  +   A E  + I+E  +P+ L+ FI I     G      +G     L     E   +       V EI+R IR H    +K FT+  +    L  L H           + ++  +  S  L+  L+K++NT    ++       PE V++    +  FA+      N +   + +V  + EI  D    + +  A  +  G E+   D   I+  +  +I   +  +Q          +IAPNL+ L+        DL  A+LI +AGSL  L++  SST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D F+ + +N     FG +LK + +  LK +  G
Sbjct:   10 HAAGYGIFKVKEFEEIGMLLPQVEASISDLSRFNSVVKLVGFSPFKSAVTALESINAISEGLLPEDLMHFIDITVPKSGKKEKVCLGVFDPKLGAAITEALGIQCNHVGAVPEILRGIRHHFPNLVKGFTSKSSAVAQL-GLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLDKDINTFAMRIREWYSYHFPELVKIVPE-NYMFAQLCKFIKNRKDLTQDSVEGLEEIVMDSSKAQAILDASRSSMGMEISPIDMINIEMFASRVIALADYRKQLSEYLKTKMGDIAPNLATLI-------GDLVGARLIARAGSLTNLAKYPSSTVQILGAEKALFRALKTRGNTPKYGLLFHSTFIGRAAVKNKGRISRYLANKCSIASRIDCFAEQPTNI----FGNKLKQQVEDRLKFYETG 413          
BLAST of Nop-domain-containing vs. TrEMBL
Match: A0A5N3ZYQ4 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_15475 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.996e-27
Identity = 113/417 (27.10%), Postives = 187/417 (44.84%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFI-IKCDLQGDS----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAV--INEI-FDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +GY +F V EFEEIG L+  V +++SD+ +F+  VKL+ F P  +   A E  + I+E  +P+ L+ FI I     G      +G     L     E   +       V EI+R IR H    +K FT+  +    L  L H           + ++  +  S  L+  L+K++NT    ++       PE V++    +  FA+      N +   + +V  + EI  D    + +  A  +  G E+   D   I+  +  +I   +  +Q          +IAPNL+ L+        DL  A+LI +AGSL  L++  SST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D F+ + +N     FG +LK + +  LK +  G
Sbjct:   10 HAAGYGIFKVKEFEEIGMLLPQVEASISDLSRFNSVVKLVGFSPFKSAVTALESINAISEGLLPEDLMHFIDITVPKSGKKEKVCLGVFDPKLGAAITESLGIQCNHVGAVPEILRGIRHHFPNLVKGFTSKSSAVAQL-GLGHSYSRAKVKFNVNRVDNMIIQSIALLDQLDKDINTFAMRIREWYSYHFPELVKIVPE-NYMFAQLCKFIKNRKDLTQDSVEGLEEIVMDSSKAQAILDASRSSMGMEISPIDMINIEMFASRVIALADYRKQLSEYLKTKMGDIAPNLATLI-------GDLVGARLIARAGSLTNLAKYPSSTVQILGAEKALFRALKTRGNTPKYGLLFHSTFIGRAAVKNKGRISRYLANKCSIASRIDCFAEQPTNI----FGNKLKQQVEDRLKFYETG 413          
BLAST of Nop-domain-containing vs. Ensembl Cavefish
Match: nop56 (NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:ZDB-GENE-040109-1])

HSP 1 Score: 107.071 bits (266), Expect = 2.231e-24
Identity = 103/424 (24.29%), Postives = 183/424 (43.16%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNIN--ENKIPQTLIKFIIKCDLQGDS-----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLII-------NLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINE---IFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            H SGY LF+V E EEIG L+  V  ++ +I KF+  VKL  F P     A     NIN     +    +K  ++ +L         +G     +    +E+  +++ T   V EIIR +R H    +K  T     K  L  L H              NV  + N+II        L+K++NT    ++       PE +++  S + ++ R   +  N +   + ++ +      D    + +  A  +  G ++   D   I+S S  +++     Q+ +    +   ++APNL+ L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G+
Sbjct:   10 HASGYALFAVKEVEEIGMLLPQVEESVLNIGKFNTVVKLAAFFPF--KSAQAALENINAISEGVVHADLKLFLETNLPSGGKKKAMLGVADGKIGAALQEELGLSIQTGGVVAEIIRGVRLHFHSLVKGLTAQAASKAQL-GLGHSYSRAKVK-----FNVNRADNMIIQSIALLDQLDKDINTFSMRVREWYGYHFPELIKIV-SDNATYCRLAKLIGNRKELSEESLESLEEVTMDGAKAQAILEASRSSMGMDISPIDLINIESFSSRVVSLSAYRQELQEYLRSKMGQVAPNLAALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSELPTSV----FGDKLRDQVEERLSFYETGE 413          
BLAST of Nop-domain-containing vs. Ensembl Cavefish
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:103025283])

