Copine-3

Overview
NameCopine-3
Smed IDSMED30014606
Length (bp)1994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Copine-3 (SMED30014606) t-SNE clustered cells

Violin plots show distribution of expression levels for Copine-3 (SMED30014606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Copine-3 (SMED30014606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Copine-3 (SMED30014606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014606h1SMcG0012885 SmedASXL_011868SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014606h1SMcG0012885 dd_Smed_v4_14045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014606h1SMcG0012885 dd_Smed_v4_14045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014606h1SMcG0012885 dd_Smed_v4_14045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014606h1SMcG0012885 dd_Smed_v4_17867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014606h1SMcG0012885 dd_Smed_v4_17867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014606h1SMcG0012885 dd_Smed_v4_17867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014606h1SMcG0012885 dd_Smed_v6_17867_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014606h1SMcG0012885 dd_Smed_v6_14045_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE8 (copine 8 [Source:HGNC Symbol;Acc:HGNC:23498])

HSP 1 Score: 369.007 bits (946), Expect = 2.038e-119
Identity = 207/490 (42.24%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE++ +R +L+ +        +   +  + C++G I+ S G              C   II    E    +D + ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+A   S+  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    T++SFLDY+ GGT +NF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D+MFPA GFGA++PPD +ISHE+ LNG+  NP+C G+EGVM+AY  +L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D  +TK +++ AS LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   69 IDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGKKCGT-IILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYM-RARG 543          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE8 (copine 8 [Source:HGNC Symbol;Acc:HGNC:23498])

HSP 1 Score: 367.851 bits (943), Expect = 4.584e-119
Identity = 207/490 (42.24%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE++ +R +L+ +        +   +  + C++G I+ S G              C   II    E    +D + ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+A   S+  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    T++SFLDY+ GGT +NF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D+MFPA GFGA++PPD +ISHE+ LNG+  NP+C G+EGVM+AY  +L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D  +TK +++ AS LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   57 IDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGKKCGT-IILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYM-RARG 531          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE9 (copine family member 9 [Source:HGNC Symbol;Acc:HGNC:24336])

HSP 1 Score: 355.91 bits (912), Expect = 1.740e-114
Identity = 197/491 (40.12%), Postives = 297/491 (60.49%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----------YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +++ +           + G++        ++G +I   G     T        C   I+    E +  +D   +++    LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +    +DWD       D   +F   IGEFTT+ R L  A  +   +E++N RKK KKK Y +SG +T+ +    ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM     + Y++A++AV EI+Q+YD+D++FPA+GFGA++PP+ +ISH++PLN +  +P C G+EGV+++Y ++L  V+L GPT+FAPVI QV+  + +  DGS Y++LLI+TDG + D  +TK A++ AS LP+SII++GVG   F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q+L YM
Sbjct:   59 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFL------ALGEVIGGQGSRVERTLTGVPGKKCGT-ILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD------RDGSHDF---IGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYM 529          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE2 (copine 2 [Source:HGNC Symbol;Acc:HGNC:2315])

HSP 1 Score: 348.591 bits (893), Expect = 1.126e-111
Identity = 201/495 (40.61%), Postives = 296/495 (59.80%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIEL-----HGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSK---EHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSE 1654
            F +K  L+Y FEE Q ++  L       +   E   +    CS+G I+ S  +++R              +I    ++ +    + + + G  LDKKD+FGKSDP++  Y+  D GK +  +R+EV+K TL+P WK     L  LC  D++  +   C+D+D   G          + IGEF T+   +  A +    +FE +N +K++KKKNY++SG+I +R+ +   D SFLDY+ GG  L F V ID T+SNG+  DP+SLHY++   TNEY  AI AV +I+Q+YD+D+MFPA GFGA++PPD+K+SHE+ +N + +NPFC GV+G+ +AY   L  ++  GPT+F+P++  V+  +    + R  + YFILLI+TDG + D  ET+ AV++AS LP+SII++GVG   F+ ME LD D ++LR    ++A RD VQFVP R F  AA          K +LAK VLAELP QV+ Y  +HK  L P  SE
Sbjct:   75 FSKKFVLDYHFEEVQKLKFALFDQDKSSMRLDEHDFLGQFSCSLGTIV-SSKKITR-PLLLLNDKPAGKGLITIAAQELSDNRVITLSLAGRRLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCYDYDNDGGH---------DFIGEFQTSVSQMCEARDSVPLEFECINPKKQRKKKNYKNSGIIILRSCKINRDYSFLDYILGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATQQRTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDSRMLRSHTGEEAARDIVQFVPFREFRNAA----------KETLAKAVLAELPQQVVQYF-KHKN-LPPTNSE 546          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE2 (copine 2 [Source:HGNC Symbol;Acc:HGNC:2315])

HSP 1 Score: 348.591 bits (893), Expect = 1.126e-111
Identity = 201/495 (40.61%), Postives = 296/495 (59.80%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIEL-----HGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSK---EHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSE 1654
            F +K  L+Y FEE Q ++  L       +   E   +    CS+G I+ S  +++R              +I    ++ +    + + + G  LDKKD+FGKSDP++  Y+  D GK +  +R+EV+K TL+P WK     L  LC  D++  +   C+D+D   G          + IGEF T+   +  A +    +FE +N +K++KKKNY++SG+I +R+ +   D SFLDY+ GG  L F V ID T+SNG+  DP+SLHY++   TNEY  AI AV +I+Q+YD+D+MFPA GFGA++PPD+K+SHE+ +N + +NPFC GV+G+ +AY   L  ++  GPT+F+P++  V+  +    + R  + YFILLI+TDG + D  ET+ AV++AS LP+SII++GVG   F+ ME LD D ++LR    ++A RD VQFVP R F  AA          K +LAK VLAELP QV+ Y  +HK  L P  SE
Sbjct:   75 FSKKFVLDYHFEEVQKLKFALFDQDKSSMRLDEHDFLGQFSCSLGTIV-SSKKITR-PLLLLNDKPAGKGLITIAAQELSDNRVITLSLAGRRLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCYDYDNDGGH---------DFIGEFQTSVSQMCEARDSVPLEFECINPKKQRKKKNYKNSGIIILRSCKINRDYSFLDYILGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATQQRTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDSRMLRSHTGEEAARDIVQFVPFREFRNAA----------KETLAKAVLAELPQQVVQYF-KHKN-LPPTNSE 546          
BLAST of Copine-3 vs. Ensembl Celegans
Match: gem-4 (Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMBL;Acc:Q22422])

HSP 1 Score: 291.967 bits (746), Expect = 1.614e-89
Identity = 185/495 (37.37%), Postives = 270/495 (54.55%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIELH-------GIYFGESACVATLECSVGRII-------HSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLL--SANGEQKKFELVNSRXXXXXXNYQ-HSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLS-KEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADG---SDSIRWNKVSLAKEVLAELPVQVLHYMSR 1621
            F     + Y FEE Q+ R EL+       G        +   EC + +I+       H GG+ S   +W  K    +   I    E+    + ++  + G  LD+KD FGKSDPY+   RR D G     +++EV   TLNP W  V+ S + LCG ++D  +I +C+D +             D++IG   TT   L+  +  GE  +  L+N +KK KK     +SG++ I   + + + +FLD++ GGT L+F VA+D T+SNG+   P SLHYM     N+Y +A+++VL I Q Y++ + F A+GFGA++P    +S  +PL+ +  +    G+ GVM AYR AL  V L GPT+F+P+I +V+N + K  +  + Y ILLI+TDG + D   T   VI AS LP+SII+IGVG   F  M  LD D  LL+  +  A RD VQFV MR FL   + G   +D+I  N   LA+EVL E+P Q+  YM R
Sbjct:   84 FKTTFLIPYFFEETQLFRFELYDVDSPKVGADMSGHDFLGRFECVLAQIVSYSTLRAHLGGKHSIGAQWKNKDKVSKNGSITIRAEEDEKNEKIQFDVCGEKLDRKDFFGKSDPYLNFKRRFDDGSSHMIHQTEVKPKTLNPRWSTVLISTQALCGKNMDRPIIIECYDHEKFKKQ--------DDIIGTAQTTLNTLIEQAGGGESTQIPLINEKKKLKKGAKYKNSGMLKIWNAKLVLEPTFLDFIAGGTQLDFAVAVDFTASNGNPRTPGSLHYMATGIPNQYEIALRSVLTICQHYNSSKTFEAYGFGAKLPNHQTVSAVFPLDLNRQSSSVVGINGVMNAYRHALQNVTLYGPTNFSPIIVEVANKAQKMMKTTARYQILLIITDGIISDMYATINTVINASGLPLSIIIIGVGNEDFERMHELDSDDALLQQDSRIAERDIVQFVTMRDFLGNQSGGYLNTDTIMEN---LAREVLYEVPDQLTGYMKR 567          
BLAST of Copine-3 vs. Ensembl Celegans
Match: gem-4 (Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMBL;Acc:Q22422])

HSP 1 Score: 291.967 bits (746), Expect = 1.614e-89
Identity = 185/495 (37.37%), Postives = 270/495 (54.55%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIELH-------GIYFGESACVATLECSVGRII-------HSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLL--SANGEQKKFELVNSRXXXXXXNYQ-HSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLS-KEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADG---SDSIRWNKVSLAKEVLAELPVQVLHYMSR 1621
            F     + Y FEE Q+ R EL+       G        +   EC + +I+       H GG+ S   +W  K    +   I    E+    + ++  + G  LD+KD FGKSDPY+   RR D G     +++EV   TLNP W  V+ S + LCG ++D  +I +C+D +             D++IG   TT   L+  +  GE  +  L+N +KK KK     +SG++ I   + + + +FLD++ GGT L+F VA+D T+SNG+   P SLHYM     N+Y +A+++VL I Q Y++ + F A+GFGA++P    +S  +PL+ +  +    G+ GVM AYR AL  V L GPT+F+P+I +V+N + K  +  + Y ILLI+TDG + D   T   VI AS LP+SII+IGVG   F  M  LD D  LL+  +  A RD VQFV MR FL   + G   +D+I  N   LA+EVL E+P Q+  YM R
Sbjct:   84 FKTTFLIPYFFEETQLFRFELYDVDSPKVGADMSGHDFLGRFECVLAQIVSYSTLRAHLGGKHSIGAQWKNKDKVSKNGSITIRAEEDEKNEKIQFDVCGEKLDRKDFFGKSDPYLNFKRRFDDGSSHMIHQTEVKPKTLNPRWSTVLISTQALCGKNMDRPIIIECYDHEKFKKQ--------DDIIGTAQTTLNTLIEQAGGGESTQIPLINEKKKLKKGAKYKNSGMLKIWNAKLVLEPTFLDFIAGGTQLDFAVAVDFTASNGNPRTPGSLHYMATGIPNQYEIALRSVLTICQHYNSSKTFEAYGFGAKLPNHQTVSAVFPLDLNRQSSSVVGINGVMNAYRHALQNVTLYGPTNFSPIIVEVANKAQKMMKTTARYQILLIITDGIISDMYATINTVINASGLPLSIIIIGVGNEDFERMHELDSDDALLQQDSRIAERDIVQFVTMRDFLGNQSGGYLNTDTIMEN---LAREVLYEVPDQLTGYMKR 567          
BLAST of Copine-3 vs. Ensembl Celegans
Match: nra-1 (Nicotinic receptor-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUB9])

