Thioredoxin domain-containing protein 3-like protein

Overview
NameThioredoxin domain-containing protein 3-like protein
Smed IDSMED30014617
Length (bp)2275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thioredoxin domain-containing protein 3-like protein (SMED30014617) t-SNE clustered cells

Violin plots show distribution of expression levels for Thioredoxin domain-containing protein 3-like protein (SMED30014617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thioredoxin domain-containing protein 3-like protein (SMED30014617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thioredoxin domain-containing protein 3-like protein (SMED30014617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30014617SMESG000006982.1 Contig40467newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014617SMESG000006982.1 Contig40467uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014617SMESG000064158.1 SMESG000059097.1 SMESG000055018.1 SMESG000052066.1 SMESG000035540.1 SMESG000021457.1 SMESG000017191.1 SMESG000015033.1 SMESG000012241.1 SMESG000008645.1 SMESG000006982.1 Contig30972newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014617SMESG000064158.1 SMESG000059097.1 SMESG000055018.1 SMESG000052066.1 SMESG000035540.1 SMESG000021457.1 SMESG000017191.1 SMESG000015033.1 SMESG000012241.1 SMESG000008645.1 SMESG000006982.1 Contig30972uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 247.284 bits (630), Expect = 5.942e-72
Identity = 177/595 (29.75%), Postives = 310/595 (52.10%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK-DVE-NAKISSPNSLRAIYGLAGFKNAIHS-------------AETREEA---IKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDY--RKLTVR-DMD-IP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQ 1765
            M +KK +    T + NQ  WD++L+ +GL V D+YQ W GPC+++  LF KL  E+N D+I  FA  + D++ +L  ++ KCEP FL    G+++  I+G+NAP++ +  +    EE K+  GEM R    +  ++ ++   +V  E+  E  +   + AIIKPDA+++ K+ ++   I +  F I  +    L++E+V++ YS+       EE+ +FMTSG   I+ +   +++      E T P+ D E N +      + A       KN   S              +  E+A    K +   FPD  FKK    S  LE+ + LL   ++ E K+ ++    D D K+++Q +  L +     + KE  N+ + F + +E M       +     N +     +LG    E+ ++Y    L  +  MD +P + +Y S   E A+R+  +FFP+Q T  +IKP A  EQR++I+K++K  GF +  V  + L+  + E+IY  +    ++  ++E L+   S VM+L+K++A+ EWR  +G  +PEEA   SPD +R  FG + ++N +HG+++  +    +N +F + +
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS--EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPS--EETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPD--FKKM--KSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENE-DYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Match: NME8 (NME/NM23 family member 8 [Source:HGNC Symbol;Acc:HGNC:16473])

HSP 1 Score: 247.284 bits (630), Expect = 5.942e-72
Identity = 177/595 (29.75%), Postives = 310/595 (52.10%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK-DVE-NAKISSPNSLRAIYGLAGFKNAIHS-------------AETREEA---IKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDY--RKLTVR-DMD-IP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQ 1765
            M +KK +    T + NQ  WD++L+ +GL V D+YQ W GPC+++  LF KL  E+N D+I  FA  + D++ +L  ++ KCEP FL    G+++  I+G+NAP++ +  +    EE K+  GEM R    +  ++ ++   +V  E+  E  +   + AIIKPDA+++ K+ ++   I +  F I  +    L++E+V++ YS+       EE+ +FMTSG   I+ +   +++      E T P+ D E N +      + A       KN   S              +  E+A    K +   FPD  FKK    S  LE+ + LL   ++ E K+ ++    D D K+++Q +  L +     + KE  N+ + F + +E M       +     N +     +LG    E+ ++Y    L  +  MD +P + +Y S   E A+R+  +FFP+Q T  +IKP A  EQR++I+K++K  GF +  V  + L+  + E+IY  +    ++  ++E L+   S VM+L+K++A+ EWR  +G  +PEEA   SPD +R  FG + ++N +HG+++  +    +N +F + +
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS--EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPS--EETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPD--FKKM--KSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENE-DYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 201.445 bits (511), Expect = 7.460e-58
Identity = 112/310 (36.13%), Postives = 172/310 (55.48%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDI----------EDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSET--ENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQD 949
            MG++K +     ++  QE W+++L  +GL V D+YQ W GPCK VVSLF K+  EV  D + FA  + D +  L  Y+GKCEPTFL   GG+LV V+RG+NAP++++T L++   E KV+    ER VI+D  +   ++           ED+++      +E   T AIIKPDA+ + K +++I  I+E  F I+  E R +++ EV   Y      +  E+    M SG   ++ L      E+ V   R + GP+D   A+   P SLRA YG     NA+H +  RE+A + ++++FP L F  +D
Sbjct:    1 MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDECVSHGKNNGEDEDMVS------SERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKD 304          

HSP 2 Score: 75.8702 bits (185), Expect = 4.230e-14
Identity = 44/143 (30.77%), Postives = 79/143 (55.24%), Query Frame = 2
Query: 1367 TFAIIKPDA--YEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKF----DAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDER 1777
            T AIIKPDA  + + DEII  I+  GF +   ++  ++ AE    Y++      F++++ ++ S  S +++L++     D +  WR  +G  +P  A  E P+ LR  +G+ +  NA+HGS   ED  R + L+F + +F ++
Sbjct:  161 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDK 303          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 152.14 bits (383), Expect = 1.584e-41
Identity = 84/209 (40.19%), Postives = 124/209 (59.33%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRD-----------SGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEV 649
            MG++K +     ++  QE W+++L  +GL V D+YQ W GPCK VVSLF K+  EV  D + FA  + D +  L  Y+GKCEPTFL   GG+LV V+RG+NAP++++T L++   E KV+    ER VI+D            G    ED ED+++      +E   T AIIKPDA+ + K +++I  I+E  F I+  E R +++ EV
Sbjct:    1 MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDECVSHGKNNGED-EDMVS------SERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEV 202          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Match: NME9 (NME/NM23 family member 9 [Source:HGNC Symbol;Acc:HGNC:21343])

HSP 1 Score: 140.198 bits (352), Expect = 1.118e-36
Identity = 92/278 (33.09%), Postives = 135/278 (48.56%), Query Frame = 2
Query:  122 LLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSET--ENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQD 949
            +L  +GL V D+YQ W GPCK VVSLF K+  EV  D + FA  + D +  L  Y+GKCEPTFL                          Y  + + +  E E +     G    ED ED+++      +E   T AIIKPDA+ + K +++I  I+E  F I+  E R +++ EV   Y      +  E+    M SG   ++ L      E+ V   R + GP+D   A+   P SLRA YG     NA+H +  RE+A + ++++FP L F  +D
Sbjct:    1 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLF-------------------------YAIKDEALSDEDECV---SHGKNNGED-EDMVS------SERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDKD 243          

HSP 2 Score: 75.8702 bits (185), Expect = 1.828e-14
Identity = 44/143 (30.77%), Postives = 79/143 (55.24%), Query Frame = 2
Query: 1367 TFAIIKPDA--YEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKF----DAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDER 1777
            T AIIKPDA  + + DEII  I+  GF +   ++  ++ AE    Y++      F++++ ++ S  S +++L++     D +  WR  +G  +P  A  E P+ LR  +G+ +  NA+HGS   ED  R + L+F + +F ++
Sbjct:  100 TLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKFSDK 242          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 59.3066 bits (142), Expect = 4.387e-10
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  IKPD   +    +II   +  G+ +  +  +  S A  E  Y+++K+  +F  +IE ++S     MV    D +++ R  +G+ NP  +   +P  +RG F     +N  HGS +++   R I   F
Sbjct:    7 TFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 59.3066 bits (142), Expect = 4.387e-10
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  IKPD   +    +II   +  G+ +  +  +  S A  E  Y+++K+  +F  +IE ++S     MV    D +++ R  +G+ NP  +   +P  +RG F     +N  HGS +++   R I   F
Sbjct:    7 TFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 59.3066 bits (142), Expect = 4.387e-10
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  IKPD   +    +II   +  G+ +  +  +  S A  E  Y+++K+  +F  +IE ++S     MV    D +++ R  +G+ NP  +   +P  +RG F     +N  HGS +++   R I   F
Sbjct:    7 TFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 59.3066 bits (142), Expect = 4.387e-10
Identity = 36/131 (27.48%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  IKPD   +    +II   +  G+ +  +  +  S A  E  Y+++K+  +F  +IE ++S     MV    D +++ R  +G+ NP  +   +P  +RG F     +N  HGS +++   R I   F
Sbjct:    7 TFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLAS---APGTIRGDFCIQTGRNICHGSDAVDSANREIAHWF 134          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Match: trx-1 (Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09433])

HSP 1 Score: 48.521 bits (114), Expect = 8.537e-7
Identity = 27/86 (31.40%), Postives = 39/86 (45.35%), Query Frame = 2
Query:  134 QGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYM-YKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLE 388
            + + + D Y  W GPCK++  L+ +LA       I F +V VD    L   Y  K  PTF+    G  +  + G     +RQ  LE
Sbjct:   26 EKIIILDFYATWCGPCKAIAPLYKELA--TTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKVLE 109          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 82.0333 bits (201), Expect = 5.640e-18
Identity = 43/138 (31.16%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            E+T A+IKP  + N      I  +  +NF I+ ++   ++KE     Y++           +FM SG    + L SET  C+ K R + GP  V  A  S PN +RA+YG++  +NA H +++   A++ +S++FP+ 
Sbjct:    2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSET--CIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPEF 137          

HSP 2 Score: 51.9878 bits (123), Expect = 1.553e-7
Identity = 31/134 (23.13%), Postives = 63/134 (47.01%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEI--IKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            +++T A+IKP        +  I+ + +  F +    ++ ++   +E  Y   K   ++ R+   + S  S  ++L     I++WR  +G      A    P+ +R ++G +  +NA HGS S     R I+++F
Sbjct:    1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILF 134          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Match: CG14221 (gene:FBgn0031042 transcript:FBtr0332485)

HSP 1 Score: 71.2478 bits (173), Expect = 1.890e-12
Identity = 43/145 (29.66%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  101 NQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAP-------------IIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAET 496
            + E ++K L+  GL V DIY EW GPC  +V    K+  E+  D +  A  K  S+  L  +  K EPT++ +  G+ + ++ G++ P             + ++T L     EL+ +  E+E++ +R+  +  AE+IE  LAE+
Sbjct:   16 SDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEITELQPI--ELEQLEVRNKALRLAEEIE--LAES 156          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Match: CG18130 (gene:FBgn0030359 transcript:FBtr0073581)

HSP 1 Score: 69.3218 bits (168), Expect = 8.784e-12
Identity = 28/90 (31.11%), Postives = 51/90 (56.67%), Query Frame = 2
Query:   95 VENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAP 364
            ++  E  ++ ++  GL V D+Y EW GPC+ +V    K+  +V  D +  A  K D++ +L  +  + EP +L + GG+ V ++ GS+ P
Sbjct:   14 IQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVP 103          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Match: nmdyn-D7 (gene:FBgn0028997 transcript:FBtr0082083)

HSP 1 Score: 53.1434 bits (126), Expect = 5.361e-7
Identity = 40/158 (25.32%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  464 AEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATF---MTSGKCCIM--ALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            +E    ++ E V++ T    T AIIKP +I +  + D+I  I    F +    +  +++      Y  +  +  + EY      + SG C  M  A     +    + R   GP D E AK+  P++LRA +G +  +NA+H  +  +++   +  MF
Sbjct:  232 SEARHSIIKECVFKNT----TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGV--VPEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMF 383          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346611)