HSP 1 Score: 64.6994 bits (156), Expect = 9.633e-11
Identity = 74/306 (24.18%), Postives = 130/306 (42.48%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLF-DSLDI-SFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    KEK N++ + +  V E++R IR  +   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++  D+L      R +    N  ITD S V+ E  +     ++++A+    G E+ + D   I    D++I       Q      N    IAPNL+ ++        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S+ L+ K ALA R D     ++N+E G
Sbjct:   93 AKLGGVIKEKLNLSCVHSPAVAELMRGIRNQMEGLITGLPPREISAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIITDNLAYCKTVRKIGDRTNVAITDLSDVLPEETEA----EVKLAVEISMGTEVSEEDITNIMHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMV-------GELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRRDTPKYGLIYHASLVGQTTAKNKGKISRTLAAKTALAIRYDALGE-DTNAEMG 385          
BLAST of Nop-domain-containing vs. Ensembl Cavefish
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:103025283])

HSP 1 Score: 64.3142 bits (155), Expect = 1.119e-10
Identity = 74/306 (24.18%), Postives = 130/306 (42.48%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLF-DSLDI-SFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    KEK N++ + +  V E++R IR  +   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++  D+L      R +    N  ITD S V+ E  +     ++++A+    G E+ + D   I    D++I       Q      N    IAPNL+ ++        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S+ L+ K ALA R D     ++N+E G
Sbjct:   93 AKLGGVIKEKLNLSCVHSPAVAELMRGIRNQMEGLITGLPPREISAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIITDNLAYCKTVRKIGDRTNVAITDLSDVLPEETEA----EVKLAVEISMGTEVSEEDITNIMHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMV-------GELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRRDTPKYGLIYHASLVGQTTAKNKGKISRTLAAKTALAIRYDALGE-DTNAEMG 385          
BLAST of Nop-domain-containing vs. Ensembl Cavefish
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:103025283])

HSP 1 Score: 64.3142 bits (155), Expect = 1.282e-10
Identity = 74/306 (24.18%), Postives = 130/306 (42.48%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLF-DSLDI-SFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    KEK N++ + +  V E++R IR  +   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++  D+L      R +    N  ITD S V+ E  +     ++++A+    G E+ + D   I    D++I       Q      N    IAPNL+ ++        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S+ L+ K ALA R D     ++N+E G
Sbjct:   93 AKLGGVIKEKLNLSCVHSPAVAELMRGIRNQMEGLITGLPPREISAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIITDNLAYCKTVRKIGDRTNVAITDLSDVLPEETEA----EVKLAVEISMGTEVSEEDITNIMHLCDQVIEISEYRTQLYDYLKNRMMAIAPNLTVMV-------GELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRRDTPKYGLIYHASLVGQTTAKNKGKISRTLAAKTALAIRYDALGE-DTNAEMG 385          
BLAST of Nop-domain-containing vs. Ensembl Sea Lamprey
Match: nop56 (NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:ZDB-GENE-040109-1])

HSP 1 Score: 102.064 bits (253), Expect = 1.605e-23
Identity = 103/422 (24.41%), Postives = 193/422 (45.73%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS------IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFH---IVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEE---ITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIIN---FYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +GY LFSV E EEIG L+  V +++ D  KF+  VKL  F P  +   A E  + I+E  + + L + +++ ++   S      +G   + +    +E+  +   T   V EIIR IR H   +VK L   + A  +     S S   V+ N  +  +   +  S +L+  L+K++NT    ++       PE +++    + ++ R   +  N +     +  A+     D    + +  A  +  G ++   D   I+S    +I+   +   +Q+   + +++   +APNL  L+        ++  A+LI++AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   +      FG++L+ + +  L  +  G
Sbjct:   10 HAAGYALFSVKEAEEIGMLLPQVEASILDRAKFNTMVKLTAFYPFKSAQAALENINAISEGILHEDL-RLLLETNMPTPSKKNKVILGVADAKIGAAIQEELGIQGQTGGVVTEIIRGIRLHFHALVKGLTVQSAAKAQLGLGHSYSRAKVKFN--VNRADNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELIKIVPD-NYTYCRLTKLISNRKGLSEENLEALEELTMDSAKAQAILDASRSSMGMDISPIDLINIESFCTRVISLAEYRKGLQEYLRSKMSL---VAPNLGTLI-------GEVVGARLISQAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRLDCFSEIPTTV----FGEKLRDQVEERLSFYETG 413          
BLAST of Nop-domain-containing vs. Ensembl Sea Lamprey
Match: nop58 (NOP58 ribonucleoprotein homolog (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2140])

