SMED30014615

Overview
NameSMED30014615
Smed IDSMED30014615
Length (bp)2200
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014615 (SMED30014615) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014615 (SMED30014615) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014615 (SMED30014615) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014615 (SMED30014615) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014615

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30014615 SmedASXL_074446SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
head regionSMED30014615SMESG000068163.1 SMESG000019370.1 SMESG000061559.1 SMESG000059122.1 SMESG000049121.1 SMESG000048179.1 SMESG000044536.1 SMESG000035153.1 SMESG000022674.1 SMESG000017133.1 OX_Smed_1.0.10806ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014615 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003836:52712..54880 -10827
v31.006737:3278..5513 -10474
Homology
BLAST of SMED30014615 vs. TrEMBL
Match: A0A0B7B729 (MULE domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF162021 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.432e-88
Identity = 73/96 (76.04%), Postives = 81/96 (84.38%), Query Frame = -2
Query: 1045 FILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEITEDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVYENS 1332
            F LT+N+R KLADE LLRRYN DPDF LVARMI+ALSFVPIEDLD+A E L+NEI E+LTPILNWFEDVYIGRQN N TRR +LFPP M  VYE +
Sbjct:   57 FHLTKNMRKKLADEGLLRRYNMDPDFALVARMIIALSFVPIEDLDVAFEALENEIAEELTPILNWFEDVYIGRQNRNSTRRRALFPPHMWSVYERT 152          

HSP 2 Score: 128.642 bits (322), Expect = 1.432e-88
Identity = 65/98 (66.33%), Postives = 77/98 (78.57%), Query Frame = -3
Query:  765 RTVNGEDPTNN*C*SSTSKIASRIW--DGNIWKFIDVIQGVQKWRDLVYEQFIRGKKPPVKRRKYVAADTTIMTIVKSYRKRNIIEYLRELAHNFLMD 1052
            RTVNG D TNN   ++  ++ +       NIWKFID I+GVQK RDLVYEQF+RG +PPVKRRKYVAAD  I+TIV+SYR+RNIIEYLR +AHNFLMD
Sbjct:  151 RTVNGLDRTNNYVEAAHRRLQAEFGMDHPNIWKFIDGIRGVQKGRDLVYEQFVRGNQPPVKRRKYVAADIRIITIVESYRERNIIEYLRGIAHNFLMD 248          

HSP 3 Score: 98.9821 bits (245), Expect = 1.432e-88
Identity = 49/59 (83.05%), Postives = 51/59 (86.44%), Query Frame = -1
Query: 1325 YALLPNKEAKTYRRLFEAIKEMWSLLNP---SIDFEQAAIGAIL-TFPNCAIHRCLFHF 1489
            YALLPNKE +TYRRLFEAIKE+W LLNP   SIDFEQAAIGAIL TFPNCAIH CLFH 
Sbjct:    1 YALLPNKEGRTYRRLFEAIKELWPLLNPSSISIDFEQAAIGAILTTFPNCAIHGCLFHL 59          
BLAST of SMED30014615 vs. TrEMBL
Match: A0A0B7B6F7 (FLYWCH-type domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF162024 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 4.553e-78
Identity = 70/91 (76.92%), Postives = 78/91 (85.71%), Query Frame = -1
Query: 1838 IENATSKRGKE*LNHEGYCYVFNKLSADYSKMFWRCELKNECKARLHMTVDDDRVLMQMNQLSNGSDAAQLRVAMIMTGIKRMATVLSKEP 2110
            +EN  SKRGK+ LNHEGY YVF+K SAD+SK FWRCELKNECKARLH TVD+DRVLMQMNQ S+GSDAAQLR AMIMTGIKR AT  ++ P
Sbjct:    1 MENVPSKRGKQKLNHEGYFYVFDKFSADHSKKFWRCELKNECKARLHTTVDNDRVLMQMNQHSHGSDAAQLRAAMIMTGIKRRATETTEIP 91          

HSP 2 Score: 132.109 bits (331), Expect = 4.553e-78
Identity = 69/86 (80.23%), Postives = 73/86 (84.88%), Query Frame = -2
Query: 1498 QHVDRA*II-PDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQICVIMAVR-GFVL 1749
            Q VDRA II PDAYRMYEV PDQME FLL D GE+DENRILLFGRQSN +W+NLMERL VDGTFS+APALF QI VIMA R GFVL
Sbjct:  133 QPVDRASIIIPDAYRMYEVEPDQMEGFLLWDSGEQDENRILLFGRQSNVEWNNLMERLYVDGTFSIAPALFSQIYVIMAARGGFVL 218          