HSP 1 Score: 49.2914 bits (116), Expect = 1.377e-6
Identity = 34/149 (22.82%), Postives = 65/149 (43.62%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSED 964
            E TF ++KPD +    +  +I+  +++ F ++  +    SKE +   Y+   +         +M SG    M    E  N V   R++ G     N   S P ++R  + +   +N IH ++  E A K +++ F +       P ++D
Sbjct:    6 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVW--EGLNVVKTGRQMLG---ATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKD 149          

HSP 2 Score: 48.9062 bits (115), Expect = 2.116e-6
Identity = 32/131 (24.43%), Postives = 62/131 (47.33%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF ++KPD  ++    +II+  +  GF +  +     S    E+ Y ++    +F  ++  + S     MV    + ++  R  +G+ NP ++    P  +RG F   + +N +HGS ++E   + I L F
Sbjct:    8 TFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSL---PGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWF 135          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Match: nme8 (NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE-070410-39])

HSP 1 Score: 269.626 bits (688), Expect = 5.422e-81
Identity = 161/511 (31.51%), Postives = 264/511 (51.66%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLA-----ETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENC---VAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQD--PTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIP------EDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIE 1540
            M  KK +     ++ N E W + L  +GL V D+YQ+W GPC++VV LF K+  E+  + + FA  + D + +L MY+GKCEPTFL   GG+LV V+RG NAP++++T  E+   E  V++    R  ++D G+   E++ D        E V   T+   T AIIKPD + + K +++I  I++  F I+  E R L++ E    Y    +    +E   FM+SG   ++ + S+TE C   +   RE  GP DVE A+   P SLRA YG     N +H +  RE A + ++  FP+  F   D  P  E +ER + L+      E++  I+++      +V  Q E  L +  +   Y   + + E F   +E M   +   +    +  +     +LG   P      + D    + +V +  I  L + SS  E A+++ ++FFP + T A+IKPD  + ++EI++ I+A GF +  + D +LS   AEE YK  +E  +F ++++
Sbjct:    1 MAAKKKEISLQININNDEQWSEALALKGLLVVDVYQQWCGPCRAVVGLFRKIKNELGDELLHFATAEADGIEALEMYRGKCEPTFLFYAGGELVSVLRGPNAPLLQKTIQEELSNEKNVLEHGGARRAVKDEGLTEEEEVNDDTEDHPHDEDVTVPTDKSYTVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVI-SKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEE-EYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQL-HGSSSSEEAEKEISFFFPPEDTLAVIKPDT-QHKEEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVD 507          

HSP 2 Score: 89.7373 bits (221), Expect = 3.033e-18
Identity = 69/272 (25.37%), Postives = 126/272 (46.32%), Query Frame = 2
Query:  974 VVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICF-ECKNCINIVNYMLGLYIPEDDMDYRKLTVRDM-------DIPDLVYASSKKEIAKRDENYFFP---------------IQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFG---STIIQNALHG 1708
            V I+ P+ +     + II +  D    ++   E TL ++     Y+    +   F+E V+ M+    +V+   + + C +++        P D  + R+     +        + + ++ SS +E A R+  +FFP               ++ T A+++PDA  E R+EI+  I+  GF + +  +++L+  +    Y    E  YF+ ++EN+TS L   + L K  A+  WR+ +G  +P +A  E PD LR  F    S+I  N LHG
Sbjct:  163 VAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAE-PYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFPNFSFSVWDSRPEEEPVERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSI--NQLHG 431          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Match: nme5 (NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE-040718-221])

HSP 1 Score: 76.6406 bits (187), Expect = 3.149e-15
Identity = 45/141 (31.91%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFK 940
            E T A+IKPDAI  +K +++ D+I +  F I++K   +LS E+    Y++            FM+SG   ++AL    +  +A  + I GP     A+ + P+ LRA +G    +NA+H +ET   A + +  MFP  V +
Sbjct:   23 ERTLALIKPDAI--HKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGP--VVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMFPHSVIE 159          

HSP 2 Score: 64.6994 bits (156), Expect = 3.139e-11
Identity = 40/135 (29.63%), Postives = 67/135 (49.63%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            ++ T A+IKPDA  + DEI  +I   GF +     + LS  +  + Y       +F  +   ++S     + L++  AI  W+  +G  +  +A E  PD LR  FG+  ++NA+HGS +     R I  +F +S
Sbjct:   22 VERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMFPHS 156          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 70.0922 bits (170), Expect = 2.050e-13
Identity = 42/140 (30.00%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSG--KCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++T A+IKPDA+ +  + + +     ENF II+K+     K +    Y++       +    FM+SG  +  I+A     E+ +   R + GP  V  A+ SSP +LR  YGL   +N  H +++ E A + +S  FP+ 
Sbjct:    8 QLTLAVIKPDAMAHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILA----REDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPEF 143          

HSP 2 Score: 68.1662 bits (165), Expect = 1.016e-12
Identity = 44/134 (32.84%), Postives = 66/134 (49.25%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKA--GGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            +QLT A+IKPDA      +  L +     F +    D++   A++E  Y       +F R++E ++S      +L++ DAI  WR  +G      A   SP+ LRG +G T  +N  HGS SIE   R I+  F
Sbjct:    7 LQLTLAVIKPDAMAHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFF 140          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Match: nme7 (NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE-000210-35])

HSP 1 Score: 72.7886 bits (177), Expect = 3.574e-13
Identity = 44/137 (32.12%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL-GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFP 925
            E T A+IKPDA+  +K+ D+I MI + N  + K ++ KL+ ++    Y +  S         F++SG    M L G E    V+  R++ GP D   A+  + +SLR  +G  G KNA H +++   A + +   FP
Sbjct:   90 ERTLAMIKPDAV--SKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEA---VSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFP 221          

HSP 2 Score: 60.077 bits (144), Expect = 4.464e-9
Identity = 43/176 (24.43%), Postives = 78/176 (44.32%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKI 1894
            T A+IKPDA  +  +II++I      +       L+  +A + Y   +  ++F+ +++ ++S     M L   +A+  WR  +G  +   A +E+   LRG FG+   +NA HGS S+    R +   F ++      N +                I +P ++ E     +LK I
Sbjct:   92 TLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFPSTAGHGLSNTA--------KYSDCTCCIIKPHAISEALTGKILKSI 259          

HSP 3 Score: 55.4546 bits (132), Expect = 1.549e-7
Identity = 41/141 (29.08%), Postives = 61/141 (43.26%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSK---EEVMSLYSKFLSIDIIEEYATF---MTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            + T  IIKP AI       ++  I E  F I   ++  + +   EE + +Y       ++ EY      + SG C  MAL     +     RE  GP D E A+   P +LRA+YG    +N +H  +  E+ I  V   F
Sbjct:  236 DCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYK-----GVVAEYTKMVDELCSGPC--MALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTDLPEDGILEVQYFF 369          

HSP 4 Score: 54.299 bits (129), Expect = 3.359e-7
Identity = 45/168 (26.79%), Postives = 71/168 (42.26%), Query Frame = 2
Query: 1304 YASSKKEIAKRDENYFFPI-------------QLTFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEE---IYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            + S     A R+  YFFP                T  IIKP A  +    +I+K I   GF +  +    +  A AEE   +YK +     + ++++ L S     + +   DA R +R+F G  +PE A    P  LR ++G   +QN +H +   ED    +   F
Sbjct:  204 HGSDSLASAARELEYFFPSTAGHGLSNTAKYSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGV--VAEYTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTDLPEDGILEVQYFF 369          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 63.1586 bits (152), Expect = 4.090e-11
Identity = 36/131 (27.48%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  +KPD  ++R   EII+  +  GF +  +  +  S A+  + Y  ++E  +++ +++ ++S     MV    D ++  R  +G  NP ++    P  +RG +   + +N +HGS S+E   R I+L F
Sbjct:   24 TFLAVKPDGVQRRLVGEIIRRFERKGFKLVGMKLLQASEAQLRQHYWELREKPFYNGLVKYMSSGPIVAMVWQGLDVVKTARKMLGETNPADSL---PGTIRGDYCVEVGRNVIHGSDSVESAAREISLWF 151          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 348.206 bits (892), Expect = 9.310e-110
Identity = 206/588 (35.03%), Postives = 317/588 (53.91%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 348.206 bits (892), Expect = 1.378e-109
Identity = 206/588 (35.03%), Postives = 317/588 (53.91%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 344.354 bits (882), Expect = 2.867e-108
Identity = 202/575 (35.13%), Postives = 312/575 (54.26%), Query Frame = 2
Query:   95 VENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:   15 LSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 587          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Match: nme9 (NME/NM23 family member 9 [Source:NCBI gene;Acc:100158550])

HSP 1 Score: 322.398 bits (825), Expect = 4.710e-100
Identity = 193/574 (33.62%), Postives = 300/574 (52.26%), Query Frame = 2
Query:   95 VENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMID--MIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T                D  +  K+N +     I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:   15 LSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQT---------------EDEELGEKLNKIYTSFQIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 571          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:780075])

HSP 1 Score: 74.7146 bits (182), Expect = 1.758e-14
Identity = 44/137 (32.12%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPD 928
            E T AIIKPD +  +K  ++ D+I    F+I++K    LS E+    YS             +M+SG   I+A+     N ++  +E+ GP +   AK + P SLRA+YG    +NA+H +     A + +  MFP+
Sbjct:   21 ERTLAIIKPDVL--HKAEEIEDIILRCGFHIVQKRKVHLSPEQCSDFYSDQYGKMFFPSLTAYMSSGP--IIAMTLARYNAISYWKELIGPTNSLKAKETHPESLRAVYGTDDLRNALHGSYCFTSAEREIRFMFPE 153          

HSP 2 Score: 73.9442 bits (180), Expect = 3.135e-14
Identity = 40/132 (30.30%), Postives = 68/132 (51.52%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            ++ T AIIKPD   + +EI  +I   GF +     + LS  +  + Y +     +F  +   ++S     M L++++AI  W++ IG  N  +A E  P+ LR ++G+  ++NALHGS       R I  +F
Sbjct:   20 VERTLAIIKPDVLHKAEEIEDIILRCGFHIVQKRKVHLSPEQCSDFYSDQYGKMFFPSLTAYMSSGPIIAMTLARYNAISYWKELIGPTNSLKAKETHPESLRAVYGTDDLRNALHGSYCFTSAEREIRFMF 151          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 239.195 bits (609), Expect = 4.273e-69
Identity = 179/595 (30.08%), Postives = 306/595 (51.43%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK---DVENAKISSPNSLRAIYGLAGFKNAIHSAETRE----------EAIKS---VSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDM--DYRKLTVR--DMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF--GNSQ 1765
            M +KK +    + V +Q  WD++L  +GL V D+YQ W GPCK+V SLF KL  E+N D+I  F   + D++ +L  ++ KCEP FL    G+++  I+G+NAP+I +  +    EE K++ GEM+R    +  ++ A  I++   E  YE        AIIKPDA++  K  ++ + I +E F I  +E   L +E V   Y+        EE+   MT+G  C++ +  E    +   +E T P+   + E   +  P+   A   +   ++++     R+          +A+K    + ++FPD  FK    T  +++  + LL   I  E+K+ ++N   +    ++ Q +  L +     V K I    E F+  +  M  +  YV+    +N +     ++G    E+      + L V+    + P +  Y SS K  A+++  +FFP Q T A+IKP   +++R EI+K IK  GF + L+ ++ L+   A +IY  I    ++  V+E L+  +S VMVL+K++A+ EWR  +G  +PEEA   SP+ LR  +G  I++NA+HG+++  +    I+ VF  GN +
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVDA--IDEEYGEVQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVI---QEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPD--FKTMKST--NVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCK-IHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVFTEGNPE 585          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Match: Nme9 (NME/NM23 family member 9 [Source:MGI Symbol;Acc:MGI:4359686])