HSP 1 Score: 287.73 bits (735), Expect = 6.884e-88
Identity = 188/507 (37.08%), Postives = 271/507 (53.45%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVAT----------LECSVGRII-------HSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDG-ANGDPEDMDTEF--DELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQH-SGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH-RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAAD---GSDSIRWNKVSLAKEVLAELPVQVLHYMSR 1621
            V ++ +  F +   L Y FEE Q++R E   IY  +S  V             EC + +I+       H G       +W  K    +   I    E+    + ++  + G GLDKKD FGKSDPY+   R+ D G     +R+EV   TL+P W  V  + + LC  D D  +I +C+D D    G+    D +F  D+LIG   TT   LL  + +  +  L N +KK KK +    SG + I   + + + +FLD++ GGT L+F VA+D T+SNG  +  +SLH+M  +  N+Y +A+++VL I Q Y++ + F AFGFGA++P    +S  +PL+         G+ GVM AYR AL  V+L GPT+FAP+I  V+  ++    D + Y ILLI+TDG + D   T R++I AS LP+SII+IGVG   F  M  LD D  LL+  +  A RD VQFV MR FL          D I+ N   LA+EVL E+P Q+  YM +
Sbjct:   75 VMNNLNPQFTKTFLLPYFFEETQLLRFE---IYDADSPTVGQDLSSHDFLGRFECVLAQIVSYSTLKAHLGKTGQIGAQWRNKDKNTKTGSITIYAEEDEKAEKIQFDVCGEGLDKKDFFGKSDPYLNFKRKFDDGSTHLIHRTEVKPKTLDPRWATVQINTQTLCAKDGDRPIIIECYDHDKWKKGEEPRGDAKFSRDDLIGTAQTTLNELLRGSSDAVEILLTNEKKKAKKGDKYKCSGTLKIWNSRIVIEPTFLDFISGGTQLDFAVAVDFTASNGPPKSSSSLHFMSADRPNQYELALRSVLSICQHYNSSKTFEAFGFGAKLPNQSSVSAIFPLDLQRGTSEVVGITGVMTAYRHALSNVQLYGPTNFAPIIENVARKAQNMIHDSARYQILLIITDGIISDMHATIRSIISASGLPLSIIIIGVGNEDFEKMHELDSDDALLQQDSRIAQRDIVQFVTMREFLNNGQGLYLDPDVIQEN---LAREVLYEVPAQLTGYMKQ 575          
BLAST of Copine-3 vs. Ensembl Celegans
Match: nra-1 (Nicotinic receptor-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUB9])

HSP 1 Score: 283.108 bits (723), Expect = 2.740e-86
Identity = 185/504 (36.71%), Postives = 266/504 (52.78%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVAT----------LECSVGRII-------HSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQH-SGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH-RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAAD---GSDSIRWNKVSLAKEVLAELPVQVLHYMSR 1621
            V ++ +  F +   L Y FEE Q++R E   IY  +S  V             EC + +I+       H G       +W  K    +   I    E+    + ++  + G GLDKKD FGKSDPY+   R+ D G     +R+EV   TL+P W  V  + + LC  D D  +I +C+D D    D         +LIG   TT   LL  + +  +  L N +KK KK +    SG + I   + + + +FLD++ GGT L+F VA+D T+SNG  +  +SLH+M  +  N+Y +A+++VL I Q Y++ + F AFGFGA++P    +S  +PL+         G+ GVM AYR AL  V+L GPT+FAP+I  V+  ++    D + Y ILLI+TDG + D   T R++I AS LP+SII+IGVG   F  M  LD D  LL+  +  A RD VQFV MR FL          D I+ N   LA+EVL E+P Q+  YM +
Sbjct:   75 VMNNLNPQFTKTFLLPYFFEETQLLRFE---IYDADSPTVGQDLSSHDFLGRFECVLAQIVSYSTLKAHLGKTGQIGAQWRNKDKNTKTGSITIYAEEDEKAEKIQFDVCGEGLDKKDFFGKSDPYLNFKRKFDDGSTHLIHRTEVKPKTLDPRWATVQINTQTLCAKDGDRPIIIECYDHDKWKKD---------DLIGTAQTTLNELLRGSSDAVEILLTNEKKKAKKGDKYKCSGTLKIWNSRIVIEPTFLDFISGGTQLDFAVAVDFTASNGPPKSSSSLHFMSADRPNQYELALRSVLSICQHYNSSKTFEAFGFGAKLPNQSSVSAIFPLDLQRGTSEVVGITGVMTAYRHALSNVQLYGPTNFAPIIENVARKAQNMIHDSARYQILLIITDGIISDMHATIRSIISASGLPLSIIIIGVGNEDFEKMHELDSDDALLQQDSRIAQRDIVQFVTMREFLNNGQGLYLDPDVIQEN---LAREVLYEVPAQLTGYMKQ 563          
BLAST of Copine-3 vs. Ensembl Celegans
Match: cpna-5 (Copine family protein 5 [Source:UniProtKB/Swiss-Prot;Acc:Q09219])

HSP 1 Score: 174.096 bits (440), Expect = 4.437e-46
Identity = 142/516 (27.52%), Postives = 241/516 (46.71%), Query Frame = 2
Query:  185 SKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----------------FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYR--RNDKGK----LIRTYRSEVVKNTLNPDWKAVVASLERLCGND---LDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTN-EYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGS---HYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGP 1642
            S++I F  K   +Y+FE+ Q+I+      +                 F     + +    + R +   G ++       +     +  I    E    +  + ++  G  LD+KD     D   + +R  R ++GK    L+  Y SE +KN  +P W       +    N    L+  +++K  D DG  G            IG+F TT   +    G    + ++N  KK +KK+Y++SG + +     ++  SFLDY+  GT L+F + +D +S       P  +H +D    + E  +AI+A+  I+++Y  + +F AFG GA++PP F  S+E+ LN    +P C+G++GVM+AYR+    V     +  +PVI  V+ +S  HR G    HY +L + T G V D  E ++A+  AS  P+SI++IG+G   FS ++ L    K  R       RD VQF+ ++  L    +G+++   NK  +A+  L  +P  ++ YM     A  P
Sbjct:  109 SRNIVFTDKFSYQYVFEKTQLIKAVFSRCHDRDKPSSSSRDILATSIFKVDELIGSFGLQLRRQLEKNGNIASALSGTQRVTDEYLGGIIVSAEMPEKEQPIVVQFHGKSLDRKDFLW--DETAVFFRVFRLEEGKDDDSLVFLYESEALKNHSHPQWAEFRLDTQDAADNRNRLLEIWVMYK--DVDGKEG-----------YIGKFLTTYAKMKYGPGSDNVYSVINDVKKAQKKSYENSGKMELVKFTDVSFYSFLDYIVSGTQLHFEIGVDFSS-------PEPVHELDQRRFDGELHMAIRAIGSIIRDYTPNRLFAAFGIGAKIPPTFHESNEFFLNFSM-DPICRGLDGVMEAYRKTQTMVTPLKESKLSPVINYVTRMS--HRSGFRGLHYHVLALFTRGEVTDLKEIQQALNSASDAPLSILIIGMGDFDFSSLQKLCSKRKDGR-------RDVVQFIHLKSLL----NGAEAPWLNKSRIAETALRHVPQHMVQYMHNANIAAKP 588          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne8 (copine VIII [Source:ZFIN;Acc:ZDB-GENE-100809-1])

HSP 1 Score: 363.614 bits (932), Expect = 2.468e-117
Identity = 199/499 (39.88%), Postives = 309/499 (61.92%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSEH 1657
            + ++ + DF+ K  L+Y FEE+Q +R +L+ +        +   +  + C++G ++ S G     +        C   +I K  E    ++++ ++  G  LDKKD FGKSDP+++ YR N+ G     +++EVVKNTL+P W+A    +  LC  D D  +  + +DWD   G          + IGEF+T+ R L   + +   +E++N +KKKKKK Y +SG +T+ +     +++FLDY+ GGT +NF VAID T+SNG+   PTSLHYM   + N Y++A++AV EI+Q+YD+D++FPA GFGA++PPD ++SHE+PLNG+  NP+C G+EGV++AY ++L  V+L GPT+F+PVI  V+  +   +DGS YFILLI++DG + D  +TK +++ AS LP+SII++GVG  +F +M  LD D   +      A RD VQFVP R ++    +   S+      LAK+VLAE+P Q L Y+ R +G + P+ S H
Sbjct:   72 IDNTLNPDFVHKFILDYFFEERQNLRFDLYDLDSKSENLSKHDFLGQMYCTLGEVVGSPGSRMERSLIGIPGKNCGT-VIVKAEELGNCRESVLMQFCGNKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRAIKIEVYDWDRDGGH---------DYIGEFSTSYRELSKGHTQFTVWEVLNPKKKKKKKKYLNSGTVTLLSCFIDVEVTFLDYIKGGTQINFTVAIDFTASNGNPSQPTSLHYMSPYHLNAYALALRAVGEIIQDYDSDKLFPALGFGAKLPPDGRVSHEFPLNGNPDNPYCSGIEGVLEAYYQSLKSVRLYGPTYFSPVINHVARYASLVKDGSEYFILLIISDGVISDMAQTKESIVNASSLPMSIIIVGVGPAEFDEMIELDGDEVRISSRGRFAERDIVQFVPFRDYIDRRGNHILSM----ARLAKDVLAEIPDQFLQYV-RSRG-IKPQHSAH 554          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne5b (copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398])