HSP 3 Score: 63.5438 bits (153), Expect = 4.553e-78
Identity = 30/36 (83.33%), Postives = 32/36 (88.89%), Query Frame = -3
Query: 1752 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAP 1859
            N AL+GTS AVQ KMPNKDTIRKVIQRSRN NR+AP
Sbjct:   96 NRALQGTSLAVQGKMPNKDTIRKVIQRSRNGNRVAP 131          
BLAST of SMED30014615 vs. TrEMBL
Match: A0A1I8BWB6 (Uncharacterized protein OS=Meloidogyne hapla OX=6305 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.483e-59
Identity = 89/238 (37.39%), Postives = 132/238 (55.46%), Query Frame = -2
Query: 1054 A*IIPDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQICVIMAVRG-FVLP--FCMLCCQIKK--------LKLTDDCLKPLKKCGHFSILLLTSNKPQLELF*RFRIVQSIDVSFILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEITEDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVY 1734
            A +IP  Y  YE  P   E+FLL D GE DE RIL+FGR+S  DWS+L+  L VDGTF + PALF Q  V++A R  +VLP  +C+L  + +         ++L    L P      F + +  + +    +F    I       F   QN++  L+ E+LL +YN  P+F++  +MIV+L+F+P +DL  A+  L+N +  +L PIL++F + YIGR  +N  R   +F P    VY
Sbjct:  140 ALVIPLNYSRYESEPGVYEQFLLADSGEGDEERILIFGRESFQDWSHLIAELYVDGTFLICPALFYQFFVVLARRNDYVLPIFYCLLPNKTENTYRRTFEMIRLIWPLLNPDSISVDFEVAIHNAIRT---VFPESHIRGCF---FHFFQNLKKHLSAENLLNQYNNSPEFSIHCKMIVSLAFIPQQDLIEALTILENYLPMELEPILSYFTNTYIGRIRNNGVRAPPIFVPSSWNVY 371          

HSP 2 Score: 79.7221 bits (195), Expect = 7.483e-59
Identity = 43/99 (43.43%), Postives = 60/99 (60.61%), Query Frame = -3
Query:  774 DMSTRTVNGEDPTNN*C*SSTSKIASRIWDGN--IWKFIDVIQGVQKWRDLVYEQFIRGKKPPVKRRKYVAADTTIMTIVKSYRKRNIIEYLRELAHNF 1064
            ++ TRT+N ED TNN C +   K+  ++   +  IWKF+D ++ V K  D  YEQF+ G +   KRRKY  AD  I+ IV  Y    +IEYLR ++HNF
Sbjct:  369 NVYTRTINNEDKTNNFCEAFHRKVQLQLGVSHPTIWKFLDELKKVVKMCDAQYEQFVAGHQATRKRRKYEEADERILNIVNRYEIGTVIEYLRGISHNF 467          

HSP 3 Score: 48.1358 bits (113), Expect = 7.483e-59
Identity = 25/90 (27.78%), Postives = 48/90 (53.33%), Query Frame = -1
Query: 1838 SKRGKE*LNHEGYCYVFNKLSADYSKMFWRCELKNE-CKARLHMTVDDDRVLMQM---NQLSNGSDAAQLRVAMIMTGIKRMATVLSKEP 2095
            S +  E  +H GYCYV ++ S+D   +FWRC+ + + CK R+  T  ++R  +++   +  S   D  ++ V   +T +++ A    + P
Sbjct:    3 SSKNFEKYSHNGYCYVKDRESSDGQIIFWRCDERGKGCKGRIWTTSCENREFIRLVTEHSCSTTGDPVRVAVQQAITTVRQRAATTMENP 92          

HSP 4 Score: 33.4982 bits (75), Expect = 7.483e-59
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = -3
Query: 1746 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAPNN 1859
            ++ L+G STAV  ++ NK  +RKV++R R   + AP N
Sbjct:   97 SNVLQGVSTAVLGQLQNKSAMRKVVKRIRLQQQEAPRN 134          