HSP 1 Score: 179.104 bits (453), Expect = 8.468e-50
Identity = 107/313 (34.19%), Postives = 161/313 (51.44%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTE---GE----------MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSE--TENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQD 949
            MG +K +     ++  QE W+++L  +GL V D+YQ W GPCK +VSLF K+  EV  D++ FA  + D +  L  Y+GKCEPTFL    G+LV V++G+N  ++++T L+         Q E E+ V  + G  RA   E++L    +       GE           T  IIKPDA+ + K  ++I  I+E  F I+ KE R L++ E+ + Y      +  E     M SG   ++ L     TE+ V   R   GP D   A+   P SLRA YG     NA+H +  RE+A + ++++FP   F  +D
Sbjct:    1 MGNRKKEIALQVNINTQELWEEMLGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFYTRGELVAVVKGANPTLLQKTILQ---------QLEAEKKVPAEGGEWRAATDEELLGALKWPPHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFSDKD 304          

HSP 2 Score: 84.7297 bits (208), Expect = 3.492e-17
Identity = 52/186 (27.96%), Postives = 98/186 (52.69%), Query Frame = 2
Query: 1238 IPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDA--YEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKF----DAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDER 1777
            +P +  ++R  T  ++ +  L +   +K+  +  +        T  IIKPDA  + + +EII  I+  GF + L ++  L+ AE +  Y++      F+R++ ++ S  S +++L+K     D +  WR F+G  +P  A  E P+ LR  +G+ +  NA+HGS   ED  R + L+F + +F ++
Sbjct:  119 VPAEGGEWRAATDEEL-LGALKWPPHRKDGGEDGDIASSGKTCTLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQHRAREEAFERLVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSRDREDANRELALLFPSFKFSDK 303          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Match: Nme8 (NME/NM23 family member 8 [Source:MGI Symbol;Acc:MGI:1920662])

HSP 1 Score: 162.155 bits (409), Expect = 1.930e-42
Identity = 131/466 (28.11%), Postives = 226/466 (48.50%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK---DVENAKISSPNSLRAIYGLAGFKNAIHSAETRE----------EAIKS---VSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDM--DYRKLTVR--DMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKP 1387
            M +KK +    + V +Q  WD++L  +GL V D+YQ W GPCK+V SLF KL  E+N D+I  F   + D++ +L  ++ KCEP FL    G+++  I+G+NAP+I +  +    EE K++ GEM+R    +  ++ A  I++   E  YE        AIIKPDA++  K  ++ + I +E F I  +E   L +E V   Y+        EE+   MT+G  C++ +  E    +   +E T P+   + E   +  P+   A   +   ++++     R+          +A+K    + ++FPD    K    S +++  + LL   I  E+K+ ++N   +    ++ Q +  L +     V K I    E F+  +  M  +  YV+    +N +     ++G    E+      + L V+    + P +  Y SS K  A+++  +FFP Q T A+IKP
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVDA--IDEEYGEVQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVI---QEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMK----STNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCK-IHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKP 456          

HSP 2 Score: 63.5438 bits (153), Expect = 5.233e-10
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 2
Query: 1358 IQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGS-TIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISN 1813
            +Q T A++ PD   E++D+++ +I   GF + +   IVLS  EA  + K  +   YFD +I ++TS  S V+ L + + +  W+  IG    EEA    P  L   F S     N  +GS+S     + I   F       +  L+++KP +++
Sbjct:  312 VQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFP-----PQSTLALIKPHVTH 460          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 76.6406 bits (187), Expect = 7.767e-15
Identity = 39/132 (29.55%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            T A+IKPDA  +  EII++I   GF +  +  + L+  EA + + +     +++ +I+ +TS     M + + DAI EW+  +G  N   +  ++P  +R +FG+  ++NA HG  +     R + L F +S
Sbjct:  113 TLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSS 244          

HSP 2 Score: 73.559 bits (179), Expect = 8.270e-14
Identity = 39/136 (28.68%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFP 925
            E T A+IKPDA+  +K  ++I+MI +  F I K  +  L+++E    +    S     E   F+TSG   ++A+    ++ + + + + GP +   ++  +P S+RA++G  G +NA H  +T   A + + + FP
Sbjct:  111 EKTLALIKPDAV--SKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGP--VIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFP 242          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 77.0258 bits (188), Expect = 2.054e-14
Identity = 39/132 (29.55%), Postives = 71/132 (53.79%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            T A+IKPDA  +  EII++I   GF +  +  + L+  EA + + +     +++ +I+ +TS     M + + DAI EW+  +G  N   +  ++P  +R +FG+  ++NA HG  +     R + L F +S
Sbjct:  113 TLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSS 244          

HSP 2 Score: 73.9442 bits (180), Expect = 2.225e-13
Identity = 39/136 (28.68%), Postives = 73/136 (53.68%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFP 925
            E T A+IKPDA+  +K  ++I+MI +  F I K  +  L+++E    +    S     E   F+TSG   ++A+    ++ + + + + GP +   ++  +P S+RA++G  G +NA H  +T   A + + + FP
Sbjct:  111 EKTLALIKPDAV--SKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGP--VIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFP 242          

HSP 3 Score: 58.151 bits (139), Expect = 2.085e-8
Identity = 39/136 (28.68%), Postives = 63/136 (46.32%), Query Frame = 2
Query:  524 TFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEY---ATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            T  IIKP AI    +  ++  I++  F +   ++  L +  V   Y  +  +  + EY    T + SG C  +A+  +  N     RE  GP D E A+   P +LRAI+G    +NA+H  +  E+ +  V   F
Sbjct:  259 TCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGV--VSEYNDMVTELCSGPC--VAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFF 390          

HSP 4 Score: 56.6102 bits (135), Expect = 6.587e-8
Identity = 48/159 (30.19%), Postives = 69/159 (43.40%), Query Frame = 2
Query: 1328 AKRDENYFFP-------------IQLTFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKE--TTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            A R+   FFP                T  IIKP A  +    +I+  I+   FGM  +    L  A  EE Y+  K   + Y D V E L S     + + + +  + +R+F G  +PE A    P+ LR IFG T +QNA+H +   ED    +   F
Sbjct:  233 AAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKILIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTE-LCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFF 390          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q95YJ5|TXND3_CIOIN (Thioredoxin domain-containing protein 3 homolog OS=Ciona intestinalis OX=7719 GN=CiIC3 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.006e-92
Identity = 178/587 (30.32%), Postives = 311/587 (52.98%), Query Frame = 2
Query:  101 NQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEG-----EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLV----------------FKKQDPTSED-LERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYR------KLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
             QE+W+  +    L+V D +Q+W GPC ++V +  ++  E+  D + FA  +VD + +L  Y+GKCEP FL  GGG+LV  +RG NAP++++T  E    E K++ GEMER V RD   + ++  +    E   E  EG     ++T A+IKPD + N ++++++  I E    ++  E R L+ EE    Y      +  ++   ++TSG C ++ L  G   E  V   R+I GP D   AK  +P+SLRAIYG     NA+H + + EEA++ +   FPD                   + + P+ +  L+R + ++        K+SI+ +  +   K+  Q E  L +      Y E  +  + FE  V++M       +C    + ++    MLG  +  D ++ +      +  V + ++ ++++ S   E A+ + +  F ++ T A+IKPDA +++++I+  +K  GF +    D+ LS   A EIYK+ + + Y+D +I+++TS  + +MVLS  +A+ + RD +G  +PE A E  P+ LR +F  +I++NA+H  ++ E     I +VFG++QFD
Sbjct:   15 TQEAWEVAMNSGKLYVVDAHQKWCGPCTAIVGMLKRIKNELGDDLLRFATAQVDVIDTLEQYRGKCEPNFLFYGGGELVAAVRGCNAPLVQETIQETLKNEHKILSGEMERKVFRD---VYSDTPDQEEEEEDEEEEEGGVVSKQITVALIKPDVVQNGQVDEILQKISEAGIEVLADEERMLTVEEARDFYKNKEEEEYFDQLIDYVTSGPCRVLVLTKGESGEGVVTLWRDIIGPFDAAVAKEENPDSLRAIYGTDATSNALHGSSSTEEAVRELGFFFPDFKPPTYRSAKSAASRASGRRSKTPSQKPRLQRTLAIIRPDALQAHKDSILQKIDEAGFKIAMQKEMVLTREQAESFYSEHKD-TDYFEPLVKQMTCGPVLALCLAHDDAVDHWRSMLGPKVVADAVEEQPDSLRAQFRVEEAEV-NMLHGSDSAEAAEEELSKIFHVEQTLAVIKPDAIDEKEQIMGKLKEAGFMISCQKDMNLSKEIASEIYKSKEGSEYYDHLIDHMTSGPTLMMVLSAENAVEKLRDIMGPTDPEVAKESHPESLRAMFAKSILENAIHSPSTNESAQEKIRIVFGDAQFD 596          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Match: sp|P90666|TXND3_HELCR (Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina OX=1043166 GN=NME8 PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 4.551e-87
Identity = 186/610 (30.49%), Postives = 313/610 (51.31%), Query Frame = 2
Query:  101 NQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRD---------------------------SGIIRAEDIEDVLAETVYEFTEG--------------------EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPD----LVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDM-DIPD----LVYASSKKEIAKRDENYFFPIQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            NQE WD+LL  +GL V D+YQ+W GPC +V+SLF +L  E+  D + FA  + DS+ +L  Y+GKCEP FL  G GQLV V+RG NAP + +    +  +E KV++  +ER+VI+D                           + I   +++ D    +V   ++G                    E+T  +IKPDA+ N  ++ +I  I+E  F I+  E + L+++E    Y +    +  E   TFM SG   I+ L  G   E  V+++R + GPKD+E AK  +P+SLRA +G     NA+H A+++E A + ++ + P+    +V     P +  +E+ + L+      + K+ ++ +  +   +V  Q    L +      YKE       FE+ + EM       +    ++ I      +G    ++  +    ++R    IPD    +V+ S   + A+++  +FFP Q T A+IKPDA  E ++ II+ IK  GF + L  D+ L+   A ++Y   +   +++ +I++++S LS VMVLS+ DA+  WR  +G  +P+ A E +P+ LR + G  ++QNA+HGS++ E+    I  +F
Sbjct:   16 NQEMWDELLSLEGLTVIDVYQKWCGPCAAVLSLFKRLRNEIGDDLLRFAVAEADSIETLERYRGKCEPCFLRYGSGQLVNVVRGVNAPALLKNVERELKQEHKVLEEGVERVVIKDPLLAAFEAEEQQAAQAEELEKKRLEEEARIKEIKELGDAGEVSVRPVSQGTVDTLMHGRQDGPQTEPVPKEVTVVLIKPDAVANGHVDSIIAKIEEHGFEILTTEDKTLTEDEAREFYKQHEEEEHFEVLVTFMASGPSKILVLTRGDTGEGVVSEVRNLLGPKDIEVAKEEAPDSLRAQFGTDKKMNAMHGADSKETAAREMAFLLPNFSVPIVPGTGPPPT--IEKTLALIRPSALKDHKDEMLQKIQEAGFEVCLQKMVQLTEDQAKEFYKEQEGTPH-FEDLIREMTSGEVLALGLAKESAIQSWREFIGPTTIDEAKEKAPDSLRAQYSIPDTQVNVVHGSDSVDTAEKELGFFFPKQTTLAVIKPDAAGEHKEAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSREDAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLF 622          

HSP 2 Score: 73.9442 bits (180), Expect = 3.455e-12
Identity = 50/159 (31.45%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  455 IIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++   D  D   + +  F   + T A+IKPDA   +K   +I+ IKE  F I  +   +L+KE    LY +    +  E     M+SG   +M L  E  + V   R + GP D + A+  +P SLRA+ G    +NA+H +   EEA   +  +FPD+
Sbjct:  470 VVHGSDSVDTAEKELGFFFPKQTTLAVIKPDAAGEHK-EAIIEKIKEAGFNISLQRDVELNKELASKLYLEHEGKEFYENLIDHMSSGLSMVMVLSRE--DAVDGWRTLMGPTDPDYAREHAPESLRALLGKDVLQNAVHGSSNPEEAKTRIERLFPDV 625          