HSP 1 Score: 60.8474 bits (146), Expect = 2.874e-10
Identity = 70/309 (22.65%), Postives = 127/309 (41.10%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFL-----SIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    K+K N++ + N  V E++R IR  I   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++    ++++ + +         N   TD S ++ E  +     D++ A     G E+   D   I   S+++I       Q      N    IAPNL+ ++        +L  A+L+  AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S++L+ K ALA R D     ++ SE G
Sbjct:   93 AKLGGAIKDKLNMSCVYNTAVTELMRGIRSQIDSLITGLHPREMSAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKVITD-NLAYCKTIKKMGTGFRTNAATTDLSDIVPEEVEA----DVKAAAEISMGTEVSDEDITNITFLSEQVIEITEYRAQLYDYLKNRMMAIAPNLTIMV-------GELVGARLVAHAGSLLNLAKHPASTVQILGAEKALFRALKTQHDTPKYGLIYHASLVGQTTPKNKGKISRMLAAKSALAIRYDAL-GEDTTSEMG 387          
BLAST of Nop-domain-containing vs. Ensembl Yeast
Match: NOP56 (Essential evolutionarily-conserved nucleolar protein; component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects [Source:SGD;Acc:S000004187])

HSP 1 Score: 101.293 bits (251), Expect = 1.778e-23
Identity = 107/423 (25.30%), Postives = 195/423 (46.10%), Query Frame = 1
Query:   61 SGYCLFSVS-EFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPL-NVNEAHECCSNINENKIPQTLIKFIIKCDLQGDS-------IGSEFSNLSEEFKEKFN-VNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNT--TITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFL-----SIYLNEE-ITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            +GY +F V  + ++IG  +K V+  ++D   F+  ++L++F P     EA E  ++I+E  + ++L K I+  +L   S       +     NL    KE+F  V+ I+N    ++IR +R H  K  K   + D E+  L  L H         ++  +  ++  +  L+  L+K++NT    +K       PE  +L    + +FA+ +        LN++ + D +A++NE  D    + +        G+++ ++D   +   +  + +  +  +Q           +APNLS L+   I        A+LI+ AGSL  LS+ A+ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D +S   SN     FG  LK + +  L+ +  GK
Sbjct:   13 TGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESL-KAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQL-GLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPD-NYTFAKLVLFIKDKASLNDDSLHDLAALLNE--DSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG-------ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNV----FGSVLKKQVEQRLEFYNTGK 419          
BLAST of Nop-domain-containing vs. Ensembl Yeast
Match: NOP58 (Protein involved in producing mature rRNAs and snoRNAs; involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA [Source:SGD;Acc:S000005837])

HSP 1 Score: 80.4925 bits (197), Expect = 9.493e-17
Identity = 103/411 (25.06%), Postives = 186/411 (45.26%), Query Frame = 1
Query:   61 SGYCLFSVSE--FEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLN-VNEAHECCSNINENKIPQTLIKFI--IKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVT--NSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLF-DSLDISFARF---LSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPR-------------SGKDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDL 1221
            +GY L   S+    +   LI+ + S+   +K+F    K+  F   N    A E  ++I E K+   L K +  IK D +   I SE    +   K   N NV+++   ++I R I+ ++ + L   ++ D  K  L  L+H    +    +A  ++V    +  L+ +L+K LNT     K       PE  ++  DS  +++AR    + I      TD S ++ E  + +    ++ A     G E+ Q+D   I + +++I+ F    +Q         K IAPNL+ L+        +L  A+LI  +GSL  L++  +STI  L  + A+ R  K   D P+             +GK+K   + +++L+ K A++ R D  +  E   + G+ G + +++ +  L
Sbjct:   10 AGYALLKASDKKIYKSSSLIQDLDSSDKVLKEF----KIAAFSKFNSAANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSL-GLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDS--VAYARIILTMGIRSKASETDLSEILPEEIEER----VKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLV-------GELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNK--GKIARVLAAKAAVSLRYDALA--EDRDDSGDIGLESRAKVENRL 398          
BLAST of Nop-domain-containing vs. Ensembl Nematostella
Match: EDO37115 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM6])