HSP 5 Score: 62.003 bits (149), Expect = 3.592e-6
Identity = 33/61 (54.10%), Postives = 37/61 (60.66%), Query Frame = -1
Query: 1325 VLYALLPNKEAKTYRRLFEAIKEMWSLLNP---SIDFEQAAIGAILT-FPNCAIHRCLFHF 1495
            + Y LLPNK   TYRR FE I+ +W LLNP   S+DFE A   AI T FP   I  C FHF
Sbjct:  221 IFYCLLPNKTENTYRRTFEMIRLIWPLLNPDSISVDFEVAIHNAIRTVFPESHIRGCFFHF 281          
BLAST of SMED30014615 vs. TrEMBL
Match: A0A2C9LZH9 (MULE domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106073290 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.512e-55
Identity = 113/239 (47.28%), Postives = 145/239 (60.67%), Query Frame = -2
Query: 1051 IPDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQICVIMAVRG-FVLPFCMLCCQIKKLKLTDDCLKPLKKC-------------GHFSILLLTSNKPQLELF*RFRIVQSIDVSFILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEITEDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVYE 1725
            IP  Y+ Y V+P+  E+FLL D GE D  RILLFG++SN  WS+  ++L VDGTF ++P++F QI VIMA RG FVLP        K+ +      + +K+                 +I  L S  P   +             F LT+N+R KLADE+LL  YN DP+F L ARMIVAL+FVPIEDLD+A+ETL NE+   LTPI+NWFED YIGR N +RTR  +LFPP M  VY+
Sbjct:  120 IPIEYQNYIVSPELTEKFLLYDSGENDNKRILLFGKESNGSWSSQTKKLYVDGTFRISPSIFSQIYVIMAERGGFVLPVLYALLPNKEGETYRRMFEAVKELWQDLNPSSVSMDFEQAAIGALQSTYPLCAIH---------GCLFHLTKNMRKKLADENLLSMYNNDPEFALAARMIVALAFVPIEDLDLAVETLANELPLHLTPIINWFEDTYIGRLNRSRTRXCALFPPPMWSVYQ 349          

HSP 2 Score: 50.447 bits (119), Expect = 1.512e-55
Identity = 23/36 (63.89%), Postives = 28/36 (77.78%), Query Frame = -3
Query: 1752 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAP 1859
            NS+L+GTS AV  KMP KD +RKVIQR RN+ + AP
Sbjct:   74 NSSLQGTSAAVHAKMPKKDALRKVIQRKRNEIQGAP 109          

HSP 3 Score: 89.7373 bits (221), Expect = 2.031e-15
Identity = 43/61 (70.49%), Postives = 50/61 (81.97%), Query Frame = -1
Query: 1325 VLYALLPNKEAKTYRRLFEAIKEMWSLLNP---SIDFEQAAIGAIL-TFPNCAIHRCLFHF 1495
            VLYALLPNKE +TYRR+FEA+KE+W  LNP   S+DFEQAAIGA+  T+P CAIH CLFH 
Sbjct:  198 VLYALLPNKEGETYRRMFEAVKELWQDLNPSSVSMDFEQAAIGALQSTYPLCAIHGCLFHL 258          
BLAST of SMED30014615 vs. TrEMBL
Match: A0A2C9KG87 (MULE domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106058662 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.348e-53
Identity = 120/254 (47.24%), Postives = 158/254 (62.20%), Query Frame = -2
Query:  979 IPDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQICVIMAVRG-FVLPFCMLCCQIKKLKLTDDCLKPLKK-CGHFSILLLTSNKPQLE---LF*RFRIVQSIDVSFILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEITEDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVYENSEWRGSYQQLMLKQHIEDCKPNL 1725
            IP  Y+ Y V+P+  E+FLL D GE D  RILLFG++SN  WS+ M++L VDGTF +AP++F QI VIMA RG FVLP        K+ +      + +K+ C   +   ++ +  Q     L   + +       F LT+N+R KLADE+LL  YN DP+F L ARMIVAL+FVPIEDLDMA+ETL NE+   LTPI+NWFED  IGR NH+ TRR     P +  + E+S      Q ++ KQHI D KP+L
Sbjct:   33 IPIEYQNYIVSPELTEKFLLYDSGENDNKRILLFGKESNGSWSSQMKKLYVDGTFRIAPSIFSQIYVIMAERGGFVLPVLYALLPNKEGETYRRMFEAVKELCPDLNPSSVSMDFEQAAIGALQSTYPLCAIHGCLFHLTKNMRKKLADENLLSMYNNDPEFALAARMIVALAFVPIEDLDMAVETLANELPLHLTPIINWFEDTSIGRLNHSTTRRC----PPIRSIREHS-MEIIEQTILWKQHIGDYKPSL 281          