HSP 3 Score: 70.4774 bits (171), Expect = 4.604e-11
Identity = 48/141 (34.04%), Postives = 75/141 (53.19%), Query Frame = 2
Query: 1355 PIQLTFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDA----IREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGN 1759
            P ++T  +IKPDA      D II  I+  GF +   +D  L+  EA E YK  +E  +F+ ++  + S  S ++VL++ D     + E R+ +G  + E A EE+PD LR  FG+    NA+HG+ S E   R +  +  N
Sbjct:  200 PKEVTVVLIKPDAVANGHVDSIIAKIEEHGFEILTTEDKTLTEDEAREFYKQHEEEEHFEVLVTFMASGPSKILVLTRGDTGEGVVSEVRNLLGPKDIEVAKEEAPDSLRAQFGTDKKMNAMHGADSKETAAREMAFLLPN 340          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q8N427|TXND3_HUMAN (Thioredoxin domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NME8 PE=2 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 2.853e-71
Identity = 177/595 (29.75%), Postives = 310/595 (52.10%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK-DVE-NAKISSPNSLRAIYGLAGFKNAIHS-------------AETREEA---IKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDY--RKLTVR-DMD-IP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQ 1765
            M +KK +    T + NQ  WD++L+ +GL V D+YQ W GPC+++  LF KL  E+N D+I  FA  + D++ +L  ++ KCEP FL    G+++  I+G+NAP++ +  +    EE K+  GEM R    +  ++ ++   +V  E+  E  +   + AIIKPDA+++ K+ ++   I +  F I  +    L++E+V++ YS+       EE+ +FMTSG   I+ +   +++      E T P+ D E N +      + A       KN   S              +  E+A    K +   FPD  FKK    S  LE+ + LL   ++ E K+ ++    D D K+++Q +  L +     + KE  N+ + F + +E M       +     N +     +LG    E+ ++Y    L  +  MD +P + +Y S   E A+R+  +FFP+Q T  +IKP A  EQR++I+K++K  GF +  V  + L+  + E+IY  +    ++  ++E L+   S VM+L+K++A+ EWR  +G  +PEEA   SPD +R  FG + ++N +HG+++  +    +N +F + +
Sbjct:    1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS--EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPS--EETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFMDAFFPD--FKKM--KSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENE-DYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q715T0|TXND3_MOUSE (Thioredoxin domain-containing protein 3 OS=Mus musculus OX=10090 GN=Nme8 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.989e-68
Identity = 179/595 (30.08%), Postives = 306/595 (51.43%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPK---DVENAKISSPNSLRAIYGLAGFKNAIHSAETRE----------EAIKS---VSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDM--DYRKLTVR--DMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF--GNSQ 1765
            M +KK +    + V +Q  WD++L  +GL V D+YQ W GPCK+V SLF KL  E+N D+I  F   + D++ +L  ++ KCEP FL    G+++  I+G+NAP+I +  +    EE K++ GEM+R    +  ++ A  I++   E  YE        AIIKPDA++  K  ++ + I +E F I  +E   L +E V   Y+        EE+   MT+G  C++ +  E    +   +E T P+   + E   +  P+   A   +   ++++     R+          +A+K    + ++FPD  FK    T  +++  + LL   I  E+K+ ++N   +    ++ Q +  L +     V K I    E F+  +  M  +  YV+    +N +     ++G    E+      + L V+    + P +  Y SS K  A+++  +FFP Q T A+IKP   +++R EI+K IK  GF + L+ ++ L+   A +IY  I    ++  V+E L+  +S VMVL+K++A+ EWR  +G  +PEEA   SP+ LR  +G  I++NA+HG+++  +    I+ VF  GN +
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQYVEIPLVDA--IDEEYGEVQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVI---QEETLPQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPD--FKTMKST--NVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCK-IHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFASGNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVFTEGNPE 585          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q715S9|TXND3_RAT (Thioredoxin domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nme8 PE=2 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 1.424e-58
Identity = 163/597 (27.30%), Postives = 299/597 (50.08%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKI-TFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSETENCVAKLREITGPKDVENAKIS---------SP-------NSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYR--KLTVR--DMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M +KK +    + V +Q  WD++L  +GL V D+YQ W GPCK+V +LF KL  E+N D++  F   + DS+ +L  ++ KCEP FL    G+++  I+G+NAP+I +  +    EE K+  GEM R    +  ++ + D E    E  YE        A+I PDA++  K  ++ + I +E F I  +E   L +E     Y+  +     EE+   MT+   C++ +  G +TE     + E   P+  +  +           +P       +SL+         +  H  +   +  K + ++FPD  FK    T  +++R + LL   +  E+K+++++   +    ++ Q +  L +     V   +    + F+  +  M  +  Y++    ++ +     ++G    E+        L VR    + P +  Y SS K  A+ +  +FFP Q T A+IKP  ++++R EI+K I+   F +  + ++ L+   A ++Y  I    ++  V++ L+S +S VM+L+K++A+ EWR  +G  +PEEA   SP+ LR  +G  +++NA+HG++++ +   +I+ VF  S F+
Sbjct:    1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQALFRKLKNELNEDELLHFVVAEADSIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVIALIDEEKKIAAGEMARPQYVEIPLVDSLDEE--YGEVHYESNVEVYNMAVINPDAVLMRKNLEIKEKITKEGFIIEIQENMLLPEEVAREFYNHMIDEPDFEEFVYSMTNRLSCVLIISQGEDTE----VIEEEALPQSDDEEEPDPLEEPHVRFAPMLVKKKRDSLQEYMDRQHMSDYCHVEDDAVKVSKFIDILFPD--FKTMKST--NVQRTLGLLYPEVCEEEKDNVLDIIQNEGFTILMQRQVVLSEEEARAVC-HVHEDEDYFDNLIGYMCSNNSYILVLMREHSVERWKELIGPKTVEEAYASHPDSLCVRFASGNFPVNQFYGSSSKAAAETEIEHFFPPQSTLALIKPHVSHKERMEILKAIRDARFELTQMKEMHLTPEHASKVYFKITGKDFYKNVLDVLSSGMSVVMILTKWNAVGEWRRMMGPVDPEEAKLLSPNSLRARYGIDVLRNAVHGASNMSEAATAISNVFTESNFE 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Match: B2GUC0 (LOC100158550 protein OS=Xenopus tropicalis OX=8364 GN=nme9 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.462e-106
Identity = 206/588 (35.03%), Postives = 317/588 (53.91%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Match: A0A5S6MZ85 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=nme9 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.164e-106
Identity = 206/588 (35.03%), Postives = 317/588 (53.91%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:    1 MAGKKRESTLQIALSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Match: A0A1L8EWQ5 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18044872mg PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.761e-105
Identity = 203/594 (34.18%), Postives = 311/594 (52.36%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGI-----------IRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIP-----DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL + GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  +            + ED E V +   Y       T AIIKPDA+ + K +++I  I+E  F I+  E R +++ E    Y      +  +E   FM+SG C I+ +    E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  E K+ I+    D    +  Q E  L +  +   YKE IN+ + +   +++M       +     N +     MLG       +     ++R    P     + ++ SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  L+   AEE YK  K   +F++++  +      +M+LSK +A+ EWR  +G  +P EA +  PD LRG F  +I+QNA+HGS++ +     I  +FG+   D
Sbjct:    1 MAGKKRESSLQIALSNQEQWEEALSTKGLQVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLVKYRGKCEPTFLFLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLNQGSERHVIKDEVLLEEEDEIVPVQAQTEDEELVPSGKSY-------TVAIIKPDAVAHGKTDEIIMKIQESGFEILANEERTMTESEAREFYQHRAGEEKFQELIQFMSSGPCHILIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKELTSVKPERTLALIRPEILKERKDEILQSIKDAGFSIAMQKEVMLTEHQVQEFYKEHINE-DYYPALLKQMTSGPVLALALVKDNAVGHWRNMLGPASLSQALSEAPDSLRAQFAPSDSETNQLHGSSTTEEAKKEINFFFPVEHTLATIKPDALEEHRDEILEQIQGAGFTISQIKEANLNREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVHEWRSLMGPTDPAEAQKVLPDSLRGKFAKSILQNAVHGSSNSDHAMEKIKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Match: F6R1B6 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=map4k3 PE=3 SV=2)

HSP 1 Score: 344.354 bits (882), Expect = 4.502e-105
Identity = 202/575 (35.13%), Postives = 312/575 (54.26%), Query Frame = 2
Query:   95 VENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAED-IEDVLAETVYE--FTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKC--CIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDP---TSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR------DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL++ GG+LV V+RG+N P++++T +E+   E KV+    ER VI+D  I+  ED I  V A+T  E     G+  T AIIKPDA+ + K +++I  I+E  F I+  E   +++ E    Y      +  +E   FM+SG C   I++   E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     + P   TS   ER + L+   I  + K+ I+    D    +  Q E  L +  +   Y E I+ ++ +   +++M       +     + ++    MLG       +     ++R      D DI  L + SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  LS   AEE YK  K   +F++++  +      +M+LSK +A++EWR  +G  +P EA + SPD LR  F  +I+QNA+HGS++ E     +  +FG+   D
Sbjct:   15 LSNQEQWEEALSTKGLLVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLMKYRGKCEPTFLLLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLSQGSERHVIKDEAILEDEDEIVPVQAQTEDEELVPAGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEESTMTESEAREFYQHREGEEKFQELIQFMSSGPCHVLIISKSDEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESPKDLTSVRPERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHID-KDYYPALLKQMTSGPVLALALVKDHAVDHWRNMLGPASLRQALSEAPDSLRAQFAPNDSDINQL-HGSSTPEEAKKELNFFFPVEHTLATIKPDALEEHRDEILEQIQGTGFTISQIKEANLSREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVQEWRSLMGPTDPTEAQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDIDLD 587          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Match: Q6IRC5 (MGC78790 protein OS=Xenopus laevis OX=8355 GN=nme9 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 4.532e-104
Identity = 201/587 (34.24%), Postives = 313/587 (53.32%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIR-DSGIIRAEDIEDVLAETVYE---FTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQ---DPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIP-----DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            M  KK +S     + NQE W++ L  +GL V D+YQ W GPCK  VSLF K+  E+  D + FA  + D++ SL  Y+GKCEPTFL + GG+LV V+RG+N P++++T +E+   E KV+    ER VI+ +  +   ++I  V A+T  E    +    T AIIKPDA+ + K +++I  I+E  F I+  E R +++ E    Y      +  +E   FM+SG C I+ +    E E+ +   RE  GP DVE AK   P SLRA YG     NA+H +  RE+A + ++  FP+     +   + TS   ER + L+   I  E K+ I+    D    +  Q E  L +  +   YKE IN+ + +   +++M       +     N +     MLG       +     ++R    P     + ++ SS  E AK++ N+FFP++ T A IKPDA E+ RDEI++ I+  GF +  + +  L+   AEE YK  K   +F++++  +      +M+LSK +A+ EWR  +G  +P EA +  PD LRG F  +I+QNA+HGS++ +     I  +FG+   D
Sbjct:    1 MAGKKRESSLQIALSNQEQWEEALSTKGLQVVDVYQAWCGPCKPTVSLFRKIKNELGDDLLHFAVAESDTIDSLVKYRGKCEPTFLFLAGGELVAVVRGANGPLLQKTIIEQLAAEKKVLNQGSERHVIKDEVLLEEEDEIAPVQAQTEDEELVPSGKSYTVAIIKPDAVAHGKTDEIIMKIQESGFEILANEERTMTESEAREFYQHRAGEEKFQELIQFMSSGPCHILIISKSEEDEDVIPAWREFIGPTDVEIAKKEKPESLRAQYGTEVLYNAVHGSNDREQASRELAFFFPNFKISNESLKELTSVKPERTLALIRPEILKERKDEILQSIKDAGFSIAMQKEVMLTEHQVQEFYKEHINE-DYYPALLKQMTSGPVLALALVKDNAVGHWRNMLGPASLSQALSEAPDSLRAQFAPSDSETNQLHGSSTTEEAKKEINFFFPVEHTLATIKPDALEEHRDEILEQIQGAGFTISQIKEANLNREMAEEFYKEHKGKPFFEQLVNYMCRGPCLMMILSKENAVHEWRSLMGPTDPAEAQKVLPDSLRGKFAKSILQNAVHGSSNSDHAMEKIKFIFGDIDLD 586          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 322.398 bits (825), Expect = 3.548e-99
Identity = 184/588 (31.29%), Postives = 313/588 (53.23%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLA-----ETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENC---VAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFK-------KQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR-----DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFG 1756
            M  KK +      + N E W ++L  +GL V D+YQ+W GPC++V+SLF K+  E+  D + FA  + DS+  L  Y+GKCEPTFL   GG+LV V+RG+NAP++++  +E+  +E +V++  ++RIV++D G++  E+ ED        E +        T AIIKPD + + K +++I  I++  F I+  E R L++ E    Y    S    +E   FM+SG   ++ + S+ E C   +   RE  GP D+E AK   P+SLRA YG     NA+H +   E+A + ++  FP+              P  E +ER + L+      E++  I+ +      KV  Q E  L +  +   Y E  N+ E F   ++ M       +    +  +     +LG   P+   + +  ++R     + +  + ++ S   E A+++ ++FFP + T A+IKPD + E RDEI++ I+AGGF +  + + VLS   AEE Y+  ++  +F ++++ +      +++L+K +A+ EWR  +G  +P +A E +P  LR  F   I++NA+HGS++ E     I+ +FG
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVI-SKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNE-EYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFG 586          