HSP 1 Score: 106.301 bits (264), Expect = 1.195e-24
Identity = 102/420 (24.29%), Postives = 181/420 (43.10%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVN-EAHECCSNINENKIPQTLIKFIIKCDLQGDS-----IGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDS--LDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLK 1251
            H +GY LF V   EE+G L+  V+ A+ D+  F   VKL+ F P      A +  + I+E  I   L  F+      G       +G   S +    +E  N+   +   ++E++R IR H  K +K  T A   K  L  L H             ++  +  S  L+  L+K++NT    ++       PE V++ +   +    A+++    +        + + + D    K +  A  +  G ++   D   I+S + ++I   +  +      ++    +APNLS L+        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K ++ASR+D FS   ++     FG +L  + +  LK +  G+  K
Sbjct:    9 HAAGYALFKVIAQEEVGALLPEVQEAVGDLALFGKLVKLVAFSPFKSGTNALDNVNCISEGIIHDDLKAFVEANVPTGKKKSKVLLGVADSKIGAAIQESLNICCDSGGVILEVLRGIRMHFDKMIKGLTGAMASKAQL-GLGHSYSRAKVKFNIHRVDNMIIQSIALLDQLDKDINTFSMRIREWYSYHFPELVKIVNDNYMYAKVAKYIKSRKDLSEDKLEGLEDIVMDEAKAKAIYDASKSSMGMDISPLDLVNIESFATKVIGLADYRKSLHQYLISKMSSVAPNLSSLI-------GELVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKKKGNTPKYGLIFHSSFIGRADKKNKGRISRYLANKCSIASRIDCFSETPTSV----FGTKLHEQVEDRLKFYETGEAPK 416          
BLAST of Nop-domain-containing vs. Ensembl Nematostella
Match: EDO48964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI45])

HSP 1 Score: 65.4698 bits (158), Expect = 2.149e-11
Identity = 76/333 (22.82%), Postives = 139/333 (41.74%), Query Frame = 1
Query:  325 FKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSKIDVQV 1284
             KEK +VN + +  V E++R IR  +   +    + +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++    ++++A+ +   +           +EI   +  ++L+ A     G E+ Q D   I    D+I+       Q      N    IAPNL+ L+        +L  A+LI  AGSL  L++  SST+  L  + A+ R  K   D P+ G             K   + S++L+ K +LA R+D            + G + ++  +  LK+  DG+  KI  + K   +V
Sbjct:   99 IKEKLSVNCVASTAVHELMRGIRNQMNNLITGLQDREMSAMAL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYVMRCREWYGWHFPELGKIVTD-NLAYAKTVK-KMGMRTKAGELDFSEILPEEVEEELKTAAEISMGVEISQEDIDNIIFLCDQIMEVAEYRAQLYDYLKNRMTAIAPNLTVLV-------GELVGARLIAHAGSLLNLAKHPSSTVQILGAEKALFRALKTKHDTPKYGLIYHASLVGQSAPKHKGKISRMLAAKASLAIRVDALGEDVGT----DMGIEARANLEARLKMIEDGQMRKISGSGKKQAKV 417          
BLAST of Nop-domain-containing vs. Ensembl Medaka
Match: nop56 (NOP56 ribonucleoprotein [Source:NCBI gene;Acc:101168944])