HSP 2 Score: 83.5741 bits (205), Expect = 8.700e-14
Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = -1
Query: 1325 VLYALLPNKEAKTYRRLFEAIKEMWSLLNP---SIDFEQAAIGAIL-TFPNCAIHRCLFHF 1495
            VLYALLPNKE +TYRR+FEA+KE+   LNP   S+DFEQAAIGA+  T+P CAIH CLFH 
Sbjct:  111 VLYALLPNKEGETYRRMFEAVKELCPDLNPSSVSMDFEQAAIGALQSTYPLCAIHGCLFHL 171          
BLAST of SMED30014615 vs. Planmine SMEST
Match: SMESG000073146.1 (SMESG000073146.1)

HSP 1 Score: 152.14 bits (383), Expect = 8.644e-43
Identity = 82/136 (60.29%), Postives = 98/136 (72.06%), Query Frame = -2
Query:  952 FILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEITEDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVYE---NSEWR------GSYQQLMLKQHIEDCKPNLGWKHLEIYR 1332
            F LT+N+R KL D+ LLRRYN D DF LVA MIVA+SFV IE LD+AIE LDN+ITE+LTPILNWFEDVYIGRQNHNRTRR++LF PQM  VYE   N E R        +Q+L L+       PN+ WK +++ R
Sbjct:   12 FHLTKNMRKKLTDKGLLRRYNIDSDFALVAGMIVAISFVSIEGLDIAIEALDNKITENLTPILNWFEDVYIGRQNHNRTRRHTLFSPQMWSVYERTVNGEHRTNNYVESEHQRLQLQAEFGMDHPNI-WKFIDVIR 146          
BLAST of SMED30014615 vs. Planmine SMEST
Match: SMESG000030505.1 (SMESG000030505.1)

HSP 1 Score: 112.849 bits (281), Expect = 2.190e-35
Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = -2
Query: 1528 QHVDRA*II-PDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQIC 1749
            Q VDRA II  DAYRMY+VAPDQMEEFLL D GE+DENRILLFGRQSN DWSNLM+R+ +D TFSLAP LF  IC
Sbjct:   77 QPVDRASIIISDAYRMYKVAPDQMEEFLLWDSGEQDENRILLFGRQSNGDWSNLMKRMYIDRTFSLAP-LFTDIC 150          

HSP 2 Score: 56.6102 bits (135), Expect = 2.190e-35
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = -3
Query: 1752 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAP 1859
            NSAL+GTS A Q K+PNKD I KVIQ+SRNDN +AP
Sbjct:   40 NSALQGTSPAFQAKLPNKDAICKVIQQSRNDNLVAP 75          

HSP 3 Score: 98.9821 bits (245), Expect = 3.599e-23
Identity = 87/235 (37.02%), Postives = 108/235 (45.96%), Query Frame = -1
Query: 1343 MQMNQLSNGSDAAQLRVAMIMTGIKRMATVLSKEPRLPFK*RCQTKTPFARLFSGVXXXXXXXXXTCRSSLN------------YSGCISDV-----------------RSGTRSDGRISFKRLGRRRRKSHSSLWPTVE**LE*SDGKTVCRRNIQLGSCSFFTDMCNHGSER-IRTAV-LYALLPNKEAKTYRRLFEAIKEMWSLLNP---SIDFEQAAIGAIL-TFPNCAIH 1942
            MQMNQ S+G DA QLRVAMI+TGIKR     ++ P +      Q  +P    F       + +    + S N             S  ISD                   SG + + RI     GR+     S+L             +    R   L     FTD+CNH SER IR  V +++    KEA+TYRRLFEAIKEMW   N    SIDFEQA+IGAI  TFPN AI+
Sbjct:    1 MQMNQHSHGRDATQLRVAMIVTGIKRRTIETTEIPSVIINSALQGTSP---AFQAKLPNKDAICKVIQQSRNDNLVAPPQPVDRASIIISDAYRMYKVAPDQMEEFLLWDSGEQDENRILL--FGRQSNGDWSNLM-----------KRMYIDRTFSL--APLFTDICNHDSERRIRIDVFVWSAAKYKEARTYRRLFEAIKEMWPFFNSSSVSIDFEQASIGAIRKTFPNYAIY 217          
BLAST of SMED30014615 vs. Planmine SMEST
Match: SMESG000026610.1 (SMESG000026610.1)