HSP 1 Score: 361.688 bits (927), Expect = 7.767e-117
Identity = 199/487 (40.86%), Postives = 299/487 (61.40%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEI--EIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +        +   +  + C++G I+  G   SR  E     I+ +    I+    E    +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY ++L  V+L GPT+FAPV+  V+  +   +DGS YFILLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:   68 IDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQMFCTLGEIV--GSPASRL-EKPLGGISGKNCGTIVLSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLSFSVESESTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYALALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFILLIITDGVISDMSQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 538          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne4b (copine IVb [Source:ZFIN;Acc:ZDB-GENE-060503-926])

HSP 1 Score: 358.221 bits (918), Expect = 1.481e-115
Identity = 208/523 (39.77%), Postives = 306/523 (58.51%), Query Frame = 2
Query:   98 PSKCIT----QH*EWLQVDISMIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIH----SGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH---RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQAC-RDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHY 1612
            P  C+      H +W +VD + +       ++ S    F +   ++Y FEE Q +R ELH I        E+  +  +EC++G+I+     S   L +       SIT   E      E + + D +E+      LD KD F KSDP++ I+R ND G     +R+E + N L+P WK+   SL  LC  D D EL    +DWD +NG          + IGEF TT + + SA +G+Q ++E +N + + KKKNY++SG++ +   + I   SFLDY+ GG  + F VAID T+SNGD  +  SLHY+     NEY  A+ AV EI Q+YD+D+MFPAFGFGA++PPDFK+SH++ +N D  NP C GV+GV++AY+  L +++L GPT+ AP+I++V+N + E    ++   YFILLILTDG + D  +T+ A++ AS+LP+S+I++G+G   FSDM++LD D  +LR    +   RD VQFVP R F  A+            +LAK VLAE+P QV+ Y
Sbjct:   41 PDPCVVLKMQSHGQWFEVDRTEV-------IRSSISPVFSKVFTVDYYFEEVQRLRFELHDISSNHNGLKEADFLGAMECTLGQIVSQRKLSKALLKQGNTAGKSSITVTAE------ELSGNDDYVELAFSAKKLDDKDFFSKSDPFLEIFRVNDDGTASLVHRTETIMNNLSPVWKSFKVSLNTLCSGDHDRELKCIVWDWD-SNGK--------HDFIGEFQTTFKEMKSAMDGKQIQWECINPKYQVKKKNYRNSGMVILTLCKIIKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALIAVGEICQDYDSDKMFPAFGFGAQIPPDFKVSHDFAVNFDEDNPECAGVQGVIEAYQNCLPKIQLYGPTNIAPIIQKVANSASEEMHTKEAMEYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGIGSADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASP----------AALAKSVLAEVPNQVVDY 531          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne4b (copine IVb [Source:ZFIN;Acc:ZDB-GENE-060503-926])

HSP 1 Score: 358.221 bits (918), Expect = 1.481e-115
Identity = 208/523 (39.77%), Postives = 306/523 (58.51%), Query Frame = 2
Query:   98 PSKCIT----QH*EWLQVDISMIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIH----SGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH---RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQAC-RDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHY 1612
            P  C+      H +W +VD + +       ++ S    F +   ++Y FEE Q +R ELH I        E+  +  +EC++G+I+     S   L +       SIT   E      E + + D +E+      LD KD F KSDP++ I+R ND G     +R+E + N L+P WK+   SL  LC  D D EL    +DWD +NG          + IGEF TT + + SA +G+Q ++E +N + + KKKNY++SG++ +   + I   SFLDY+ GG  + F VAID T+SNGD  +  SLHY+     NEY  A+ AV EI Q+YD+D+MFPAFGFGA++PPDFK+SH++ +N D  NP C GV+GV++AY+  L +++L GPT+ AP+I++V+N + E    ++   YFILLILTDG + D  +T+ A++ AS+LP+S+I++G+G   FSDM++LD D  +LR    +   RD VQFVP R F  A+            +LAK VLAE+P QV+ Y
Sbjct:   41 PDPCVVLKMQSHGQWFEVDRTEV-------IRSSISPVFSKVFTVDYYFEEVQRLRFELHDISSNHNGLKEADFLGAMECTLGQIVSQRKLSKALLKQGNTAGKSSITVTAE------ELSGNDDYVELAFSAKKLDDKDFFSKSDPFLEIFRVNDDGTASLVHRTETIMNNLSPVWKSFKVSLNTLCSGDHDRELKCIVWDWD-SNGK--------HDFIGEFQTTFKEMKSAMDGKQIQWECINPKYQVKKKNYRNSGMVILTLCKIIKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALIAVGEICQDYDSDKMFPAFGFGAQIPPDFKVSHDFAVNFDEDNPECAGVQGVIEAYQNCLPKIQLYGPTNIAPIIQKVANSASEEMHTKEAMEYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGIGSADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASP----------AALAKSVLAEVPNQVVDY 531          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne5b (copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398])

HSP 1 Score: 357.836 bits (917), Expect = 4.292e-115
Identity = 196/491 (39.92%), Postives = 293/491 (59.67%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESAC-----------VATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +                  +  + C++G I+ S                C   I+    E    +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY ++L  V+L GPT+FAPV+  V+  +   +DGS YFILLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:   73 IDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHKPLELYDFLGQMFCTLGEIVGSPASRLEKPLGGISGKNCGT-IVLSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLSFSVESESTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYALALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFILLIITDGVISDMSQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 549          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: acot11 (acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GENE-5864266])

HSP 1 Score: 359.377 bits (921), Expect = 8.615e-116
Identity = 205/495 (41.41%), Postives = 301/495 (60.81%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIEL------------HGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEI--EIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWD-GANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R ++            H  + G++ C      ++G +I  G   SR  E     I  +    II    E +  +D + +++    LDKKD FGKSDP+++ YR N+ G     +++EV+KNTLNP W+     +  LC  D D  +    +DWD G + D           IGEFTT+ R L     +   +E++N +KK KKK Y +SG +T+ + +  ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D++FPA+GFGA++PPD KISHE+ LNGD  NP C G++GV++AY ++L  V+L GPT+FA VI QV+  + +  DGS Y++LLI+TDG + D V+TK A++ AS LP+SII++GVG  +F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM
Sbjct:   62 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVFNVDSRSCNISKHKDFLGQAFC------TLGEVI--GSPRSRL-EKPLTGIPGKKCGTIILSAEELSNCRDIVTMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWDRGGSHD----------FIGEFTTSYRELSRGQSQFSVYEVLNPKKKCKKKKYINSGTVTLLSFKAESEYTFVDYIKGGTQLNFTVAIDFTASNGNPSQPTSLHYMNPYQLNAYGMALKAVGEIIQDYDSDKLFPAYGFGAKIPPDGKISHEFALNGDIENPNCVGIQGVLEAYFKSLRTVQLYGPTNFASVINQVARAAGDVTDGSQYYVLLIITDGVISDMVQTKEAIVNASSLPMSIIIVGVGPAEFDAMEELDGDEVRVSSRGRFAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQFLSYM 533          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: cpne9 (copine family member IX [Source:NCBI gene;Acc:100125077])

HSP 1 Score: 358.221 bits (918), Expect = 3.969e-115
Identity = 200/507 (39.45%), Postives = 299/507 (58.97%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-YFGESACVATLE------CSVGRIIHSGGE--------------------LSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + +S + DF++K  L+Y FEEKQ +R +L  I YF  +  +   +      C++G I+ S G                         +     S  C I II    E +  +D   ++   + LDKKD FGKSDP+++ YR N+ G     +++E VKNTL+P W+     +  LC  D D  +  + +DWD       D   +F   IGEF+T+ R L     +   +E++N RKK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+ FPA GFGA++PPD ++SHE+PLNG   NP C G+EG+++AY ++L  V+L GPT+FAPV+ +V+  +   +DGSHYF+LLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q++ YM
Sbjct:   57 IDNSLNPDFVRKFVLDYFFEEKQNLRFDLFAITYFDLNFSLFLFDFLGQCFCTLGEIVGSAGSRLEKSLIIGQNAPNSRSGRSTQSMSNGGIPSKKCGI-IIISAEELSNCRDIATVQFSAHKLDKKDFFGKSDPFMVFYRSNEDGTYTICHKTEYVKNTLSPVWQKFSIPVRGLCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFSTSYRELSKGQSQFNIYEVINPRKKIKKKKYINSGTVTLLSFSVESEYTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQLNAYALALKAVGEIIQDYDSDKRFPALGFGAKLPPDGRVSHEFPLNGSIENPQCNGIEGILEAYHKSLKSVQLYGPTNFAPVVNRVARFAAAVQDGSHYFVLLIITDGVISDMSQTKEAIVNAAMLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLAKDVLAEIPDQLISYM 549          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: cpne9 (copine family member IX [Source:NCBI gene;Acc:100125077])

HSP 1 Score: 355.91 bits (912), Expect = 2.842e-114
Identity = 197/505 (39.01%), Postives = 297/505 (58.81%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGE--------------------LSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + +S + DF++K  L+Y FEEKQ +R +L+ +        +   +    C++G I+ S G                         +     S  C I II    E +  +D   ++   + LDKKD FGKSDP+++ YR N+ G     +++E VKNTL+P W+     +  LC  D D  +  + +DWD       D   +F   IGEF+T+ R L     +   +E++N RKK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+ FPA GFGA++PPD ++SHE+PLNG   NP C G+EG+++AY ++L  V+L GPT+FAPV+ +V+  +   +DGSHYF+LLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q++ YM
Sbjct:   62 IDNSLNPDFVRKFVLDYFFEEKQNLRFDLYDVDAKSPDLSKHDFLGQCFCTLGEIVGSAGSRLEKSLIIGQNAPNSRSGRSTQSMSNGGIPSKKCGI-IIISAEELSNCRDIATVQFSAHKLDKKDFFGKSDPFMVFYRSNEDGTYTICHKTEYVKNTLSPVWQKFSIPVRGLCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFSTSYRELSKGQSQFNIYEVINPRKKIKKKKYINSGTVTLLSFSVESEYTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQLNAYALALKAVGEIIQDYDSDKRFPALGFGAKLPPDGRVSHEFPLNGSIENPQCNGIEGILEAYHKSLKSVQLYGPTNFAPVVNRVARFAAAVQDGSHYFVLLIITDGVISDMSQTKEAIVNAAMLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLAKDVLAEIPDQLISYM 552          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: acot11 (acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GENE-5864266])