HSP 1 Score: 108.997 bits (271), Expect = 4.576e-25
Identity = 102/419 (24.34%), Postives = 188/419 (44.87%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNIN--ENKIPQTLIKFIIKCDL-----QGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFH---IVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLN-EEITDK--SAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +GY LF+V E EEIG L+  V  ++  I KF+  V L  F P     A     NIN     +    +K  ++ +L     +  S+G   + +    +E+ N+++ T   V EI R IR H   +VK L     +  +     S S   V+ N  +  +   +  S  L+  L+K++NT    ++       PE +++  S +  + R   +  N +E+T++   ++   + D    + +  A  +  G ++   D   I+  S+ +++     Q  +    +   ++APNL+ L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G
Sbjct:   14 HAAGYALFAVKEVEEIGMLLPQVEESVLSIGKFNSMVSLAAFFPF--KSAQAALENINAISEGVVHADLKLFLETNLALSGKKKPSLGVSDAKIGAALQEELNISIQTGGVVAEITRGIRLHFHSLVKGLTSLAASKAQLGLGHSYSRAKVKFN--VNRADNMIIQSIALLDQLDKDINTFSMRVREWYGYHFPELIKIV-SENSMYCRLAQLIGNRKELTEEKLESLEEVVMDSAKAQAILEASRSSMGMDISPIDLINIERFSNRVVSLAAYRQGLQEYLRSKMSQVAPNLAALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSELPTSV----FGDKLREQVEERLSFYETG 416          
BLAST of Nop-domain-containing vs. Ensembl Medaka
Match: nop56 (NOP56 ribonucleoprotein [Source:NCBI gene;Acc:101168944])

HSP 1 Score: 108.997 bits (271), Expect = 5.369e-25
Identity = 102/419 (24.34%), Postives = 188/419 (44.87%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNIN--ENKIPQTLIKFIIKCDL-----QGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFH---IVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLN-EEITDK--SAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADG 1239
            H +GY LF+V E EEIG L+  V  ++  I KF+  V L  F P     A     NIN     +    +K  ++ +L     +  S+G   + +    +E+ N+++ T   V EI R IR H   +VK L     +  +     S S   V+ N  +  +   +  S  L+  L+K++NT    ++       PE +++  S +  + R   +  N +E+T++   ++   + D    + +  A  +  G ++   D   I+  S+ +++     Q  +    +   ++APNL+ L+        ++  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   + P+ G             K   R S+ L++K  +ASR+D FS   ++     FG +L+ + +  L  +  G
Sbjct:   10 HAAGYALFAVKEVEEIGMLLPQVEESVLSIGKFNSMVSLAAFFPF--KSAQAALENINAISEGVVHADLKLFLETNLALSGKKKPSLGVSDAKIGAALQEELNISIQTGGVVAEITRGIRLHFHSLVKGLTSLAASKAQLGLGHSYSRAKVKFN--VNRADNMIIQSIALLDQLDKDINTFSMRVREWYGYHFPELIKIV-SENSMYCRLAQLIGNRKELTEEKLESLEEVVMDSAKAQAILEASRSSMGMDISPIDLINIERFSNRVVSLAAYRQGLQEYLRSKMSQVAPNLAALI-------GEVVGARLISHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCTIASRIDCFSELPTSV----FGDKLREQVEERLSFYETG 412          
BLAST of Nop-domain-containing vs. Ensembl Medaka
Match: nop58 (NOP58 ribonucleoprotein [Source:NCBI gene;Acc:101168351])