HSP 1 Score: 108.612 bits (270), Expect = 2.565e-35
Identity = 57/79 (72.15%), Postives = 61/79 (77.22%), Query Frame = -2
Query: 1495 IIPDAYRMYEVAPDQMEEFLLRD*GEEDENRILLFGRQSNSDWSNLMERLCVDGTFSLAPALFLQICVIMAVR-GFVLP 1728
            II + YRMYEVA DQMEEFLL D GE DENRIL FGRQSN D SNLM++L VDGTF L  A+F QI V MA R GFVLP
Sbjct:   76 IILNTYRMYEVAQDQMEEFLLWDSGEHDENRILHFGRQSNGDCSNLMKKLYVDGTFILDSAVFSQIYVFMAARGGFVLP 154          

HSP 2 Score: 48.521 bits (114), Expect = 2.565e-35
Identity = 28/49 (57.14%), Postives = 32/49 (65.31%), Query Frame = -3
Query: 1713 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAPNNMSIELKLFRMH 1859
            NS L+ TSTAVQ  M NKD IRKVIQ S NDNR +     I L  +RM+
Sbjct:   40 NSTLQVTSTAVQANMSNKDAIRKVIQWSINDNRAS----IIILNTYRMY 84          

HSP 3 Score: 32.3426 bits (72), Expect = 2.565e-35
Identity = 16/25 (64.00%), Postives = 18/25 (72.00%), Query Frame = -3
Query: 1326 LRTSRNWSYF-NVSELCNP*MSLSF 1397
            +RT+ NWSY  NVSEL NP M  SF
Sbjct:  187 VRTNLNWSYLNNVSELYNPWMPFSF 211          

HSP 4 Score: 77.411 bits (189), Expect = 9.542e-16
Identity = 70/207 (33.82%), Postives = 91/207 (43.96%), Query Frame = -1
Query: 1403 MQMNQLSNGSDAAQLRVAMIMTGIKRMATVLSKEPRLPFK*RCQTKTPFARLFSGVXXXXXXXXXTCRSSLNYSGCISDVRSGTRSDGRISFKRLGRRRRKSHSS-------LWPTVE**LE*SDGKTVCRRNIQL-GSCS-FFTDMCNHGSERIRTAV------------------LYALLPNKEAKTYRRLFEAIKEMWSLLNPS 1942
            MQMNQ S+G  A QLRV +IMTGIKR AT  ++ P +      Q  +                 T  +++++    I  V   + +D R S   L   R    +        LW + E      D   +     Q  G CS     +   G+  + +AV                  LYALLPNKEA+TYRRLFEAIKEMW LLNPS
Sbjct:    1 MQMNQHSHGCYAEQLRVTVIMTGIKRRATETTEIPSVILNSTLQVTS-----------------TAVQANMSNKDAIRKVIQWSINDNRASIIILNTYRMYEVAQDQMEEFLLWDSGE-----HDENRILHFGRQSNGDCSNLMKKLYVDGTFILDSAVFSQIYVFMAARGGFVLPVLYALLPNKEARTYRRLFEAIKEMWPLLNPS 185          
BLAST of SMED30014615 vs. Planmine SMEST
Match: SMESG000065925.1 (SMESG000065925.1)

HSP 1 Score: 98.2117 bits (243), Expect = 9.416e-24
Identity = 57/109 (52.29%), Postives = 70/109 (64.22%), Query Frame = -2
Query: 1018 FILTQNIRMKLADEDLLRRYNTDPDFTLVARMIVALSFVPIEDLDMAIETLDNEIT----EDLTPILNWFEDVYIGRQNHNRTRRNSLFPPQM*YVYENSEWRGSYQQL 1332
            F LT+N+    ADE LLR+YNTDPDFTLV RMIVALSFVP EDLD+A+  LDNEIT     +L  IL     +Y   ++   +    +    +  + ENSEWRGSYQQL
Sbjct:   36 FHLTKNMHQTFADECLLRQYNTDPDFTLVVRMIVALSFVPFEDLDVAVNALDNEITGRPQANLKLILGC---MYRTLKSQPNSPSCVVSSSNVVCIRENSEWRGSYQQL 141          