HSP 1 Score: 349.362 bits (895), Expect = 1.298e-112
Identity = 202/483 (41.82%), Postives = 294/483 (60.87%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEI--EIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWD-GANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +    + G++ C      ++G +I  G   SR  E     I  +    II    E +  +D + +++    LDKKD FGKSDP+++ YR N+ G     +++EV+KNTLNP W+     +  LC  D D  +    +DWD G + D           IGEFTT+ R L     +   +E++N +KK KKK Y +SG +T   +   + ++FL + F  T LNF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D++FPA+GFGA++PPD KISHE+ LNGD  NP C G++GV++AY ++L  V+L GPT+FA VI QV+  + +  DGS Y++LLI+TDG + D V+TK A++ AS LP+SII++GVG  +F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM
Sbjct:   28 IDNTLNPDFVRKFVLDYFFEEKQNLRFD---DFLGQAFC------TLGEVI--GSPRSRL-EKPLTGIPGKKCGTIILSAEELSNCRDIVTMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWDRGGSHD----------FIGEFTTSYRELSRGQSQFSVYEVLNPKKKCKKKKYINSGTVT-EELDGDSAITFLSFFFSRTQLNFTVAIDFTASNGNPSQPTSLHYMNPYQLNAYGMALKAVGEIIQDYDSDKLFPAYGFGAKIPPDGKISHEFALNGDIENPNCVGIQGVLEAYFKSLRTVQLYGPTNFASVINQVARAAGDVTDGSQYYVLLIITDGVISDMVQTKEAIVNASSLPMSIIIVGVGPAEFDAMEELDGDEVRVSSRGRFAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQFLSYM 483          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: cpne3 (copine III [Source:NCBI gene;Acc:493363])

HSP 1 Score: 348.206 bits (892), Expect = 4.089e-112
Identity = 199/502 (39.64%), Postives = 295/502 (58.76%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGG-----ELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEI--KMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSAN-GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNL---SKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQAC-RDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK 1627
            ++K+  +  F QK  ++Y FE  Q ++  ++ I       G+   +   EC++G+I+ S        L         SIT   E +         KDN  I  + +   LD KD FGKSDPY+  +++ + G+    +R+EV+KN LNP W+     L+ LC  D++  +  +C+D+D         D    +LIG F TT   L  A+     +FE +N +KKKKKK Y++SG+++++  +   + SFLDY+ GG  +NF+V ID T SNGD   P SLH++  N  NEY  AI +V  ++Q+YD D+MFPAFGFGA++PP  ++SHE+P+N + SNPFC G++GV+ AYR  L QVKL GPT+F+P+I  V+     + + +  S YF+LLI+TDG + D  +T++A++ A+ LP+SII+IGVG   FS ME LD D  +LR    +A  RD VQFVP R+F +A           K +LA+ VLAE+P QV+ Y S  K
Sbjct:   12 RIKNCLNPKFSQKFLVDYYFEVVQKLKFGIYDIDNKTVDLGDDDFLGEFECTLGQIVASKNLTRPLVLKNGRPAGKGSITISAEEV---------KDNRVILFEAEARKLDNKDFFGKSDPYLEFHKQTENGRWQMVHRTEVIKNNLNPVWRPFKIPLQSLCNGDMEKPIRVECYDYD---------DDGSHDLIGIFETTMSKLQQASRSSPMEFECINEKKKKKKKGYRNSGIVSVKHCEMTKEYSFLDYIMGGCQMNFVVGIDFTGSNGDPRSPDSLHFISPNGVNEYLTAIWSVGCVIQDYDTDKMFPAFGFGAQIPPTGQVSHEFPINFNPSNPFCSGIQGVVDAYRSCLPQVKLYGPTNFSPIIHHVARFAGAATQQKTASQYFVLLIITDGVITDLDQTRQAIVNAAKLPMSIIIIGVGAADFSAMEFLDGDNGMLRSPTGEAAIRDIVQFVPFRQFAQAP----------KEALAQSVLAEVPQQVVSYFSTFK 485          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne8 (copine VIII [Source:MGI Symbol;Acc:MGI:1914121])

HSP 1 Score: 369.392 bits (947), Expect = 1.538e-119
Identity = 207/490 (42.24%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE++ +R +L+ +        +   +  + C++G I+ S G              C   II    E    +D + ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+A   S+  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    T++SFLDY+ GGT +NF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D+MFPA GFGA++PPD +ISHE+ LNG+  NP+C G+EGVM+AY  +L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D  +TK +++ AS LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   82 IDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGRKCGT-IILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYM-RARG 556          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne9 (copine family member IX [Source:MGI Symbol;Acc:MGI:2443052])

HSP 1 Score: 355.91 bits (912), Expect = 1.302e-114
Identity = 198/492 (40.24%), Postives = 301/492 (61.18%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----------YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAAS-KDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +++ +           + G++        ++G +I  GG+ SR           +   I    E+ ++ +D   +++    LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +    +DWD       D   +F   IGEFTT+ R L  A  +   +E++N RKK KKK Y +SG +T+ +    ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM     + Y++A++AV EI+Q+YD+D++FPA+GFGA++PP+ +ISH++PLN +  +P C G+EGV+++Y ++L  V+L GPT+FAPVI QV+  + +  DGS Y++LLI+TDG + D  +TK A++ AS LP+SII++GVG   F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q+L YM
Sbjct:   59 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFL------ALGEVI--GGQGSRVERPLTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD------RDGSHDF---IGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYM 529          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne1 (copine I [Source:MGI Symbol;Acc:MGI:2386621])

HSP 1 Score: 346.665 bits (888), Expect = 3.103e-111
Identity = 206/507 (40.63%), Postives = 296/507 (58.38%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAAS----------KDNLEIKMQ--GYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQV---SNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            +V++    +F + LQ+EY FE  Q +R  ++ I       G+   +   ECS+G+I+               S T  + ++ K  + A            KD+  + M+     LDKKD  GKSDP++  +R+ D GK    YR+EVVKN LNP WK    SL+  CG DL   +  +C D+D         D   D LIG F TT   L +   E   FE V+  K+++KKNY++SG + ++T +  T+ SFLDY+ GG  +NF V +D T SNGD   P SLHY+     NEY  A+ +V  ++Q+YD+D++FPAFGFGA+VPPD+++SHE+ LN + SNP+C G++G++ AYR+AL QV+L GPT+FAP+I  V   +  + + R  S YF+LL+LTDG+V D   T +AV++AS LP+S+I++GVGG  F  ME LD D   LR    + A RD VQFVP RRF  A  +          +LA+ VLAE+P Q++ Y  R +G
Sbjct:   48 RVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV--------------SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGD-GKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDS--------DGSHD-LIGTFHTTLAQLQAVPAE---FECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVMEQLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRE----------TLAQTVLAEVPTQMVSYF-RAQG 516          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne1 (copine I [Source:MGI Symbol;Acc:MGI:2386621])

HSP 1 Score: 346.665 bits (888), Expect = 3.103e-111
Identity = 206/507 (40.63%), Postives = 296/507 (58.38%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAAS----------KDNLEIKMQ--GYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQV---SNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            +V++    +F + LQ+EY FE  Q +R  ++ I       G+   +   ECS+G+I+               S T  + ++ K  + A            KD+  + M+     LDKKD  GKSDP++  +R+ D GK    YR+EVVKN LNP WK    SL+  CG DL   +  +C D+D         D   D LIG F TT   L +   E   FE V+  K+++KKNY++SG + ++T +  T+ SFLDY+ GG  +NF V +D T SNGD   P SLHY+     NEY  A+ +V  ++Q+YD+D++FPAFGFGA+VPPD+++SHE+ LN + SNP+C G++G++ AYR+AL QV+L GPT+FAP+I  V   +  + + R  S YF+LL+LTDG+V D   T +AV++AS LP+S+I++GVGG  F  ME LD D   LR    + A RD VQFVP RRF  A  +          +LA+ VLAE+P Q++ Y  R +G
Sbjct:   48 RVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV--------------SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGD-GKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDS--------DGSHD-LIGTFHTTLAQLQAVPAE---FECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVMEQLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRE----------TLAQTVLAEVPTQMVSYF-RAQG 516          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne5 (copine V [Source:MGI Symbol;Acc:MGI:2385908])

HSP 1 Score: 340.887 bits (873), Expect = 2.582e-108
Identity = 193/505 (38.22%), Postives = 295/505 (58.42%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGE------------LSRFTEWCWKSIT--------CEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  ++Y FEEKQ +R +L+ +        +   +    C++G I+ S G             L+  T     +++        C   II    E +  +D   ++     LDKKD FGKSDP+++ YR N+ G     +++EV+KNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E++N +KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM     N Y++A+ AV EI+Q YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP C G++G+++AY  +L  V+L GPT+FAPV+  V+  +   +DGS Y +LLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LA++VLAE+P Q++ YM
Sbjct:   68 IDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSSGSRLEKPLTIGTFSLNSRTGKPMPAVSNGGVPGKKCGT-IILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNIYEVINPKKKMKKKKYVNSGTVTLLSFAVESESTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHSSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLARDVLAEIPDQLVSYM 558          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q86YQ8|CPNE8_HUMAN (Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8 PE=1 SV=2)

HSP 1 Score: 369.007 bits (946), Expect = 9.786e-119
Identity = 207/490 (42.24%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE++ +R +L+ +        +   +  + C++G I+ S G              C   II    E    +D + ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+A   S+  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    T++SFLDY+ GGT +NF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D+MFPA GFGA++PPD +ISHE+ LNG+  NP+C G+EGVM+AY  +L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D  +TK +++ AS LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   69 IDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGKKCGT-IILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYM-RARG 543          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q9DC53|CPNE8_MOUSE (Copine-8 OS=Mus musculus OX=10090 GN=Cpne8 PE=2 SV=3)