HSP 1 Score: 57.3806 bits (137), Expect = 2.022e-8
Identity = 68/307 (22.15%), Postives = 132/307 (43.00%), Query Frame = 1
Query:  307 SNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGIN--VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFAR-FLSI--YLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-----------KDKLHSRESKILSDKVALASRMDYFSSRESNSERG 1179
            + L    K+K  ++ + +  V E++R IR  +   +      +     L  L+H         +   ++  +  + +L+ +L+K LN  +   +       PE  ++    ++++ +  L I    N   TD S ++ E  +     ++++A     G E+ + D   I+   D++I   +   Q      N    IAPNL+ ++        +L  A+LI+ AGSL  L++  +ST+  L  + A+ R  K   D P+ G             K   + S++L+ K +LA R D     ++N+E G
Sbjct:   93 AKLGGVIKDKLELSCVHSSAVAELMRCIRSQMESLISGLPPKEMSAMSL-GLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKVVVD-NLAYCKTVLKIGDRTNVATTDLSEILPEEVEA----EVKLAAEISMGTEVSEQDIANIRHLCDQVIEISDYRAQLYDYLKNRMTAIAPNLTVMV-------GELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGLIYHASLVGQTTAKNKGKISRMLAAKASLAIRYDAL-GEDTNAEMG 385          
BLAST of Nop-domain-containing vs. Planmine SMEST
Match: SMESG000004014.1 (SMESG000004014.1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 441/445 (99.10%), Postives = 443/445 (99.55%), Query Frame = 1
Query:   55 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNINENKIPQTLIKFIIKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSGKDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGKGLKIDETSKIDVQVRIQXXXXXXXXXXXXXXXXXXXXXXXXXXDMAPES 1389
            HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNINENKIPQTLIKFIIKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVR+FDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKE APNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRS KDKLHSRESKILSDKVALASRMDYFSSRESN+ERGEFGKQLKSRFDTDLKVWADGKGLKIDETSKIDVQVRIQRLKLKRKEKKKNWLKRKNSQKSQSNSDMAPES
Sbjct:    7 HYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMPLNVNEAHECCSNINENKIPQTLIKFIIKCDLQGDSIGSEFSNLSEEFKEKFNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENNTTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRMFDSLDISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKETAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSAKDKLHSRESKILSDKVALASRMDYFSSRESNAERGEFGKQLKSRFDTDLKVWADGKGLKIDETSKIDVQVRIQRLKLKRKEKKKNWLKRKNSQKSQSNSDMAPES 451          
BLAST of Nop-domain-containing vs. Planmine SMEST
Match: SMESG000024763.1 (SMESG000024763.1)