HSP 2 Score: 65.0846 bits (157), Expect = 2.236e-10
Identity = 39/142 (27.46%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  506 FTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            F   E T A+IKPD    ++ +++++ I+   F I + +   LS+E     Y +        +   +M  G C ++ L  E  N V + R + GP D  +AK ++P SLRA +     +NA+H +   E A + +  +F ++
Sbjct:  450 FFPKEQTLAVIKPDTSEEHR-DEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKE--NAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 588          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 281.182 bits (718), Expect = 6.806e-84
Identity = 172/588 (29.25%), Postives = 298/588 (50.68%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLA-----ETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENC---VAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFK-------KQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR-----DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFG 1756
            M  KK +      + N E W ++L  +GL V D+YQ+W GPC++V+SLF K+  E+  D + FA                         GG+LV V+RG+NAP++++  +E+  +E +V++  ++RIV++D G++  E+ ED        E +        T AIIKPD + + K +++I  I++  F I+  E R L++ E    Y    S    +E   FM+SG   ++ + S+ E C   +   RE  GP D+E AK   P+SLRA YG     NA+H +   E+A + ++  FP+              P  E +ER + L+      E++  I+ +      KV  Q E  L +  +   Y E  N+ E F   ++ M       +    +  +     +LG   P+   + +  ++R     + +  + ++ S   E A+++ ++FFP + T A+IKPD + E RDEI++ I+AGGF +  + + VLS   AEE Y+  ++  +F ++++ +      +++L+K +A+ EWR  +G  +P +A E +P  LR  F   I++NA+HGS++ E     I+ +FG
Sbjct:    1 MAGKKKEVSLQVSIGNDEQWGEMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAV------------------------GGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVI-SKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNE-EYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKENAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFG 562          

HSP 2 Score: 65.0846 bits (157), Expect = 2.133e-10
Identity = 38/138 (27.54%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            E T A+IKPD    ++ +++++ I+   F I + +   LS+E     Y +        +   +M  G C ++ L  E  N V + R + GP D  +AK ++P SLRA +     +NA+H +   E A + +  +F ++
Sbjct:  430 EQTLAVIKPDTSEEHR-DEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYMCRGPCTMLILTKE--NAVEEWRAMMGPTDPNDAKENAPGSLRARFAKDILENAVHGSSNTEHAQEKIHFLFGEI 564          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Match: nme8 (thioredoxin domain-containing protein 3 homolog [Source:NCBI gene;Acc:103039823])

HSP 1 Score: 261.922 bits (668), Expect = 2.086e-78
Identity = 154/497 (30.99%), Postives = 264/497 (53.12%), Query Frame = 2
Query:  119 KLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLA-----ETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENC---VAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFK-------KQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVR-----DMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENL 1546
            ++L  +GL V D+YQ+W GPC++V+SLF K+  E+  D + FA  + DS+  L  Y+GKCEPTFL   GG+LV V+RG+NAP++++  +E+  +E +V++  ++RIV++D G++  E+ ED        E +        T AIIKPD + + K +++I  I++  F I+  E R L++ E    Y    S    +E   FM+SG   ++ + S+ E C   +   RE  GP D+E AK   P+SLRA YG     NA+H +   E+A + ++  FP+              P  E +ER + L+      E++  I+ +      KV  Q E  L +  +   Y E  N+ E F   ++ M       +    +  +     +LG   P+   + +  ++R     + +  + ++ S   E A+++ ++FFP + T A+IKPD + E RDEI++ I+AGGF +  + + VLS   AEE Y+  ++  +F ++++ +
Sbjct:    1 EMLVCKGLTVVDVYQQWCGPCRAVISLFRKIKNELGDDLLHFAVAEADSINVLEKYRGKCEPTFLFYAGGELVAVLRGANAPLLQRIVVEELVKEKRVLEQGVQRIVVKDEGLVDEEEQEDDAGPIQNDEDILVTDNRSYTVAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASEPYFQELVQFMSSGPSHVLVI-SKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNE-EYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQTLAVIKPDTSEEHRDEILEEIQAGGFTISQLQETVLSREMAEEFYREHRDKPFFSQLVDYM 495          

HSP 2 Score: 90.1225 bits (222), Expect = 1.916e-18
Identity = 80/329 (24.32%), Postives = 147/329 (44.68%), Query Frame = 2
Query:  974 VVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFE----CKNCINIVNYMLGLYIPEDDMDYRKLTVRDM----DIPDLVYASSKKEIAKRDENYFFP--------------------IQLTFAIIKPD-AYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIF-GSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIK 1870
            V I+ P+ +     + II +  D   +++   E TL +S     Y+   ++   F+E V+ M+    +V+       C + I      LG    E+       ++R       + + V+ S   E A R+  +FFP                    ++ T A+I+PD A E R+ I+  I   GF + +  +++L+  +    Y   +   YF  +++++TS     + L+K  A+  WR+ +G  +P++A E+ P+ LR  F G +   N LHGS S+E+  + I+  F   Q      L+++KP  S          +R E ++EI+
Sbjct:  142 VAIIKPDIVAHGKTDEIIMKIQDAGFEILAHEERTLTESEAQEFYQHKASE-PYFQELVQFMSSGPSHVLVISKPEGCDDVIPAWREFLGPTDIEEAKREHPDSLRAQYGSETLFNAVHGSYDGEQASRELAFFFPNFRTAVSGRHSGHAGPEPEPVERTLALIRPDTARENREMILAKIHKAGFKVAMQKEVMLTEEQVCLFYSEHQNEEYFPALLKSMTSGPVLALALAKQGAVEHWRNLLGPKDPKQAKEDQPESLRAQFAGESECVNQLHGSQSLEEAEKEISFFFPKEQ-----TLAVIKPDTSEE--------HRDEILEEIQ 456          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:103028979])

HSP 1 Score: 78.5666 bits (192), Expect = 3.862e-16
Identity = 42/141 (29.79%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFK 940
            E T A+IKPD++  +K  ++ ++I +  F I++K+  +LS E+    Y++            FM+SG   ++AL       ++  +++ GP +   AK + P+ LRA YG +  +NA+H +ET   A + +  MFP+ V +
Sbjct:   15 ERTLALIKPDSV--DKAEEIENIILQSGFTILQKKRLQLSPEQCSDFYAEHYGKLFFPSLTAFMSSGP--VIALALARHQAISTWKDLMGPANSSKAKDTHPDCLRARYGTSDLRNAVHGSETFSAAERELRFMFPNSVIE 151          

HSP 2 Score: 71.2478 bits (173), Expect = 1.306e-13
Identity = 38/135 (28.15%), Postives = 70/135 (51.85%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            ++ T A+IKPD+ ++ +EI  +I   GF +     + LS  +  + Y       +F  +   ++S     + L++  AI  W+D +G  N  +A +  PD LR  +G++ ++NA+HGS +     R +  +F NS
Sbjct:   14 LERTLALIKPDSVDKAEEIENIILQSGFTILQKKRLQLSPEQCSDFYAEHYGKLFFPSLTAFMSSGPVIALALARHQAISTWKDLMGPANSSKAKDTHPDCLRARYGTSDLRNAVHGSETFSAAERELRFMFPNS 148          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 73.9442 bits (180), Expect = 8.174e-14
Identity = 44/140 (31.43%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  509 TEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL-GSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFP 925
            ++ E T A+IKPDA+   K+ D+I MI +    + K  + +LS ++    Y +  S         F++SG   +M L G E    V+  R++ GP D   A+  +  SLRA +G  G KNA H +++   A + +   FP
Sbjct:   56 SQKERTLAMIKPDAVT--KVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEA---VSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP 190          

HSP 2 Score: 67.3958 bits (163), Expect = 1.167e-11
Identity = 53/202 (26.24%), Postives = 91/202 (45.05%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGS------KQVTKEFTIKEL 1954
            T A+IKPDA  +  +II++I   G  +       LS  +A + Y   +  ++F+ +++ ++S    VM L   +A+  WR  +G  +   A +++   LR  FG+   +NA HGS S+    R +   F ++        +   P  +         I +P +V E KIQ  L +   D+          K V  E+T+ EL
Sbjct:   61 TLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFPST--------AGHSPPNTAKFSDCTCCIIKPHAVSEGKIQFSL-QFSLDRANAEEFLEVYKGVVTEYTVTEL 253          

HSP 3 Score: 51.2174 bits (121), Expect = 2.278e-6
Identity = 37/136 (27.21%), Postives = 62/136 (45.59%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYA-TFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            + T  IIKP A+   K+            + ++  + + + EE + +Y       ++ EY  T + SG C  MAL   + +   + R   GP D E A+   P +LRA+YG    +NA+H  +  E+ +  V   F
Sbjct:  205 DCTCCIIKPHAVSEGKIQ-----------FSLQFSLDRANAEEFLEVYK-----GVVTEYTVTELCSGPC--MALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFF 322          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 8.912e-21
Identity = 37/121 (30.58%), Postives = 76/121 (62.81%), Query Frame = 2
Query: 1406 DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQF 1768
            D ++  IK  GF + +  +++L+  +A E Y+  +   YF  +++++T   S ++VL++ DA+ EWR  +G  +P+ A + +P+ LR  F  ++++NALHG++++     +I+L+FG+  F
Sbjct:    5 DTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGDISF 125          

HSP 2 Score: 59.3066 bits (142), Expect = 6.415e-11
Identity = 36/127 (28.35%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  560 NKMND-MIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVF 937
            N M D ++  IKE  F+I  ++   L++E+    Y +    D        MT G   ++ L  E  + V + R + GP D + A+ ++P SLRA +  +  +NA+H A     A +++ ++F D+ F
Sbjct:    1 NTMADTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNRE--DAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLFGDISF 125          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 65.855 bits (159), Expect = 8.628e-13
Identity = 38/140 (27.14%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMI--DMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++T A++KPDA+ +    + +  D++K + F I+K +  +L + +    Y+        +    FM SG   +  L     + V   RE+ GP  V  A  ++P S+RA YGL   +N  H +++   A++ +S  FP+ 
Sbjct:   11 QLTLALLKPDALAHGIAWEAVHQDVLKNK-FLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHH--DAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPEF 147          