HSP 1 Score: 369.392 bits (947), Expect = 1.076e-118
Identity = 207/490 (42.24%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE++ +R +L+ +        +   +  + C++G I+ S G              C   II    E    +D + ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+A   S+  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    T++SFLDY+ GGT +NF VAID T+SNG+   PTSLHYM+    N Y +A++AV EI+Q+YD+D+MFPA GFGA++PPD +ISHE+ LNG+  NP+C G+EGVM+AY  +L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D  +TK +++ AS LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   82 IDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGRKCGT-IILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYM-RARG 556          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q5BJS7|CPNE9_RAT (Copine-9 OS=Rattus norvegicus OX=10116 GN=Cpne9 PE=2 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 7.273e-114
Identity = 198/492 (40.24%), Postives = 301/492 (61.18%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----------YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAAS-KDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +++ +           + G++        ++G +I  GG+ SR           +   I    E+ ++ +D   +++    LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +    +DWD       D   +F   IGEFTT+ R L  A  +   +E++N RKK KKK Y +SG +T+ +    ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM     + Y++A++AV EI+Q+YD+D++FPA+GFGA++PP+ +ISH++PLN +  +P C G+EGV+++Y ++L  V+L GPT+FAPVI QV+  + +  DGS Y++LLI+TDG + D  +TK A++ AS LP+SII++GVG   F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q+L YM
Sbjct:   59 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFL------ALGEVI--GGQGSRVERPLTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD------RDGSHDF---IGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYM 529          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q1RLL3|CPNE9_MOUSE (Copine-9 OS=Mus musculus OX=10090 GN=Cpne9 PE=1 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 8.181e-114
Identity = 198/492 (40.24%), Postives = 301/492 (61.18%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----------YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAAS-KDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +++ +           + G++        ++G +I  GG+ SR           +   I    E+ ++ +D   +++    LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +    +DWD       D   +F   IGEFTT+ R L  A  +   +E++N RKK KKK Y +SG +T+ +    ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM     + Y++A++AV EI+Q+YD+D++FPA+GFGA++PP+ +ISH++PLN +  +P C G+EGV+++Y ++L  V+L GPT+FAPVI QV+  + +  DGS Y++LLI+TDG + D  +TK A++ AS LP+SII++GVG   F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q+L YM
Sbjct:   59 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFL------ALGEVI--GGQGSRVERPLTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD------RDGSHDF---IGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYM 529          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q8IYJ1|CPNE9_HUMAN (Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3)

HSP 1 Score: 355.91 bits (912), Expect = 8.358e-114
Identity = 197/491 (40.12%), Postives = 297/491 (60.49%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----------YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +++ +           + G++        ++G +I   G     T        C   I+    E +  +D   +++    LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +    +DWD       D   +F   IGEFTT+ R L  A  +   +E++N RKK KKK Y +SG +T+ +    ++ +F+DY+ GGT LNF VAID T+SNG+   PTSLHYM     + Y++A++AV EI+Q+YD+D++FPA+GFGA++PP+ +ISH++PLN +  +P C G+EGV+++Y ++L  V+L GPT+FAPVI QV+  + +  DGS Y++LLI+TDG + D  +TK A++ AS LP+SII++GVG   F  ME LD D   +      A RD VQFVP R ++    D S +   +   LAK+VLAE+P Q+L YM
Sbjct:   59 IDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFL------ALGEVIGGQGSRVERTLTGVPGKKCGT-ILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD------RDGSHDF---IGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYM 529          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267G9Y0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017750g6 PE=4 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 279/486 (57.41%), Postives = 359/486 (73.87%), Query Frame = 2
Query:  212 LQLEYIFEEKQIIRIELHGIYFGESA------CVATLECSVGRIIHSGGELSRFTEWCWKS-ITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRR 1648
            L   Y FEE+Q+I +E+H      S+       + +   S+G +IHSGG L    + C  S   C I     V E A +K+N+ +K+ G GLDKKD+FGKSDPY+II +RNDKG+L+R YR+EV+KNTL+PDWK +  S++RLCG DL  E+ F+C+DWDGA GD ED D EFDE IGEF TT + L S +G +  FEL+N RK KKKKNY++SG +T +TI    D SFLDYMF GTDL F VAID+T+SNG    PTSLHY D    N+Y++A+QAVLEI+Q+YD+D++ PAFGFG R PPD+++SHE+PLNGD +NPFC+G  GV++AYR  L +V+LSGPTHFAPVI+ VS L+  H+DGS Y++LLILTDG++DDW E KRAVIEASYLPVSIIV+G+G   F++ME+LDQD  LL  G  +ACRD VQFV +R++LR AADGSD +RW+KV+LAK+VL ELP Q+L YM R +  L P R
Sbjct:   84 LITSYKFEERQMIELEIHCAMDDHSSRAASRKVIGSCTVSLGHLIHSGGSLD--CQLCSSSPAVCTIH----VEEYAGNKENMLLKLNGRGLDKKDLFGKSDPYMIIDKRNDKGRLVRAYRTEVIKNTLDPDWKPIKVSVDRLCGGDLRREIRFRCYDWDGAEGDHEDKDIEFDEFIGEFATTPKELFSNDGREVTFELINPRKAKKKKNYRNSGTVTAKTIPIDADFSFLDYMFSGTDLCFTVAIDMTASNGSPSQPTSLHYTDPFTPNQYTIAMQAVLEIIQDYDSDQLLPAFGFGCRAPPDYRVSHEWPLNGDSANPFCQGAAGVLEAYRHCLEEVRLSGPTHFAPVIKHVSRLALNHQDGSRYYVLLILTDGTIDDWTECKRAVIEASYLPVSIIVVGIGSGNFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRVAADGSDGVRWSKVALAKDVLQELPSQILEYMRRRR--LKPNR 561          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267FGY6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017750g2 PE=4 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 277/486 (57.00%), Postives = 358/486 (73.66%), Query Frame = 2
Query:  212 LQLEYIFEEKQIIRIELHGIYFGESA------CVATLECSVGRIIHSGGELSRFTEWCWKS-ITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRR 1648
            L   Y FEE+Q+I +E+H      S+       + +   S+G +IHSGG L    + C  S   C I     V E A +K+N+ +K+ G GLDKKD+FGKSDPY+II +RNDKG+L+R YR+EV+KNTL+PDWK +  S++RLCG +   E+ F+C+DWDGA GD ED D EFDE IGEF TT + L S +G +  FEL+N RK KKKKNY++SG +T +TI    D SFLDYMF GTDL F VAID+T+SNG    PTSLHY D    N+Y++A+QAVLEI+Q+YD+D++ PAFGFG R PPD+++SHE+PLNGD +NPFC+G  GV++AYR  L +V+LSGPTHFAPVI+ VS L+  H+DGS Y++LLILTDG++DDW E KRAVIEASYLPVSIIV+G+G   F++ME+LDQD  LL  G  +ACRD VQFV +R++LR AADGSD +RW+KV+LAK+VL ELP Q+L YM R +  L P R
Sbjct:   84 LITSYKFEERQMIELEIHCAMDDHSSRAASRKVIGSCTVSLGHLIHSGGSLD--CQLCSSSPAVCTIH----VEEYAGNKENMLLKLNGRGLDKKDLFGKSDPYMIIDKRNDKGRLVRAYRTEVIKNTLDPDWKPIKVSVDRLCGGEFRREIRFRCYDWDGAEGDHEDKDIEFDEFIGEFATTPKELFSNDGREVTFELINPRKAKKKKNYRNSGTVTAKTIPIDADFSFLDYMFSGTDLCFTVAIDMTASNGSPSQPTSLHYTDPFTPNQYTIAMQAVLEIIQDYDSDQLLPAFGFGCRAPPDYRVSHEWPLNGDSANPFCQGAAGVLEAYRHCLEEVRLSGPTHFAPVIKHVSRLALNHQDGSRYYVLLILTDGTIDDWTECKRAVIEASYLPVSIIVVGIGSGNFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRVAADGSDGVRWSKVALAKDVLQELPSQILEYMRRRR--LKPNR 561          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267EEV5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028315g1 PE=4 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 262/444 (59.01%), Postives = 343/444 (77.25%), Query Frame = 2
Query:  311 SVGRIIHSGGELS-----RFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK 1627
            S+G +IH GG L+       +  C +   C    I+ V E   +K+N+ +K+ G GLDKKD FGKSDPY+II +RNDKG+L+RTYR+EV+KNTL+PDWK +  SL+RLCG D   E+ F+C+DWDGA GDPED D EFDE IGEF+TT + L S  G + +F+LVN RK KKKK+Y++SG+I+++T+   +D SFLDYMFGGTDL F VAID+T+SNG    PTSLHY D    N+Y++A+QAVLEI+Q+YD D++ PAFGFG RVPP++K+SHE+PLNG+  NPFC+G  GV+ AYR  L +V+LSGPT+FAPVIR VS L+ EH+DGS Y++LLILTDG++DDW E KRAVIEAS+LPVSIIV+G+G   F++ME+LDQD  LL  G  +ACRD VQFV +R++LR AADG+D +RW+KV+LAK+VL ELP Q++ YM R +
Sbjct:  259 SLGHLIHCGGRLTCPLTNSRSGQCLEYARC----IFHVEEYRGNKENIMLKLSGRGLDKKDFFGKSDPYLIIEKRNDKGRLVRTYRTEVIKNTLDPDWKPIKVSLDRLCGGDFRREIKFRCYDWDGAEGDPEDKDIEFDEFIGEFSTTPKDLFSCEGSELQFDLVNPRKAKKKKHYRNSGVISLKTVAMDSDHSFLDYMFGGTDLCFTVAIDMTASNGSPSQPTSLHYTDPFTPNQYTIAMQAVLEIIQDYDTDQLLPAFGFGCRVPPEYKVSHEWPLNGNSENPFCQGASGVLDAYRRCLEEVRLSGPTNFAPVIRHVSRLAVEHQDGSRYYVLLILTDGTIDDWTECKRAVIEASFLPVSIIVVGIGNGDFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRPAADGTDGVRWSKVALAKDVLQELPTQIMEYMRRRR 698          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267ER93 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028292g1 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 276/490 (56.33%), Postives = 365/490 (74.49%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHG----IYFGESACVATLECSVGRIIHSGGELSRFTEWCWKS--ITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK 1627
            V+ S    F   L   Y FEE+Q++ +E++     +  GE   + T   S+G +IH+GG++    +    S   +   + ++ V E   +K+ L +K+ G GLDKKD+FGKSDPYVII +RNDKG+L+R YR+EV+KNTL+PDWK V  S+++LCG D   E+ F+CFDWDGA GDPED D EFDELIGEF TT   LL  +G +  F+LVN RK+KKKKNY++SG+I ++ I   +  SFLDYMFGGTDL F VAID+T+SNG+   PTSLHY D    N+Y++A+QAVLEI+Q+YD+D++ PAFGFG RVPPD+++SHE+PLNGD +NPFC G  GVM+AYR+ L +V+ SGPTHFAPVIR VS L+  H+DGS Y++LLILTDG++DDW + KRAVIEASYLPVSIIVIG+G   F++ME+LDQD  LL  G  +ACRD VQFV +R++LR AADG++S+RW+KV+LAK+VL ELP Q++ YM R K
Sbjct:   54 VERSSSPAFRTPLLAVYKFEERQMVELEVYSAQEEVRHGERRVIGTCSVSLGHVIHNGGQIVAQLDSGAGSGANSGRAKCLFHVEEYGGNKETLMLKLSGRGLDKKDLFGKSDPYVIIEKRNDKGRLVRAYRTEVIKNTLDPDWKPVKVSMDKLCGGDFGREIRFRCFDWDGAEGDPEDKDIEFDELIGEFFTTPSDLL--DGREICFDLVNPRKQKKKKNYKNSGVINLKVISVDSQGSFLDYMFGGTDLCFTVAIDMTASNGNPSQPTSLHYTDPFTPNQYTIAMQAVLEIVQDYDSDQLLPAFGFGCRVPPDYRVSHEWPLNGDSNNPFCHGAGGVMEAYRQCLDEVRPSGPTHFAPVIRHVSRLAVGHQDGSRYYVLLILTDGTIDDWTDCKRAVIEASYLPVSIIVIGIGNGNFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRQAADGTESVRWSKVALAKDVLQELPSQIMEYMRRRK 541          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267H4K5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029885g1 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 262/444 (59.01%), Postives = 342/444 (77.03%), Query Frame = 2
Query:  311 SVGRIIHSGGELS-----RFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK 1627
            S+G +IH GG L+       +  C +   C    I+ V E   +K+N+ +K+ G GLDKKD FGKSDPYVII +RNDKG+L+RTYR+EV+KNTL+PDWK +  SL+RLCG D   E+ F+C+DWDGA GDPED D EFDE IGEF+TT + L S    + +F+LVN RK KKKK+Y++SG+I+++T+   +D SFLDYMFGGTDL F VAID+T+SNG    PTSLHY D    N+Y++A+QAVLEI+Q+YD D++ PAFGFG RVPP++K+SHE+PLNG+  NPFC+G  GV+ AYR  L +V+LSGPT+FAPVIR VS L+ EH+DGS Y++LLILTDG++DDW E KRAVIEAS+LPVSIIV+G+G   F++ME+LDQD  LL  G  +ACRD VQFV +R++LR AADG+D +RW+KV+LAK+VL ELP Q++ YM R +
Sbjct:  195 SLGHLIHCGGRLTCPLTNSRSGQCLEYARC----IFHVEEYRGNKENIMLKLSGRGLDKKDFFGKSDPYVIIEKRNDKGRLVRTYRTEVIKNTLDPDWKPIKVSLDRLCGGDFRREIKFRCYDWDGAEGDPEDKDIEFDEFIGEFSTTPKDLFSCEASELQFDLVNPRKAKKKKHYRNSGVISLKTVAMDSDHSFLDYMFGGTDLCFTVAIDMTASNGSPSQPTSLHYTDPFTPNQYTIAMQAVLEIIQDYDTDQLLPAFGFGCRVPPEYKVSHEWPLNGNSENPFCQGASGVLDAYRRCLEEVRLSGPTNFAPVIRHVSRLAVEHQDGSRYYVLLILTDGTIDDWTECKRAVIEASFLPVSIIVVGIGNGDFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRPAADGTDGVRWSKVALAKDVLQELPTQIMEYMRRRR 634          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne5b (copine-5 [Source:NCBI gene;Acc:103046149])