HSP 1 Score: 69.707 bits (169), Expect = 2.006e-12
Identity = 71/261 (27.20%), Postives = 116/261 (44.44%), Query Frame = 1
Query:  514 VTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLDISFARFLSIYLNEEITDKSAV--INEIFDCKNVKDLQIAINTV---YGKELIQSDKCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDLTAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSG-------------KDKLHSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWADGK 1242
            +  + NL+  ++K++NT    L+       PE  ++     + +AR +S+  +     +S +  I EI   ++    Q+ I T     G EL   D   IKS +D++I   NE +           ++APN S L+        D+ AA+LI+ AGSL  L++  +STI  L  + A+ R  K   + P+ G              DK   R S+ L+ K++LA R+D F     N     +G+ LK   +  L     GK
Sbjct:  166 IIQAINLLDQMDKDINTVSMRLREWFGYHYPELFKIVPDYKM-YARIVSLIESRAGAVQSNMERIEEIL--QDSSKSQMIIETAKSSMGYELSSEDFINIKSFADKLILMINERENTAKYLNRKMNQVAPNFSTLV-------GDIVAARLISHAGSLINLAKFPASTIQILGAEKALFRAIKSRGNTPKYGLIFHSSFIGRAAKGDK--GRISRFLAAKISLAVRLDCFMDEPINI----YGQHLKKHVEDQLVYLETGK 410          
The following BLAST results are available for this feature:
BLAST of Nop-domain-containing vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOP562.436e-2123.50NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HG... [more]
NOP561.046e-2023.50NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HG... [more]
NOP582.179e-1122.89NOP58 ribonucleoprotein [Source:HGNC Symbol;Acc:HG... [more]
NOP563.607e-826.25NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HG... [more]
NOP565.743e-825.00NOP56 ribonucleoprotein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol-563.027e-2126.35Nucleolar protein 56 [Source:UniProtKB/Swiss-Prot... [more]
nol-586.925e-1423.08NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:O4... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nop562.891e-2725.65gene:FBgn0038964 transcript:FBtr0084230[more]
nop52.176e-1124.05gene:FBgn0026196 transcript:FBtr0079369[more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nop562.702e-2524.83NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:Z... [more]
nop581.088e-823.20NOP58 ribonucleoprotein homolog (yeast) [Source:ZF... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nop561.545e-2323.68NOP56 ribonucleoprotein [Source:NCBI gene;Acc:7335... [more]
nop562.939e-2323.97NOP56 ribonucleoprotein [Source:NCBI gene;Acc:7335... [more]
nop563.176e-2324.23NOP56 ribonucleoprotein [Source:NCBI gene;Acc:7335... [more]
nop583.496e-1122.83NOP58 ribonucleoprotein [Source:NCBI gene;Acc:3949... [more]
nop583.650e-1122.83NOP58 ribonucleoprotein [Source:NCBI gene;Acc:3949... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nop562.346e-2022.54NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI... [more]
Nop586.127e-1222.78NOP58 ribonucleoprotein [Source:MGI Symbol;Acc:MGI... [more]
Nop581.386e-1122.78NOP58 ribonucleoprotein [Source:MGI Symbol;Acc:MGI... [more]
Nop562.255e-826.25NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI... [more]
Nop561.755e-722.73NOP56 ribonucleoprotein [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Nop-domain-containing vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54MT2|NOP56_DICDI1.221e-2425.91Nucleolar protein 56 OS=Dictyostelium discoideum O... [more]
sp|Q12460|NOP56_YEAST1.234e-2125.30Nucleolar protein 56 OS=Saccharomyces cerevisiae (... [more]
sp|O94514|NOP56_SCHPO1.099e-2025.53Nucleolar protein 56 OS=Schizosaccharomyces pombe ... [more]
sp|Q5RA29|NOP56_PONAB2.438e-2023.50Nucleolar protein 56 OS=Pongo abelii OX=9601 GN=NO... [more]
sp|Q21276|NOP56_CAEEL3.850e-2026.35Nucleolar protein 56 OS=Caenorhabditis elegans OX=... [more]
back to top
BLAST of Nop-domain-containing vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9FCX62.367e-3027.06Nop multi-domain protein OS=Oxytricha trifallax OX... [more]
A0A078AP594.863e-2926.06Nop domain-containing protein OS=Stylonychia lemna... [more]
A0A482XBS14.967e-2927.79Nop domain-containing protein OS=Laodelphax striat... [more]
A0A1Y1KXF51.902e-2727.10Nop domain-containing protein OS=Photinus pyralis ... [more]
A0A5N3ZYQ41.996e-2727.10Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nop562.231e-2424.29NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:Z... [more]
nop589.633e-1124.18NOP58 ribonucleoprotein [Source:NCBI gene;Acc:1030... [more]
nop581.119e-1024.18NOP58 ribonucleoprotein [Source:NCBI gene;Acc:1030... [more]
nop581.282e-1024.18NOP58 ribonucleoprotein [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nop561.605e-2324.41NOP56 ribonucleoprotein homolog [Source:ZFIN;Acc:Z... [more]
nop582.874e-1022.65NOP58 ribonucleoprotein homolog (yeast) [Source:ZF... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NOP561.778e-2325.30Essential evolutionarily-conserved nucleolar prote... [more]
NOP589.493e-1725.06Protein involved in producing mature rRNAs and sno... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO371151.195e-2424.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489642.149e-1122.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nop-domain-containing vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nop564.576e-2524.34NOP56 ribonucleoprotein [Source:NCBI gene;Acc:1011... [more]
nop565.369e-2524.34NOP56 ribonucleoprotein [Source:NCBI gene;Acc:1011... [more]
nop582.022e-822.15NOP58 ribonucleoprotein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Nop-domain-containing vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004014.10.000e+099.10SMESG000004014.1[more]
SMESG000024763.12.006e-1227.20SMESG000024763.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014621 ID=SMED30014621|Name=Nop-domain-containing|organism=Schmidtea mediterranea sexual|type=transcript|length=1423bp
AGCGTGATTACTATAATTAATATTTAATTTTAAAATATGAAAATTTTTTA
CATTCACTATTCTGGATATTGCTTATTTAGTGTATCTGAATTTGAAGAAA
TTGGGCATCTTATAAAATCGGTTCGTTCTGCATTAAGTGATATAAAAAAA
TTTTCAGGATTTGTAAAATTAATAAATTTTATGCCATTAAATGTGAATGA
AGCCCACGAATGTTGTTCAAATATTAATGAAAACAAAATTCCTCAAACTT
TAATTAAATTTATAATAAAATGTGATCTTCAAGGTGACTCTATTGGAAGC
GAATTTTCTAACCTTAGCGAAGAATTCAAAGAGAAATTTAATGTTAATGT
GATAACTAATGTTCGAGTTATGGAAATAATTCGATGGATTAGGTTTCACA
TCGTTAAAAAGTTAAAGAAATTTACAAATGCTGACAATGAGAAAACATTT
CTAAAATCATTGTCCCACAAAAACGTTGAAAATAACACCACCATAACTGC
AAGTGGTATAAACGTGACAAATAGTTATAATTTAATAATAAACTTGGAAA
AAAATCTAAATACCAAACTACAGAACCTTAAATCTTTAATCCAACCATTT
CTTCCCGAATTTGTTAGATTGTTCGATTCTCTCGATATATCATTTGCAAG
ATTCTTATCGATTTATTTAAATGAAGAAATTACCGACAAATCGGCTGTTA
TTAATGAAATTTTCGACTGTAAAAACGTCAAAGATTTACAAATCGCCATC
AATACCGTTTATGGCAAAGAACTAATTCAATCGGATAAATGTTTTATTAA
AAGCACAAGTGATGAGATAATAAATTTCTACAATGAAATTCAACAATGCA
AAACGACAACGCTGAATATAACGAAAGAAATCGCACCGAATTTGAGCTGT
CTGTTAGAGAGAACAATTGCAAATGAATGCGACTTAACAGCAGCGAAATT
GATTACCAAGGCGGGCTCGTTGAAAAAGCTCTCGGAATTGGCGAGCTCGA
CAATTCACACGTTGACATTTCAGGACGCCATGCTGAGGAAGGGCAAATTC
GCATCGGATATTCCCCGCTCAGGAAAGGATAAACTGCACAGCAGAGAATC
GAAAATTCTCTCTGATAAAGTCGCTCTTGCTTCTCGGATGGATTATTTCT
CATCTCGGGAATCCAATTCCGAGCGAGGAGAGTTCGGGAAACAGTTGAAA
TCGAGATTCGACACGGATTTGAAGGTCTGGGCCGATGGAAAGGGGCTGAA
AATCGATGAAACAAGCAAAATCGATGTTCAGGTAAGAATTCAAAGATTGA
AACTGAAAAGAAAGGAGAAAAAGAAAAATTGGCTTAAAAGGAAAAATAGC
CAGAAATCCCAGTCAAATTCTGATATGGCACCAGAATCATGAGATTTATT
TTAATATATTTGTTGATTTAAAA
back to top