HSP 2 Score: 63.5438 bits (153), Expect = 6.137e-12
Identity = 40/141 (28.37%), Postives = 69/141 (48.94%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQR---DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFD 1771
            +QLT A++KPDA       + + + +    F +    ++ L  +++E  Y   K   +F R++E + S    V VL+  DA+R WR+ +G      A   +P+ +R  +G T  +N  HGS S     + I+  F   +FD
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFF--PEFD 148          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 47.7506 bits (112), Expect = 1.500e-6
Identity = 33/131 (25.19%), Postives = 63/131 (48.09%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            T   IKPD  ++R   +I+K  +  G  +  +  +    A  ++ Y ++K+  ++  +++ + S     MV      +R  R  +G  +P ++   +P  +RG F   I +N +HGS S E   + I+L F
Sbjct:   23 TLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPADS---APGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWF 150          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 53.1434 bits (126), Expect = 9.565e-9
Identity = 37/136 (27.21%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLV-----DDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            TF  +KPD  ++    +I+   +  G+ +  +     DD +L    AE + K      +F +++  + S      V    D +R+ R  +G+ NP  +   +P  +RG FG  + +N  HGS S++   R INL F
Sbjct:    8 TFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGK-----PFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGS---APGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWF 135          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Yeast
Match: TRX3 (Mitochondrial thioredoxin; highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p [Source:SGD;Acc:S000000679])

HSP 1 Score: 48.9062 bits (115), Expect = 1.931e-7
Identity = 39/132 (29.55%), Postives = 56/132 (42.42%), Query Frame = 2
Query:   29 LIFHNPGYQMGTKKLDS-------GYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCE----PTFLIMGGGQLVGVIRGSNAPIIRQTCLEK 391
            ++F+ P  +M  + L S         IT + N   +  L+K     V D Y  W GPCK +     KL        + F +  VD    +     +CE    PTF++   GQL+G I G+N      T LEK
Sbjct:    1 MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPD--VRFVKCDVDESPDI---AKECEVTAMPTFVLGKDGQLIGKIIGANP-----TALEK 122          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Match: EDO42234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S268])

HSP 1 Score: 246.128 bits (627), Expect = 6.089e-72
Identity = 166/570 (29.12%), Postives = 281/570 (49.30%), Query Frame = 2
Query:  152 DIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEM-ERIVIRDSGIIRAEDIEDVLAETVYEFT-EGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMAL--GSET----ENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPT------SEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDM----DIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAY-EQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKP 1801
            D Y EW GPCK+++S   +L  E+  D + FA  + DS+ SL  Y+ + +PTFL    G LV VIRG + P + +T  ++   E KV++G    ++V  +       + E+      ++F    ++T A+IKPDA+    + ++I  ++E    ++K E R L++EE    Y +    +  ++   FM+SG    +AL    ET    E  +   RE+ GPKDV  AK  +PNSLRA+YG     NA+H  ++ E A + ++  FPD       PT         L+R + L+        + SI+++  +   ++    E  L +      Y E  +Q E F+  V  M+      +C   ++ I     MLG    E   D    ++R      D P + ++ S   E A+++   FFP+Q T A+IKP+   +QR+ I + IK  GF + L  ++ LS   A + Y   +   +F+ + + ++S  +  MVLSK DA+  WR  +G  +PE+A E +P+ +R   G  +++N +HG +  E   + I   F  ++    G +  ++P
Sbjct:    3 DAYSEWCGPCKAIISSLKRLKNEIGDDLLIFAMAETDSIDSLEKYRMRSQPTFLFYAAGTLVNVIRGCHCPKLLKTIRKELDHEHKVLEGNAERKVVKEEKKEEITPEEEEEEIGKTHDFHLPKQVTVAVIKPDAVKAGLVEEIIRKVEEAGIEVLKMEERTLTREEAAEFYKQHEGTEHFDQLVEFMSSGPLMTLALSKAGETPEALEGVIDNFRELIGPKDVNVAKEEAPNSLRAMYGTDTVMNAVHGCDSNESAARELAFFFPDFAA----PTVANKRKKRQLQRTLALIRPDALRSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQ-EFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFPMQSTVAVIKPEVEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGLTDYMSSGPTMFMVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFFPEAKILPDGTVKKVQP 567          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 82.0333 bits (201), Expect = 1.032e-17
Identity = 45/139 (32.37%), Postives = 76/139 (54.68%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLV 934
            E T A+IKPDA+  +K +++ ++I +  F I++K    L+ E+    Y++            +M+SG   IMAL    EN ++  R++ GP + + A+  +P SLRAIYG    +NA+H ++    A K +   FPD +
Sbjct:   18 ERTLALIKPDAV--HKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGP--IMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDSI 152          

HSP 2 Score: 71.2478 bits (173), Expect = 5.225e-14
Identity = 42/135 (31.11%), Postives = 72/135 (53.33%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            I+ T A+IKPDA  + DEI ++I   GF +       L+  +  + Y       +F  ++  ++S     +VL++ +AI  WR  IG  N ++A +++P+ LR I+G+   +NALHGS       + I+  F +S
Sbjct:   17 IERTLALIKPDAVHKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDS 151          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Match: EDO30526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0J8])

HSP 1 Score: 77.7962 bits (190), Expect = 8.011e-17
Identity = 41/139 (29.50%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEEN-FYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++T AI+KPD +++      +  I  +N F I++  + K S+E+    Y++            FM+SG    M LG E  N +   R++ GP     A+  +P S+RA+YG++  +NA H +++ E A K +   FP+ 
Sbjct:    9 QLTLAILKPDLMLHPVRTQAVKNILVDNQFMIVRSRVLKWSREDAECFYTEHKGRFFYNRLVGFMSSGPMTAMILGRE--NAITHWRKLMGPTHAYKARSIAPKSIRALYGISDTRNATHGSDSDESARKEIEFFFPEF 145          

HSP 2 Score: 62.7734 bits (151), Expect = 1.287e-11
Identity = 45/145 (31.03%), Postives = 73/145 (50.34%), Query Frame = 2
Query: 1358 IQLTFAIIKPDA--YEQRDEIIKLIKAGGFGMPLVDDIVL--SNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERG 1780
            +QLT AI+KPD   +  R + +K I      M +V   VL  S  +AE  Y   K   +++R++  ++S     M+L + +AI  WR  +G  +  +A   +P  +R ++G +  +NA HGS S E   + I   F   +FD  G
Sbjct:    8 LQLTLAILKPDLMLHPVRTQAVKNILVDNQFM-IVRSRVLKWSREDAECFYTEHKGRFFYNRLVGFMSSGPMTAMILGRENAITHWRKLMGPTHAYKARSIAPKSIRALYGISDTRNATHGSDSDESARKEIEFFF--PEFDYHG 149          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 69.3218 bits (168), Expect = 7.376e-13
Identity = 39/135 (28.89%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            E T A+IKPDA+    +  +++MI +  F + + ++ +L+++E    Y +  S    +    F++SG   ++A   +    V   R++ GP D   A+  +P S+RA +G    KNA H +++ E A + VS  F
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFF 219          

HSP 2 Score: 69.3218 bits (168), Expect = 7.867e-13
Identity = 42/149 (28.19%), Postives = 70/149 (46.98%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFG----NSQFDERGNLSILKP 1801
            T A+IKPDA      I+++I   GF +     + L+  EA + Y+      ++DR++E ++S       L    A+  WR  +G  +   A  ++P  +R  FG+   +NA HGS S E   R ++  F     N+       L ++KP
Sbjct:   91 TLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKP 239          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 70.0922 bits (170), Expect = 9.567e-13
Identity = 39/135 (28.89%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMF 922
            E T A+IKPDA+    +  +++MI +  F + + ++ +L+++E    Y +  S    +    F++SG   ++A   +    V   R++ GP D   A+  +P S+RA +G    KNA H +++ E A + VS  F
Sbjct:   89 EKTLAMIKPDAV--GCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGP--VVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFF 219          

HSP 2 Score: 69.707 bits (169), Expect = 1.309e-12
Identity = 42/149 (28.19%), Postives = 70/149 (46.98%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFG----NSQFDERGNLSILKP 1801
            T A+IKPDA      I+++I   GF +     + L+  EA + Y+      ++DR++E ++S       L    A+  WR  +G  +   A  ++P  +R  FG+   +NA HGS S E   R ++  F     N+       L ++KP
Sbjct:   91 TLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKP 239          

HSP 3 Score: 54.299 bits (129), Expect = 1.127e-7
Identity = 65/259 (25.10%), Postives = 106/259 (40.93%), Query Frame = 2
Query: 1016 NSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKN--CINIVNYMLGLYIPEDDMDYRK---LTVRDM----DIPDLVYASSKKEIAKRDENYFFPIQ---------LTFAIIKPDAYEQ--RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETT--YFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIED 1726
              I+        K+ +     L +   +  Y+E  +Q   F +R+ E   S   V+ FE K    ++    +LG   P D    R    L+VR      +  +  + S   E A+R+ ++FF  +          T  ++KP A        I+  I+  GF +  +    L  A AEE ++  K     Y   ++E L S     + +   D  + +RDF+G  +PE A    P  LR  FG   I+NA+H +   ED
Sbjct:  104 GGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQP--FYDRLVEFISSG-PVVAFELKGPGAVDSWRKVLG---PTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFFDKRRQNTAVLNNCTLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTDLPED 356          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Match: nme8 (thioredoxin domain-containing protein 6 [Source:NCBI gene;Acc:101170553])

HSP 1 Score: 290.426 bits (742), Expect = 2.972e-88
Identity = 181/584 (30.99%), Postives = 306/584 (52.40%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLA-ETVYEFTEGE-MTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLR---EITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRK----------LTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQ-RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGN 1759
            M  KK ++     + NQ+ W+K+L  +GL V D+YQ+W GPCK +V    K+  E+    + FA  + DS+  L M++GKC PTFL    G LVGV++ +N P++++T +++  +E + +    +   I+   I   E+ +  L  + V     G+  T AIIKPDA+ + K N++I  I+E  F I+  +  KL++ E    Y         ++   FM+SG C I+ L S T++ V+ L    E  GP DV  A+ + P  LRA YG     NA+H +E    A + ++  FP+    +QD   E +ER + L+   +  E++  I+ +       V  Q E  L +  +  +Y + IN+ + F   ++ M       +    K  ++    ++G      D+D  K            V +  I   ++ S  +E A+R+ ++FFP Q T A+IK +A EQ R+ I++ I+  GF +    ++VLS   AEE+YK  KE  +F ++++ +      ++VL+K +A+ EWR  +G  +P +A E S + LR  FGS I+QN++HGS++++     I L+FG+
Sbjct:    1 MAVKKKEATLQVSITNQKQWEKMLATKGLTVVDVYQKWCGPCKPIVKHLRKVKNELGDVLLHFATAEADSIEDLKMFRGKCIPTFLFYADGMLVGVLQRANPPLLQRTIVKQLAKEKQSLNEGGQHKPIKPFCISDDENEDGKLGNKQVMSVPAGKSYTVAIIKPDAVSHRKTNEIIMKIQESGFEILAHKKHKLTEAEARRFYQHKAEEPCFQDLVQFMSSGHCHILVL-SHTDSSVSVLPAWLEFMGPTDVSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRV-EQDGEEERVERTLALIRPGLARENREEILARIHKAGFTVSLQREVMLTEEQVRLLYFQHINE-DYFPALLQSMTSGPVAAMVLAGKEAVHHWKNIIG----PSDLDKAKAENPECLRAQFPVENEPISH-IHGSEDQEAAEREISFFFPKQNTLAVIKHEAMEQHRETILEEIRDRGFSVTQQKEMVLSRELAEELYKEHKEKPFFTKLVDYICQGHCLMLVLTKENAVEEWRVMMGPSDPAKAKETSTESLRARFGSDILQNSVHGSSNVQHAEEEIQLIFGD 576          