HSP 1 Score: 362.073 bits (928), Expect = 5.299e-117
Identity = 197/487 (40.45%), Postives = 297/487 (60.99%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCW--KSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +        +   +  + C++G I+  G   SR  +         C   II    E    +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W++    +  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY ++L  V+L GPT+FAPV+  V+  +   +DGS YF+LLI+TDG + D  +TK A++  + LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:   73 IDNTLNPDFVRKFILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQMFCTLGEIV--GSPASRLDKPLGGIPGKKCGT-IILSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQSFTIPVRALCNGDFDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLSFSVESEFTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMSQTKEAIVNGAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 543          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne5b (copine-5 [Source:NCBI gene;Acc:103046149])

HSP 1 Score: 360.918 bits (925), Expect = 2.055e-116
Identity = 199/492 (40.45%), Postives = 298/492 (60.57%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-------YFGESAC---VATLECSVGRIIHSGGELSRFTEWCW--KSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +           S C   +  + C++G I+  G   SR  +         C   II    E    +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W++    +  LC  D D  +  + +DWD       D   +F   IGEFTT+ R L     +   +E+VN +KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY ++L  V+L GPT+FAPV+  V+  +   +DGS YF+LLI+TDG + D  +TK A++  + LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:   73 IDNTLNPDFVRKFILDYFFEEKQNLRFDLYDVDSKSPDLSKHPSECNDFLGQMFCTLGEIV--GSPASRLDKPLGGIPGKKCGT-IILSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQSFTIPVRALCNGDFDRTIKVEVYDWD------RDGSHDF---IGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLSFSVESEFTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMSQTKEAIVNGAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 548          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne4a (copine-4-like [Source:NCBI gene;Acc:111188392])

HSP 1 Score: 357.066 bits (915), Expect = 3.699e-115
Identity = 213/522 (40.80%), Postives = 306/522 (58.62%), Query Frame = 2
Query:   98 PSKCIT----QH*EWLQVDISMIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDN-LEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKC--FDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH---RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQAC-RDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHY 1612
            P  C+      H +WL+VD + +       ++   +  F +   L+Y FEE Q +R EL+ +        E+ C+  +EC++G+I+ S  +L R      +S T     I    E+    D+ +E+      LD KD F KSDP++ IYR ND G     YR+E V N LNP WK    SL  LC  D   E I KC  +DWD +NG          + IGEF  T + +  A +G+Q ++E +N + K KKKNY++SG++ +   + I   SFLDY+ GG  + F VAID T+SNGD  +  SLHY+     NEY  A+ AV EI Q+YD+D+MFPA GFGAR+PPDFK+SH++ +N +  NP C G++GV++AY+  L +++L GPT+ AP+I++V+N + E    R+   YFILLILTDG + D  +T+ A++ AS+LP+SII++GVG   F+DM+ILD D  +LR    +   RD VQFVP R F  A+            +LAK VLAE+P QV+ Y
Sbjct:   41 PDPCVIIKMQSHGQWLEVDRTEV-------IRSCCNPTFSKVFTLDYYFEEVQRLRYELYDMNSSHNGMREADCLGAVECTLGQIV-SQRKLCR--ALLKQSNTVGKSTITITAEELTGNDDYVELSFSARKLDDKDFFSKSDPFLEIYRVNDDGTQQLVYRTETVMNNLNPVWKTFKTSLNCLCSGDH--ERILKCTVWDWD-SNGK--------HDFIGEFEATFKEMRGAIDGKQVQWECINPKYKTKKKNYRNSGIVILNQCKIIKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDSDKMFPALGFGARIPPDFKVSHDFAVNFNDDNPECAGIQGVVEAYQNCLPKIQLYGPTNIAPIIQKVANSASEEEHTREAMQYFILLILTDGVITDMADTREAIVHASHLPMSIIIVGVGNADFTDMQILDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASP----------AALAKSVLAEVPSQVVDY 531          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne4b (copine-4 [Source:NCBI gene;Acc:103033161])

HSP 1 Score: 355.91 bits (912), Expect = 1.064e-114
Identity = 206/524 (39.31%), Postives = 305/524 (58.21%), Query Frame = 2
Query:   98 PSKCIT----QH*EWLQVDISMIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIH----SGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA--NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH---RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQAC-RDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHY 1612
            P  C+      H +W +VD + +       ++ S    F +   ++Y FEE Q +R ELH I        E+  + ++EC++G+I+     S   L +       SIT   E      E + + D +E+      LD KD F KSDP++ I+R ND G     +R+E + N LNP WK+   S   LC  D + EL    FDWD +NG          + IGEF TT + + +A   G+Q ++E +N + + KKKNY++SG++ +   + I   SFLDY+ GG  + F VAID T+SNGD  +  SLHY+     NEY  A+ AV EI Q+YD+D+MFPAFGFGA++PPDFK+SH++ +N D  NP C G++GV++AY+  L +++L GPT+ AP+I++V+N + E    ++   YFILLILTDG + D  +T+ A++ AS+LP+S+I++G+G   FSDM++LD D  +LR    +   RD VQFVP R F  A+            +LAK VLAE+P QV+ Y
Sbjct:   41 PDPCVVLKMQSHGQWFEVDRTEV-------IRSSISPVFSKVFTVDYYFEEVQRLRFELHDISSNHNGLKEADFLGSMECTLGQIVSQRKLSKALLKQGNTSGKSSITVTAE------ELSGNHDYVELAFSAKKLDDKDFFSKSDPFLEIFRVNDDGTGSLVHRTETIMNNLNPVWKSFKVSQNTLCSGDEERELKCTVFDWD-SNGK--------HDFIGEFQTTFKEMKAAMMEGKQIQWECINPKYQVKKKNYRNSGVVMMTQCKIIKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQDYDSDKMFPAFGFGAQIPPDFKVSHDFAVNFDEDNPECAGIQGVVEAYQNCLPKIQLYGPTNIAPIIQKVANSASEEMHIKEAMEYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGIGSADFSDMQMLDGDDGILRSPKGEPVLRDIVQFVPFRNFKHASP----------AALAKSVLAEVPNQVVDY 532          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne3 (copine 3 [Source:NCBI gene;Acc:103047700])