protein sequence of SMED30014621-orf-1

>SMED30014621-orf-1 ID=SMED30014621-orf-1|Name=SMED30014621-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
MKIFYIHYSGYCLFSVSEFEEIGHLIKSVRSALSDIKKFSGFVKLINFMP
LNVNEAHECCSNINENKIPQTLIKFIIKCDLQGDSIGSEFSNLSEEFKEK
FNVNVITNVRVMEIIRWIRFHIVKKLKKFTNADNEKTFLKSLSHKNVENN
TTITASGINVTNSYNLIINLEKNLNTKLQNLKSLIQPFLPEFVRLFDSLD
ISFARFLSIYLNEEITDKSAVINEIFDCKNVKDLQIAINTVYGKELIQSD
KCFIKSTSDEIINFYNEIQQCKTTTLNITKEIAPNLSCLLERTIANECDL
TAAKLITKAGSLKKLSELASSTIHTLTFQDAMLRKGKFASDIPRSGKDKL
HSRESKILSDKVALASRMDYFSSRESNSERGEFGKQLKSRFDTDLKVWAD
GKGLKIDETSKIDVQVRIQRLKLKRKEKKKNWLKRKNSQKSQSNSDMAPE
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR042239Nop_C
IPR036070Nop_dom_sf
IPR002687Nop_dom
IPR012974NOP5_N
Vocabulary: biological process
TermDefinition
GO:0000154rRNA modification
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0030515snoRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005732small nucleolar ribonucleoprotein complex
GO:0031428box C/D snoRNP complex
GO:0032040small-subunit processome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042239Nop, C-terminal domainGENE3DG3DSA:1.10.246.90coord: 283..402
e-value: 1.8E-12
score: 49.0
IPR002687Nop domainPFAMPF01798Nopcoord: 168..396
e-value: 2.7E-18
score: 66.3
IPR002687Nop domainPROSITEPS51358NOPcoord: 282..400
score: 18.654
IPR012974NOP5, N-terminalPFAMPF08156NOP5NTcoord: 9..65
e-value: 1.5E-4
score: 22.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 437..451
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 427..451
NoneNo IPR availablePANTHERPTHR10894:SF0NUCLEOLAR PROTEIN 56coord: 3..444
NoneNo IPR availablePANTHERPTHR10894NUCLEOLAR PROTEIN 5 NUCLEOLAR PROTEIN NOP5 NOP58coord: 3..444
IPR036070Nop domain superfamilySUPERFAMILYSSF89124Nop domaincoord: 160..392