HSP 2 Score: 73.1738 bits (178), Expect = 5.897e-13
Identity = 51/174 (29.31%), Postives = 84/174 (48.28%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQR--DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDA----IREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERG-------NLSILKP-LISNNMESFPITIYR 1846
            T AIIKPDA   R  +EII  I+  GF +       L+ AEA   Y++  E   F  +++ ++S    ++VLS  D+    +  W +F+G  +  EA    P+ LR  +G+  + NA+HGS       R +   F N + ++ G        L++++P L   N E     I++
Sbjct:  159 TVAIIKPDAVSHRKTNEIIMKIQESGFEILAHKKHKLTEAEARRFYQHKAEEPCFQDLVQFMSSGHCHILVLSHTDSSVSVLPAWLEFMGPTDVSEARRAKPECLRAQYGTETLHNAVHGSEDSNHASRELAFFFPNFRVEQDGEEERVERTLALIRPGLARENREEILARIHK 332          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:101162299])

HSP 1 Score: 82.8037 bits (203), Expect = 8.489e-18
Identity = 47/137 (34.31%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPD 928
            E T AIIKPD  +  K   +   I +    I++K   +LS+E+    YS             +M+SG    M L    E+ V + + I GP  + NAK S P  LRA YG +  KNA+H +E+ +EA++ +  MFP+
Sbjct:    9 ERTLAIIKPD--IYEKAEKIEGFILQSGLTILQKRRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLA--CEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPN 141          

HSP 2 Score: 77.411 bits (189), Expect = 6.646e-16
Identity = 43/132 (32.58%), Postives = 69/132 (52.27%), Query Frame = 2
Query: 1367 TFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            T AIIKPD YE+ ++I   I   G  +     + LS  +  + Y +     +F  ++  ++S     MVL+  DA+  W+  IG  +   A E  P+ LR  +G++ ++NALHGS S ++  R I  +F NS
Sbjct:   11 TLAIIKPDIYEKAEKIEGFILQSGLTILQKRRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLACEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPNS 142          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:101162299])

HSP 1 Score: 81.2629 bits (199), Expect = 3.823e-17
Identity = 46/137 (33.58%), Postives = 71/137 (51.82%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPD 928
            E T AIIKPD  +  K   +   I +    I+++ + +LS+E+    YS             +M+SG    M L    E+ V + + I GP  + NAK S P  LRA YG +  KNA+H +E+ +EA++ +  MFP+
Sbjct:   13 ERTLAIIKPD--IYEKAEKIEGFILQSGLTILQRRL-QLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLA--CEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPN 144          

HSP 2 Score: 77.7962 bits (190), Expect = 5.876e-16
Identity = 44/135 (32.59%), Postives = 72/135 (53.33%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNS 1762
            ++ T AIIKPD YE+ ++I   I   G  + L   + LS  +  + Y +     +F  ++  ++S     MVL+  DA+  W+  IG  +   A E  P+ LR  +G++ ++NALHGS S ++  R I  +F NS
Sbjct:   12 VERTLAIIKPDIYEKAEKIEGFILQSGLTI-LQRRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLACEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPNS 145          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 69.3218 bits (168), Expect = 3.849e-13
Identity = 42/135 (31.11%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQ---RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            +QLT A+IKPDA       + + + I    F +    D+V    ++E+ Y       ++ R++E ++S      VL++ DAIR WR  +G      A    P+ +R  FG T  +N  HGS S E   R I+  F
Sbjct:   10 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 144          

HSP 2 Score: 67.781 bits (164), Expect = 1.156e-12
Identity = 38/139 (27.34%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDM-IKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++T A+IKPDA+ +  M + +   I + +F I++ +     +++    Y++       +    FM+SG      L  E  + +   R + GP  V  A+ + PNS+RA +GL   +N  H +++ E A + +S  FPD 
Sbjct:   11 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLARE--DAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 147          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 69.3218 bits (168), Expect = 4.014e-13
Identity = 42/135 (31.11%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 1358 IQLTFAIIKPDAYEQ---RDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVF 1753
            +QLT A+IKPDA       + + + I    F +    D+V    ++E+ Y       ++ R++E ++S      VL++ DAIR WR  +G      A    P+ +R  FG T  +N  HGS S E   R I+  F
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFF 146          

HSP 2 Score: 67.781 bits (164), Expect = 1.205e-12
Identity = 38/139 (27.34%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  518 EMTFAIIKPDAIVNNKMNDMIDM-IKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDL 931
            ++T A+IKPDA+ +  M + +   I + +F I++ +     +++    Y++       +    FM+SG      L  E  + +   R + GP  V  A+ + PNS+RA +GL   +N  H +++ E A + +S  FPD 
Sbjct:   13 QLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLARE--DAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPDF 149          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 1441.4 bits (3730), Expect = 0.000e+0
Identity = 714/718 (99.44%), Postives = 715/718 (99.58%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE 2209
            MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMN+MIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSED ERVVILLPERIYIEDKNSIINQFTD DLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEE NGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE
Sbjct:    1 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDSERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE 718          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000006982.1 (SMESG000006982.1)

HSP 1 Score: 1376.3 bits (3561), Expect = 0.000e+0
Identity = 684/688 (99.42%), Postives = 685/688 (99.56%), Query Frame = 2
Query:  146 VADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE 2209
            VADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMN+MIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSED ERVVILLPERIYIEDKNSIINQFTD DLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEE NGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE
Sbjct:    5 VADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNEMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPTSEDSERVVILLPERIYIEDKNSIINQFTDADLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEETNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPESVDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLKCFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTEENLLPELNYVIYKFVELE 692          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 354.755 bits (909), Expect = 9.519e-110
Identity = 207/589 (35.14%), Postives = 319/589 (54.16%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKK---QDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 1786
            M  KK +      +  QE WD+L+K +GL V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++++I  ++E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K       + +++R + L+    Y E + SI+ +  +   KV  Q E  L K      Y +  + +  FEE ++EM+      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD-KPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 585          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 354.755 bits (909), Expect = 1.233e-109
Identity = 207/589 (35.14%), Postives = 319/589 (54.16%), Query Frame = 2
Query:   56 MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVL-AETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKK---QDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPED-------DMDYRKLTVRDMDIP-DLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNL 1786
            M  KK +      +  QE WD+L+K +GL V D+YQ+W GPCK+V++ F ++  E+  D + FA  K D++ SL  Y+G+CEP FLI GG  LVGVIRG+N P++  T   K  EE KVM+GEMER   +DS +   E  E V   +   E  E E+T A+IKPD +   K++++I  ++E    I+ ++ R L+ EE    Y      +I E+   F+ SG   I+ L       + + RE+ GPK ++ AK +SP S+RAIYG    +NAIH A+ R+ A + ++  FPD +  K       + +++R + L+    Y E + SI+ +  +   KV  Q E  L K      Y +  + +  FEE ++EM+      +  E +N +     MLG   P+D       D +  +      DI  +L++ S   E A+ +  YFFP++ T A IKPD  E  +EI   I    F +  +  I +  + AEE Y +     YF+ +I ++ S  +  MVLS+ DAIR WR  IG  +P+ A +  PD +R I+G  I +NA++GS +  +V R +NL+FG  +F+E G+L
Sbjct:    1 MARKKQEIALQAEINTQEEWDELIKKEGLLVVDVYQDWCGPCKAVINFFRRVKNEIGDDFLNFAVAKADTIDSLEKYRGRCEPCFLIYGGRSLVGVIRGANPPVLETTIKLKLEEEHKVMKGEMERNETKDSFLADFETDEKVQEVDKDLEEIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPDFMVPKIARVKHEASNVQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKD-KPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLG---PKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFPVEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIFGKLEFNEDGSL 585          
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Match: SMESG000065659.1 (SMESG000065659.1)