HSP 1 Score: 352.829 bits (904), Expect = 7.472e-114
Identity = 211/502 (42.03%), Postives = 310/502 (61.75%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELH-----GIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDN--LEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSAN-GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKE---HRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQ-ACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGP 1642
            +VK+  +  F +KL ++Y FE  Q ++  L+      I  G+   +  +ECS+G+I+ S G+L+R      K    +  I     E    KDN  +  + +   LD KD FGKSDPY+  YR+ + G  +  +R+EVVKN LNP W+     L+ LCG DL+  +  +C+D+D              +LIG F T  + L  A+     +F+ +NS+KK+KKKNY++SG+++ +  Q + + +FLDY+ GG  +NF V +D T SNGD   P SLHY+  N  NEY  AI +V  ++Q+YD+D+MFPAFGFGA++PP +++SHE+PLN + SNPFC GVEG+++AYR+ L QVKL GPT+F+P+IR VS  ++E       S Y++LLI+TDG + D  +T+ A++ AS LP+SII++GVGG  F+DMEILD D   LR  + + A RD VQFVP R+F  A+ +          +LA+ VLAELP Q++ Y  R+K    P
Sbjct:   50 RVKNCLNPKFAKKLVIDYHFEIVQKLKFGLYDIDNKTIDLGDDDFLGEMECSLGQIV-SSGKLTRPLILKNKRPAGKSTITISAEE---IKDNRVVNFEAEARKLDNKDFFGKSDPYLEFYRQTESGWQL-AHRTEVVKNNLNPCWRPFKIPLQSLCGGDLEKPIKVECYDYDNDGSH---------DLIGIFETNMKRLQEASRTSPAEFDCINSKKKQKKKNYKNSGVVSFKLCQVVKEYTFLDYIMGGCQINFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLSAIWSVGLVVQDYDSDKMFPAFGFGAQIPPQWQVSHEFPLNFNPSNPFCSGVEGMVEAYRQCLPQVKLYGPTNFSPIIRHVSRFAQEALQQNSASQYYVLLIITDGVITDMDQTRAAIVAASNLPMSIIIVGVGGADFTDMEILDGDDGRLRSPSGELAVRDIVQFVPFRKFQNASRE----------ALAQCVLAELPQQLVTYF-RYKKLQPP 526          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 328.946 bits (842), Expect = 4.065e-105
Identity = 200/517 (38.68%), Postives = 303/517 (58.61%), Query Frame = 2
Query:  128 WLQVDISMIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATL--ECSVGRIIHSGGELSRFTEWCWKSITCEIEI----------IYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANG--EQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKE---HRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVS---LAKEVLAELPVQVLHYM 1615
            +++ D   +++     +K++   DF +KL +EY FEE Q ++  L    F E A  A L     +G I  + G++        +++T  + +          I    E+      + + M G  LDK D+FGKSDPY+ IY+++  G  +  +R+EVV+NTL+P WK     L+ LC  DL+  +   C+DWD  +G P+        LIGEF      L  A G  E  +FE +N++KK+KKK+Y++SG+I  ++ +   D +FLDY+FGG  L+F V ID T+SNG+  D +SLHY+     N+Y  AI AV +I+Q+YD D++FPA GFGA++PPD K+ H++ LN + SNPFC G+EG++ AY   L  ++L GPT+F+P+I  V++ +         S Y++LLI+TDG + D   T+ A+++AS LP+S+I++GVG   F  ME+LD D ++L     + A RD VQFVP R+F        D +  NK +   LAK VLAELP QV+ Y 
Sbjct:   46 FIECDKQWMEVARTETIKNTLCPDFSRKLVMEYRFEEVQKLKFAL----FDEDAPSAKLVDHDFLGEITSTLGQIVSH-----RTLTRPLLMQDDRPAGRGTITISAEEITDNRIITLSMAGRKLDKMDLFGKSDPYLEIYKQSPDGTWMLVHRTEVVRNTLDPTWKPFTLHLQVLCNGDLEKNINAVCYDWD-RHGSPD--------LIGEFYANIIRLKEATGSMEVVEFECINNKKKQKKKSYKNSGIIICKSCKISRDYTFLDYIFGGCQLHFTVGIDFTASNGNPRDASSLHYISPTGMNDYLAAIWAVGQIIQDYDTDKLFPALGFGAQLPPDCKVHHDFALNFNPSNPFCTGIEGIVAAYHFCLQNIRLYGPTNFSPIINHVASFAHTASGSASASEYYVLLIITDGVISDMEATREAIVKASRLPMSVIIVGVGNADFEAMEVLDSDDRVLTAPSGEAATRDIVQFVPFRQFRSV-----DRLLINKAAKEELAKSVLAELPGQVVQYF 539          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007777.1 (pep scaffold:Pmarinus_7.0:GL477373:3581:22444:1 gene:ENSPMAG00000006999.1 transcript:ENSPMAT00000007777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.404 bits (703), Expect = 6.615e-85
Identity = 168/466 (36.05%), Postives = 272/466 (58.37%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDN--LEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTS--SNGDVE--DPTSLH----YMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNL---SKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRF 1513
            ++++ ++  F ++LQ++Y FE+ Q +R  ++ I        +   +  LEC++ +++ S  +++R           + +I     E    KDN  L +++    LDKKD+FGKSDPY+  ++  D G     +R+EV+KN LNP W+     L+ LC  DL+ ++   C+D+D              +LIGEF T  + L  A   Q +F +++  KKKKKKNY+ SGL+ +++ +T  + SFLDY+ GG  +NF V   L S  + GD+   +  +LH     + +NN      A+ +   I   +  D++FPAFGFGA++PP++++SHE+PLN + +NP+C GV+G++  Y+  L QV+L GPT+F+P+I  V+     + +    + YF+LLI+TDG + D  ET+ AV++AS LP+S+I++GVG   FS ME LD D  +L+    + A RD VQFVP R F
Sbjct:   80 QIQNCQEPAFSKRLQIDYCFEQVQKLRFGVYDIDNKTYDLTDDDFLGQLECNLAQVV-SSKKMTRPLLLKNGKPAGKGQITIVADE---IKDNRVLALQVDARNLDKKDMFGKSDPYLEFFKMADDGTWQMVHRTEVIKNNLNPTWRPFSIPLQALCNGDLERDVRVVCYDYDSDGSH---------DLIGEFKTNVKNLQQAEKGQVEFAVIHPEKKKKKKNYKGSGLVIVKSCRTEVEYSFLDYIMGGCQINFTVRSALRSCLTLGDIHRINLLTLHIPWPLLPLNN------ALSSFNGIKSHHLQDKLFPAFGFGAQIPPNWQVSHEFPLNFNPANPYCNGVQGIVDMYKVCLPQVRLYGPTNFSPIINHVARFAAAALQQPAATQYFVLLIVTDGVISDMDETRLAVVQASRLPMSLIIVGVGNADFSAMEFLDGDGGVLKAPSGEPAARDIVQFVPFRDF 526          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000748.1 (pep scaffold:Pmarinus_7.0:GL477446:179420:193439:1 gene:ENSPMAG00000000673.1 transcript:ENSPMAT00000000748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.284 bits (630), Expect = 4.860e-76
Identity = 149/397 (37.53%), Postives = 217/397 (54.66%), Query Frame = 2
Query:  473 KDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWD-GANGDPEDMDTEFDELIGEFTTTTRYLLSAN-GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSK----EHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGP 1642
            +D FGKSDP++ +Y++   GK    YR+EV KNTLNP WK +V +L+ LC  ++   +   C DW+     +P          IGE   T   L  A       F+LV      K  NY++SG + +         +FLDY+ GG  L F +AID T+SN       SLH+   N+ N+Y + I+AV   LQ YD D+ FPA+GFGA++P + K+S ++PL  + +NP C GV+ ++KAY+  L +VKLS P + APVI +V+  +K    + +    Y IL I+TDG V D   T+ A+++AS LP+SI+++GVG   F D+  LD D  +L     + A RD VQFVP   F R   +             ++V+ E+P QV  Y   H+  L P
Sbjct:    1 QDWFGKSDPFLELYKQTSIGKWKLVYRTEVHKNTLNPRWKNIVLNLQSLCDGNIAKPIKVVCADWNRNGRSNP----------IGECIVTVMQLNQAKLNNTVMFDLV-LPGNVKNSNYKNSGQLVVVLCTICRQYTFLDYIRGGCKLQFSMAIDFTASNKPPSQLDSLHHTGFNDANQYLMVIRAVGGTLQYYDADKQFPAYGFGAQLPSEEKVSQDFPLTLNANNPNCDGVQALIKAYKSCLTKVKLSEPANLAPVINRVATAAKRIKFQSKLAHEYHILFIITDGEVKDMPATREAIVQASKLPLSIVLVGVGSNDFRDLVELDSDDAILTAPSGENAFRDIVQFVPYLDFARDPVE----------KFLEQVMEEIPHQVEQYF--HQMDLQP 374          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 213.386 bits (542), Expect = 5.604e-65
Identity = 110/238 (46.22%), Postives = 157/238 (65.97%), Query Frame = 2
Query:  920 VAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQV---SNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRV-GNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSR 1621
            V I  ++SNGD  DP+SLH++    TNEY  A+ AV +++Q+YD D+ FPA GFGA++PP++++SHE+ LN +  NPFC GVEG+++AY   L QV+L GPT+F+P+I  V   +  + +    + YF+LLI+TDG + D  ET+ AV++AS LP+S+I++GVG   FS ME LD D  +L+    + A RD VQFVP R F  A           K +LAK VLAE+P QV+ Y  +
Sbjct:    1 VGIHFSASNGDPRDPSSLHHISPTGTNEYLAAVWAVGQVIQDYDADKQFPALGFGAQLPPEWEVSHEFALNFNPLNPFCTGVEGIVQAYMACLPQVRLYGPTNFSPIINHVARFAAAAAQQPAATQYFVLLIVTDGVISDMDETRLAVVQASRLPMSLIIVGVGSADFSAMEFLDGDGGVLKAPSGEPAARDIVQFVPFRDFRNAP----------KEALAKAVLAEVPGQVVTYFKQ 228          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 101.293 bits (251), Expect = 2.901e-24
Identity = 63/197 (31.98%), Postives = 102/197 (51.78%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA-NGEQ 772
            F  K Q++Y FEE Q +R  ++ +        +   +  L  ++G+++ S  +LSR              II  + E+     +L++  +G  LDKKD FGKSDPY+  +++ D G  +  +R+EVV NTLNP W+    +++ LCG DLD  +   C+D+D   G          + IGEF T+   +L A +G+Q
Sbjct:   58 FAHKFQIDYHFEEVQKLRFAIYDLDSPSKRLQDHDFLGDLTLTLGQVV-SSKKLSR-ALVLKDGRPAGKGIIQVLAEEMKDNRHLQLLFEGIKLDKKDFFGKSDPYLEFFKKGDDGSWVLVHRTEVVLNTLNPSWRPFTLAVQSLCGGDLDRSVRVTCYDYDSDGG---------HDFIGEFQTSVTQMLEAQSGKQ 243          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO44352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW53])