HSP 2 Score: 55.8398 bits (133), Expect = 4.647e-9
Identity = 49/123 (39.84%), Postives = 59/123 (47.97%), Query Frame = -1
Query: 1100 MWSLLNPS---IDFEQAAIGAI-LTFPNCAIHRCLFHF--DAEHTY--EVSRRR------FTSPI*HRSGLHLGCQNDSRSLLCSNRRP*YGY*DTG**NYGRPHANLKLV*GCLHRTSKSQP 1426
            M SL NPS   IDFEQAAI +I  TFPNC IH CLFH   +   T+  E   R+      FT  +     L      D    + +      G          RP ANLKL+ GC++RT KSQP
Sbjct:    1 MCSLFNPSSVSIDFEQAAIRSIQTTFPNCEIHACLFHLTKNMHQTFADECLLRQYNTDPDFTLVVRMIVALSFVPFEDLDVAVNALDNEITG----------RPQANLKLILGCMYRTLKSQP 113          
BLAST of SMED30014615 vs. Planmine SMEST
Match: SMESG000056539.1 (SMESG000056539.1)

HSP 1 Score: 54.299 bits (129), Expect = 5.592e-15
Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = -3
Query: 1752 NSALEGTSTAVQVKMPNKDTIRKVIQRSRNDNRIAP 1859
            NS L+GTSTA+Q  M NKD IRKVIQ SRN NR+ P
Sbjct:   40 NSTLQGTSTAIQAMMSNKDAIRKVIQWSRNGNRVVP 75          