HSP 1 Score: 301.212 bits (770), Expect = 4.768e-92
Identity = 187/594 (31.48%), Postives = 317/594 (53.37%), Query Frame = 2
Query:   74 DSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFNKLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGSNAPIIRQTCLEKYGEELKVMQGEMERIVIRD----------SGIIRAEDIEDVLAETVYEFTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMSLYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVENAKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLV---FKKQDPTSEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYVYKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDMDY---------RKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQRDEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSELSCVMVLSKFDAIREWRDFIGSPNPXXXXXXSPDKLRGIFGSTIIQNALHGSASIEDVYRSINLVFGNSQFDERGNLS 1789
            +S +   +  ++ W++L+  +GL V D+YQ+W+ PCK +V    +L  ++N   + FA  K +++ SL  Y+G+CEP FLI G G LVGVIRG N P +      K  EE   M+G  ER+ I+D               A+D E+  AE V           IIKP  I   K+ ++I +I +    I+K+E + +++EE   LY    + D       F+TS  C  M L  E E  + +LR + GPK +++AK   PNS+RA+Y  +  +NAIH  E RE   + +S+ +PD V    K +    E+++  V ++    Y E K  IIN   + + ++++Q E    ++     Y E+    +  E+ + EM    F V+    K+ +N    ++G      D+ +         R L  +     +L++ S   E A+++  YFFPI+ T   IKPD+Y+ RDEII+LI   GF + +  +++L+  + + +Y+  K  +Y+  ++  +T   S  ++LSK DA++EWR+ IG  +PE A EE+PD  R ++G  I++NA++GS+  E+V   + ++FG+  F++ G+++
Sbjct:    4 ESNFQKLINTEDEWEELIFNEGLQVIDVYQDWSSPCKPIVKFLWRLKTQLNDKILNFAVAKSNTIESLEKYRGRCEPCFLIYGNGILVGVIRGCNPPSLEILIKTKLEEEHLAMKGLGERMEIKDPFFKYMEELKLEEEMAKDFEEAPAEIV---------LVIIKPGIIYEGKLPEIISIIVDNGITILKEEEKYMTEEEAGQLYEHLQNTDFHHGLIKFITSENCYFMILMKENE-IINELRNLVGPKSLDDAKTFYPNSIRALYAKSTLENAIHCGEDRESCERELSIFYPDFVAPLIKLRRNLMENIQTTVAIIRPSAYKEFKEKIINSIVENEFEILRQDEFKFTRNEAEKFY-EVNMMGDYLEDLILEMIEGPFLVLLLSRKDAVNKWRTLIG----SKDLTFASKCEPECLRALYSKSNIFINLIHGSDSVETAEKELKYFFPIEQTIGAIKPDSYDNRDEIIELINEFGFKISMTKELILTKEQIDTMYQKDKYKSYYSDLVRYMTGGKSLFLILSKQDAVKEWRNVIGPTDPEVAVEENPDYFRALYGRDILENAIYGSSDKEEVSTMMKMIFGDLIFNDDGSIA 582          
The following BLAST results are available for this feature:
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME85.942e-7229.75NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME85.942e-7229.75NME/NM23 family member 8 [Source:HGNC Symbol;Acc:H... [more]
NME97.460e-5836.13NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME91.584e-4140.19NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
NME91.118e-3633.09NME/NM23 family member 9 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndk-14.387e-1027.48Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-14.387e-1027.48Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-14.387e-1027.48Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-14.387e-1027.48Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
trx-18.537e-731.40Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmdyn-D65.640e-1831.16gene:FBgn0030573 transcript:FBtr0073933[more]
CG142211.890e-1229.66gene:FBgn0031042 transcript:FBtr0332485[more]
CG181308.784e-1231.11gene:FBgn0030359 transcript:FBtr0073581[more]
nmdyn-D75.361e-725.32gene:FBgn0028997 transcript:FBtr0082083[more]
awd1.377e-622.82gene:FBgn0000150 transcript:FBtr0346611[more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme85.422e-8131.51NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme53.149e-1531.91NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme62.050e-1330.00NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme73.574e-1332.12NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme34.090e-1127.48NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme99.310e-11035.03NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme91.378e-10935.03NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme92.867e-10835.13NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme94.710e-10033.62NME/NM23 family member 9 [Source:NCBI gene;Acc:100... [more]
nme51.758e-1432.12NME/NM23 family member 5 [Source:NCBI gene;Acc:780... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme84.273e-6930.08NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme98.468e-5034.19NME/NM23 family member 9 [Source:MGI Symbol;Acc:MG... [more]
Nme81.930e-4228.11NME/NM23 family member 8 [Source:MGI Symbol;Acc:MG... [more]
Nme77.767e-1529.55NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme72.054e-1429.55NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95YJ5|TXND3_CIOIN1.006e-9230.32Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|P90666|TXND3_HELCR4.551e-8730.49Thioredoxin domain-containing protein 3 homolog OS... [more]
sp|Q8N427|TXND3_HUMAN2.853e-7129.75Thioredoxin domain-containing protein 3 OS=Homo sa... [more]
sp|Q715T0|TXND3_MOUSE2.989e-6830.08Thioredoxin domain-containing protein 3 OS=Mus mus... [more]
sp|Q715S9|TXND3_RAT1.424e-5827.30Thioredoxin domain-containing protein 3 OS=Rattus ... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B2GUC01.462e-10635.03LOC100158550 protein OS=Xenopus tropicalis OX=8364... [more]
A0A5S6MZ852.164e-10635.03Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A1L8EWQ51.761e-10534.18Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
F6R1B64.502e-10535.13Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
Q6IRC54.532e-10434.24MGC78790 protein OS=Xenopus laevis OX=8355 GN=nme9... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme83.548e-9931.29thioredoxin domain-containing protein 3 homolog [S... [more]
nme86.806e-8429.25thioredoxin domain-containing protein 3 homolog [S... [more]
nme82.086e-7830.99thioredoxin domain-containing protein 3 homolog [S... [more]
nme53.862e-1629.79NME/NM23 family member 5 [Source:NCBI gene;Acc:103... [more]
nme78.174e-1431.43NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008106.18.912e-2130.58pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
nme68.628e-1327.14NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme31.500e-625.19NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YNK19.565e-927.21Nucleoside diphosphate kinase; catalyzes the trans... [more]
TRX31.931e-729.55Mitochondrial thioredoxin; highly conserved oxidor... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422346.089e-7229.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392011.032e-1732.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305268.011e-1729.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500657.376e-1328.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345029.567e-1328.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme82.972e-8830.99thioredoxin domain-containing protein 6 [Source:NC... [more]
nme58.489e-1834.31NME/NM23 family member 5 [Source:NCBI gene;Acc:101... [more]
nme53.823e-1733.58NME/NM23 family member 5 [Source:NCBI gene;Acc:101... [more]
nme63.849e-1331.11NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme64.014e-1331.11NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Thioredoxin domain-containing protein 3-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006982.10.000e+099.44SMESG000006982.1[more]
SMESG000006982.10.000e+099.42SMESG000006982.1[more]
SMESG000043677.19.519e-11035.14SMESG000043677.1[more]
SMESG000043677.11.233e-10935.14SMESG000043677.1[more]
SMESG000065659.14.768e-9231.48SMESG000065659.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014617 ID=SMED30014617|Name=Thioredoxin domain-containing protein 3-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2275bp
TGAATTTGTTTTGCTATTCTAAAAAAAGTTAATATTTCATAACCCAGGAT
ATCAAATGGGTACTAAAAAACTAGATTCAGGTTATATAACCCATGTTGAA
AATCAAGAAAGCTGGGATAAATTATTAAAATTTCAAGGATTATTCGTTGC
CGATATTTATCAAGAGTGGAATGGACCGTGTAAATCTGTTGTTAGCTTGT
TTAATAAACTTGCAGCAGAAGTCAACAGTGATAAAATAACATTTGCACAA
GTCAAAGTTGATAGTGTACGATCATTATATATGTATAAAGGAAAGTGTGA
ACCAACTTTTCTTATTATGGGGGGAGGTCAGTTAGTTGGCGTTATTAGAG
GATCAAATGCTCCAATAATAAGACAAACTTGTCTTGAAAAATATGGAGAA
GAACTAAAAGTTATGCAAGGAGAGATGGAAAGAATTGTGATTCGGGATTC
TGGAATTATTCGAGCAGAAGACATTGAAGATGTTTTGGCAGAAACTGTTT
ATGAATTCACAGAAGGCGAAATGACTTTTGCAATTATCAAACCTGATGCT
ATAGTTAACAATAAAATGAACGATATGATTGATATGATAAAAGAAGAAAA
TTTTTATATTATTAAAAAGGAAATAAGGAAACTTAGCAAAGAAGAAGTGA
TGAGTCTATATAGCAAATTTTTAAGTATTGATATCATTGAAGAATATGCA
ACATTTATGACATCTGGTAAATGCTGTATTATGGCTTTGGGATCCGAGAC
TGAAAACTGTGTTGCAAAGCTTAGAGAAATAACAGGACCTAAAGATGTAG
AAAATGCAAAGATTTCTAGTCCGAATAGTTTGAGAGCAATTTATGGACTC
GCCGGTTTCAAAAATGCTATTCACTCAGCAGAAACACGAGAAGAAGCTAT
CAAGTCAGTCAGCGTTATGTTTCCAGATTTAGTATTTAAAAAGCAAGATC
CAACTTCAGAAGACTTAGAAAGAGTAGTTATTCTTCTACCCGAAAGAATT
TATATAGAAGATAAAAATTCTATAATAAATCAATTTACTGACGTTGATCT
AAAAGTAGTCAAACAAACGGAAACTACTTTACCTAAAAGCACTATGACTT
ATGTTTATAAAGAAATAATAAATCAGCGTGAATTATTTGAAGAAAGAGTC
GAAGAAATGAATGGCTCAGTATTCTATGTTATATGCTTTGAATGCAAAAA
TTGTATCAATATTGTAAATTATATGCTTGGATTGTATATACCCGAAGACG
ATATGGATTATAGGAAGCTTACTGTTCGAGATATGGATATCCCCGATTTA
GTATATGCTTCTTCAAAAAAAGAAATTGCAAAAAGAGATGAAAACTATTT
TTTTCCTATTCAATTGACATTTGCTATCATAAAACCTGATGCTTATGAAC
AGCGGGATGAAATAATAAAACTTATTAAAGCTGGAGGATTCGGAATGCCT
TTAGTCGATGACATCGTCTTATCAAATGCTGAAGCTGAAGAAATATATAA
AAATATAAAAGAGACCACGTATTTTGATCGTGTCATTGAAAATTTGACAA
GTGAATTATCATGCGTTATGGTTTTATCTAAATTCGATGCCATTAGAGAA
TGGAGAGATTTCATCGGTAGTCCGAATCCCGAGGAAGCCGCAGAAGAAAG
TCCTGATAAATTGAGAGGAATTTTTGGTTCAACAATTATTCAAAATGCTT
TACATGGTTCAGCCAGTATTGAAGACGTTTATCGCTCAATTAATTTAGTA
TTTGGTAACTCTCAATTTGATGAAAGAGGAAACCTATCAATTCTAAAGCC
ACTAATCAGTAATAATATGGAAAGCTTCCCAATTACAATTTATCGCCCAG
AGAGTGTCGATGAAATTAAAATCCAAGATGTCCTAAAAAAAATTCAATTT
GATAAAGGAATGGGCTCGAAACAAGTCACTAAAGAATTTACGATTAAAGA
ATTGGCTAAATTTTACTCTACAATTAAAAATCCTGAATTATTACCAAATT
TAAAATGTTTTATAGAAATCGCATCGAATATTATTCCGGTATTTATGCAC
GAGGAAAATTCTGGTTTTAAGAAATTAGATTTGATCAACACCTCAACGAG
AATCCAAAAAAATAATCAAGTTCAATTAGAAATTTGGATTTCAAAATTTA
CTGAAGAAAATTTATTGCCAGAATTGAATTATGTCATTTATAAATTTGTG
GAATTAGAATAAAATGAATTTAGATTTCAATTTATATATGTGTGTGTGAA
ATTGTGTGATTATCTTTTCTCTAAG
back to top

protein sequence of SMED30014617-orf-1

>SMED30014617-orf-1 ID=SMED30014617-orf-1|Name=SMED30014617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=719bp
MGTKKLDSGYITHVENQESWDKLLKFQGLFVADIYQEWNGPCKSVVSLFN
KLAAEVNSDKITFAQVKVDSVRSLYMYKGKCEPTFLIMGGGQLVGVIRGS
NAPIIRQTCLEKYGEELKVMQGEMERIVIRDSGIIRAEDIEDVLAETVYE
FTEGEMTFAIIKPDAIVNNKMNDMIDMIKEENFYIIKKEIRKLSKEEVMS
LYSKFLSIDIIEEYATFMTSGKCCIMALGSETENCVAKLREITGPKDVEN
AKISSPNSLRAIYGLAGFKNAIHSAETREEAIKSVSVMFPDLVFKKQDPT
SEDLERVVILLPERIYIEDKNSIINQFTDVDLKVVKQTETTLPKSTMTYV
YKEIINQRELFEERVEEMNGSVFYVICFECKNCINIVNYMLGLYIPEDDM
DYRKLTVRDMDIPDLVYASSKKEIAKRDENYFFPIQLTFAIIKPDAYEQR
DEIIKLIKAGGFGMPLVDDIVLSNAEAEEIYKNIKETTYFDRVIENLTSE
LSCVMVLSKFDAIREWRDFIGSPNPEEAAEESPDKLRGIFGSTIIQNALH
GSASIEDVYRSINLVFGNSQFDERGNLSILKPLISNNMESFPITIYRPES
VDEIKIQDVLKKIQFDKGMGSKQVTKEFTIKELAKFYSTIKNPELLPNLK
CFIEIASNIIPVFMHEENSGFKKLDLINTSTRIQKNNQVQLEIWISKFTE
ENLLPELNYVIYKFVELE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR034907NDK-like_dom
IPR036850NDK-like_dom_sf
IPR036249Thioredoxin-like_sf
IPR001564Nucleoside_diP_kinase
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
Vocabulary: biological process
TermDefinition
GO:0006228UTP biosynthetic process
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0006241CTP biosynthetic process
GO:0045454cell redox homeostasis
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0004550nucleoside diphosphate kinase activity
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034907Nucleoside diphosphate kinase-like domainSMARTSM00562ndk_5coord: 154..296
e-value: 1.1E-19
score: 81.4
coord: 435..573
e-value: 6.2E-28
score: 108.8
IPR034907Nucleoside diphosphate kinase-like domainPFAMPF00334NDKcoord: 155..291
e-value: 4.8E-25
score: 88.1
coord: 437..570
e-value: 1.2E-25
score: 90.1
coord: 308..434
e-value: 1.1E-7
score: 32.0
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 300..435
e-value: 7.4E-9
score: 37.4
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 153..293
e-value: 4.0E-31
score: 110.1
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 436..577
e-value: 5.2E-33
score: 115.8
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 434..571
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 308..434
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 155..293
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 3..112
e-value: 7.2E-12
score: 47.0
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 6..102
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 14..101
e-value: 2.1E-8
score: 34.0
NoneNo IPR availablePANTHERPTHR46135FAMILY NOT NAMEDcoord: 1..569