HSP 2 Score: 46.2098 bits (108), Expect = 5.592e-15
Identity = 24/29 (82.76%), Postives = 25/29 (86.21%), Query Frame = -2
Query: 1666 QHVDRA*II-PDAYRMYEVAPDQMEEFLL 1749
            Q VDR  II P+AYRMYEVAPDQMEEFLL
Sbjct:   77 QLVDRISIIFPEAYRMYEVAPDQMEEFLL 105          
The following BLAST results are available for this feature:
BLAST of SMED30014615 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7B7291.432e-8876.04MULE domain-containing protein (Fragment) OS=Arion... [more]
A0A0B7B6F74.553e-7876.92FLYWCH-type domain-containing protein (Fragment) O... [more]
A0A1I8BWB67.483e-5937.39Uncharacterized protein OS=Meloidogyne hapla OX=63... [more]
A0A2C9LZH91.512e-5547.28MULE domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9KG871.348e-5347.24MULE domain-containing protein OS=Biomphalaria gla... [more]
back to top
BLAST of SMED30014615 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014615 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073146.18.644e-4360.29SMESG000073146.1[more]
SMESG000030505.12.190e-3577.33SMESG000030505.1[more]
SMESG000026610.12.565e-3572.15SMESG000026610.1[more]
SMESG000065925.19.416e-2452.29SMESG000065925.1[more]
SMESG000056539.15.592e-1569.44SMESG000056539.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014615 ID=SMED30014615|Name=SMED30014615|organism=Schmidtea mediterranea sexual|type=transcript|length=2200bp
CTGTCGAAGATCCAGAAAATAATAGTGAAGAAGAAATAAACGAGCCTGCC
TGAAGCACTGAACTTCTATTGCAGTGATGATAGCTATTTTGCACCATTTC
ACATACGCTTGAGACTGTTAGAAAACGATGATAATGTCAAAATATTATAA
TTTTCATTGAATAAATAAATATAATTAATTAAAAAGAAACGAATGTTATT
CTTTTGATTTCAATTTATGAATTGTAAATCTTTAGCTCTTCTCTTCTCAA
ACATCTTTTAGTAACACCGATTGTTAACTTTCTTTGTGGTAATATGATTA
TTATAAGTGTGAATATTCTTCTTAGACATTATTTATTTAAACTTTCATTC
TTATATAGCCTAATACTGACGGTACTATTTTTATTGCTTCTACCATTATC
CAATTATACTTCTCTCTAAATTACCAATAAAAGGTACAGATACCTTCCAC
TATAATACCAATTTCTGAGGTGACTACTTTATAAGCGATTTTTTTGGTTT
TATGTTCTTTTCGAAAATTATGGAACATAACACTATTTATACATCTGACC
TTGTATATTTATATATATATTACGGTGTCCATTCGTTCCTTTTGCGAAGC
GGGACTTTTTGGCGCCATTTTAAAATAACTTTTAATTTAACTTATTGTTT
ATAAACTTTTAATAAAGGAATGCAAAATATATAAATTAAGACACGTTTAA
AAATAACTTGTTATTTAACTTAACGTTTATAAACTCTTTATTTTCCGAAA
GTCCGTGTATATTAGTCCATCAAAAAATTATGGGCAAGTTCTCTAAGATA
CTCGATGATGTTTCGTTTTCTGTAACTCTTAACAATTGTCATGATTGTGG
TATCTGCTGCGACATATTTTCTGCGCTTTACAGGCGGCTTTTTTCCACGA
ATGAATTGCTCATATACAAGGTCACGCCATTTTTGAACACCTTGAATTAC
GTCTATAAATTTCCAAATGTTTCCATCCCAAATTCGGCTTGCAATCTTCG
ATGTGCTGCTTCAACATTAGTTGTTGGTAGGATCCTCTCCATTCACTGTT
CTCGTAGACATATCACATTTGAGGAGGAAACAACGAATTACGTCGAGTTC
GGTTGTGATTTTGACGTCCTATGTAAACATCCTCAAACCAATTTAAGATT
GGCGTGAGGTCTTCCGTAATTTCATTATCCAGTGTCTCAATAGCCATATC
AAGGTCTTCGATTGGAACAAAGGAGAGAGCGACTATCATTCTGGCAACCA
AGGTGAAGTCCGGATCTGTGTTATATCGGCGAAGTAAATCTTCGTCTGCT
AACTTCATACGTATGTTCTGCGTCAAAATGAAAGAGACATCTATGGATTG
CACAATTCGGAAACGTTAAAATAGCTCCAATTGCGGCTTGTTCGAAGTCA
ATAGAAGGATTGAGAAGTGACCACATTTCTTTAATGGCTTCAAACAGTCG
TCGGTAAGTTTTAGCTTCTTTATTTGGCAGCAGAGCATACAAAACGGCAG
TACGAATCCTCTCACTGCCATGATTACACATATCTGTAAAAAAAGAGCAG
GAGCCAAGCTGAATGTTCCGTCTACACACAGTCTTTCCATCAGATTACTC
CAGTCACTATTCGACTGTCGGCCAAAGAGAAGAATGCGATTTTCGTCTTC
TTCTCCCTAATCTCTTAAAAGAAATTCTTCCATCTGATCTGGTGCCACTT
CGTACATCCGATATGCATCCGGAATAATTTAAGCTCGATCGACATGTTGT
TAGGAGCTATTCTGTTGTCGTTTCTACTCCGCTGAATAACCTTGCGAATG
GTGTCTTTGTTTGGCATCTTCACTTGAACGGCAGTCGAGGTTCCTTCGAG
AGCACTGTTGCCATCCTTTTGATTCCTGTCATTATCATGGCAACCCGAAG
TTGCGCTGCGTCACTTCCGTTACTAAGCTGGTTCATCTGCATCAGAACTC
GATCATCATCTACTGTCATGTGTAAACGAGCCTTGCATTCGTTCTTCAGT
TCACATCGCCAGAACATCTTGGAATAGTCTGCACTTAACTTATTGAACAC
ATAACAGTATCCTTCGTGATTCAACTATTCTTTACCACGCTTCGATGTAG
CATTTTCTATTTTACTGGTTTAACAGAATTATAATATGTGATATATTTAT
GAAACTCTACTTAACTTATGATTTTAGTCTAGAACACTCTTGCGCTTTTA
back to top

protein sequence of SMED30014615-orf-1

>SMED30014615-orf-1 ID=SMED30014615-orf-1|Name=SMED30014615-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MGKFSKILDDVSFSVTLNNCHDCGICCDIFSALYRRLFSTNELLIYKVTP
FLNTLNYVYKFPNVSIPNSACNLRCAASTLVVGRILSIHCSRRHITFEEE
TTNYVEFGCDFDVLCKHPQTNLRLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007588Znf_FLYWCH