HSP 1 Score: 349.362 bits (895), Expect = 5.310e-113
Identity = 205/498 (41.16%), Postives = 300/498 (60.24%), Query Frame = 2
Query:  197 DFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRII-HSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKE---HRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFL-RAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK---GALGPRRS 1651
            DF++K  + Y FEE Q +R +++ I        +   +  +EC++G I+  +GG+L        K++ CE        E +  KD   ++ +G+ LDKKD FGKSDP+++ YR N+       +R+EVVKNTLNP WK        LC  D+D  +  +C+DWD         D   D LIG F+TT R L S       FEL N +K+ KKK+Y++SG I +   +     +FLD++ GGT ++FIVAID T+SNG+ ++  SLH+++    N+Y  A+ +V  I Q+YD+D++FPAFGFGAR+PP++++SHE+ LNG+  NPFC+ VEGV+ +Y  ++ +V+L GPT+F+P+IR+   L+KE    + G  YF+LLILTDG + D  +TK A+++A+ LPVSII++GVGG  F  ME LD D   L      A RD VQFVP R +L +   D +   R     LAK+VL ELP Q+  YM +      +  P RS
Sbjct:   64 DFVKKFTIHYFFEEIQKLRFQVYDIDKKSSRLQDHDFIGEIECTLGSIVGENGGQLE-------KALLCE--------EVSQCKDVATLQFRGHKLDKKDFFGKSDPFLVFYRCNEDNSFTAVHRTEVVKNTLNPTWKPFSVPARALCNGDIDRSIRIECYDWD--------RDGSHD-LIGIFSTTLRELTS--NPNLTFELKNPKKQAKKKSYKNSGTIILLQSKLEQQPTFLDFIKGGTQISFIVAIDFTASNGNPQNSNSLHFLNPYEPNQYVKALTSVGAICQDYDSDKLFPAFGFGARLPPNWEVSHEFALNGNPQNPFCERVEGVISSYFHSIQRVQLYGPTNFSPIIRRTVALAKESERQKPGEEYFVLLILTDGIISDMEQTKAAIVDAASLPVSIIIVGVGGADFEAMEELDGDEVRLSSRGRLAERDIVQFVPFRDYLDKCYGDITSGAR-----LAKDVLEELPDQLTDYMKKRNIKPPSFAPSRS 530          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO45927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRD6])

HSP 1 Score: 318.546 bits (815), Expect = 4.512e-101
Identity = 188/491 (38.29%), Postives = 284/491 (57.84%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESAC-----VATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSA--NGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGS----HYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHY 1612
            +++++ + +F   + ++Y FEE Q ++  ++ I     +      +  ++C++G+++ S                            A    NL+I       +  D FGKSDPY+   R  + G  +  +R+EVV N LNP WK +  S ++LC  D D  L   C+DWD         D    +LIG FTTT R L +    G + ++  +N +K+KKKKNY++SG+I + + Q +   SFLD++ GG  +NF V ID T SNG+   PTSLHY++    NEY  A+ AV EI+Q+YD+D++FPAFGFGA+VPP+  +SH++ LN +++NPFC G++G+++AY++ + QV L GPT+ AP+I  V+  ++          +Y+ILLILTDG + D  +TKRA+++AS LP+SII++GVG   F  ME LD D  LLR     A RD VQFVP R+F   ++           +LAKEVLAE+P QV  Y
Sbjct:   67 RLENTLNPNFSTTIVVDYFFEELQKLKFMVYDIDSASGSLKNADFLGEMQCTLGQLVSS----------------------------ATYTHNLKIPSGKPAGNMTDFFGKSDPYLEFSRAKEDGSFVVVHRTEVVSNNLNPKWKPIHISSQQLCNGDYDRVLKVNCYDWD---------DDGSHDLIGTFTTTLRELSTCQQGGAELQWPCINEKKRKKKKNYKNSGVIFLSSCQVVRVASFLDFIQGGCQINFTVGIDFTGSNGNPASPTSLHYINPYAPNEYCQALTAVGEIIQDYDSDKLFPAFGFGAKVPPNNMVSHQFALNFNHTNPFCAGLQGLIEAYQQCVRQVTLYGPTNIAPIISNVAMYAQAAAQQPYASLNYYILLILTDGVISDMDQTKRAIVQASGLPMSIIIVGVGSADFEMMEELDADDGLLRSEGSTAQRDIVQFVPFRKFKNLSS----------AALAKEVLAEVPGQVTGY 510          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO39500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X6])

HSP 1 Score: 318.161 bits (814), Expect = 6.954e-101
Identity = 179/490 (36.53%), Postives = 283/490 (57.76%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLS-KEHRDGS--HYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMS 1618
            +VK++ + DF + + ++Y FE  Q ++  +  +        +   + ++EC++G+I+ S    ++  E   + +     I     E   + + +++  +   LD KD  GKSDP++ + +    G  +  +R+EV+KN LNP WK     ++ LC  D D  +   C D+DG        D   D LIG   T+ R LL         +L+N +KK KKK Y +SG++ I   + I   +FLDY+ GG  +NF V +D T+SNG+   P SLHY++    NEY  A+ +V E+ Q+YD+D++FPAFGFGA++PP+F++SHE+ LN + SNP+C+G+ GV+ AY+  + QV+L GPT+ +P+I  V++ + +  +DG+   YF+LL++TDG + D   TK A++ AS LP+S+I++GVG   F+DM  LD D   LR G+++A RD VQFVP R F                 LAK VLAE+P Q   Y +
Sbjct:   49 RVKNNLNPDFSKAISVDYYFELVQKLKFSVFDVDNATKQLDDDDFLGSIECTLGQIV-SKKSFTKHLEIKGRQVGT---ITIYAEEMKGANEIVKLTFRATNLDNKDFMGKSDPFLELLKLKPDGGTLLVHRTEVIKNNLNPTWKVFSLPIQSLCSADYDATIRIDCHDYDG--------DGSHD-LIGIANTSLRQLLELRQSGSGLDLINPKKKAKKKKYVNSGVLYISGCEVIHHNTFLDYVMGGCQINFTVGVDFTASNGNPSTPQSLHYINPYEPNEYVNALVSVGEVCQDYDSDKLFPAFGFGAKIPPNFQVSHEFALNFNPSNPYCEGIPGVVAAYQACIRQVQLYGPTNASPIINHVASFAQRAAQDGTAGAYFVLLLITDGVLSDMEATKLAIVRASRLPMSLIIVGVGSADFTDMNELDADEGTLRAGHERAERDIVQFVPFRDFKTQP----------PAMLAKHVLAEVPKQAQEYFN 515          

HSP 2 Score: 48.9062 bits (115), Expect = 5.376e-6
Identity = 33/117 (28.21%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  437 LEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFEL 787
            +E+ +   GL  KD   KSDP  +++ +++ G+     R+E VKN LNPD+   ++        +L  +L F  FD D A    +D     D+ +G    T   ++S     K  E+
Sbjct:    8 VELHISCRGLLDKDAMSKSDPIAVLHMQDNSGRWYEFSRTERVKNNLNPDFSKAISVDYYF---ELVQKLKFSVFDVDNATKQLDD-----DDFLGSIECTLGQIVSKKSFTKHLEI 116          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO49902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF64])

HSP 1 Score: 172.94 bits (437), Expect = 2.251e-47
Identity = 106/347 (30.55%), Postives = 174/347 (50.14%), Query Frame = 2
Query:  389 IEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEH--RDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDM 1423
            I++ Y+  E   S  N+  ++ G  L+K+ +  K D +  + R    G     YRSE+V  TL+P W      L++LC  ++  E +  C+ +  +  +          LI        +L+  N   K  +LV  +K +K +    +G + I         S +DY+ GG D+    AID T SNGD    +SLH +     NEY  A++A+  +L  YD D+  P F FGA+      I + + LNGD S P    +E ++  Y  +L  +KL GPT+  PVI+++++ +     +D  HY + +++ DG  +D  +TK  +I+ S LP+SI+V+GVG   F+ M
Sbjct:  121 IKLFYE--EVHTSLTNVRFQISGVNLEKRSLLSKWDVFFELERLLPGGFYHPVYRSEIVARTLDPRWSPFDIYLQKLCNEEVTREAVISCWHYSSSGAN---------TLIASARCPVGHLI--NRSIKVLQLVKPQKTQKARRAGTAGSLRIDHCHVDKHFSLVDYIRGGCDVTIACAIDFTLSNGDPSCRSSLHTLSCLYQNEYIGALRALGPVLMHYDEDKQIPTFAFGAK--SKHGIPYCFALNGDESEPEISSIETLIDTYTRSLTTIKLGGPTYLVPVIKRLADYATRELSQDSQHYLVAMVIMDGVANDLDDTKEQIIQVSGLPLSIVVVGVGPADFTAM 452          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO26801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB16])

HSP 1 Score: 143.28 bits (360), Expect = 2.302e-38
Identity = 86/195 (44.10%), Postives = 118/195 (60.51%), Query Frame = 2
Query:  473 KDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSAN--GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYD 1051
            KD FGKSDPY+   R  + G  +  +R+EVV N LNP WK +  S ++LC  D D  L   C+DWD         D    +LIG FTTT R L +    G + ++  +N +K+KKKKNY++SG+I + + Q +   SFLD++ GG  +NF V ID T SNG+   PTSLHY++    NEY  A+ AV EI+Q+YD
Sbjct:  106 KDFFGKSDPYLEFSRAKEDGSFVVVHRTEVVSNNLNPKWKPIHISSQQLCNGDYDRVLKVNCYDWD---------DDGSHDLIGTFTTTLRELSTCQQGGAELQWPCINEKKRKKKKNYKNSGVIFLSSCQVVRVASFLDFIQGGCQINFTVGIDFTGSNGNPASPTSLHYINPYAPNEYCQALTAVGEIIQDYD 291          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5b (copine-8 [Source:NCBI gene;Acc:101170754])

HSP 1 Score: 362.073 bits (928), Expect = 1.219e-117
Identity = 195/485 (40.21%), Postives = 296/485 (61.03%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +        +   +  + C++G I+ S                C   II    E +  +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IG+FTT+ R L     +   +E++N++KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY E+L  V+L GPT+FAPV+  V+  +   +DGS YF+LLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:   23 IDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQVFCTLGEIVGSPASRLEKPLGGIPGKKCGT-IILSAEELSNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGDFTTSYRELARGQSQFNVYEVINTKKKMKKKKYVNSGTVTLLSFSVESEFTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNLENPYCNGIEGILEAYHESLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRVSSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 493          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5a (copine-5 [Source:NCBI gene;Acc:101166794])

HSP 1 Score: 363.229 bits (931), Expect = 1.988e-117
Identity = 197/485 (40.62%), Postives = 297/485 (61.24%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            +K++ + DF++K  L+Y FEEKQ +R +++ I       G+   +  + C++G I+ S               TC   II    E    +D   ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IGEF+T+ + L     E   +E+VN++KK KKK Y +SG +++ +    ++ +FLDY+ GGT ++F VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY ++L  V+L GPT+FAPV+  V+  +    DGS YFILLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q++ YM
Sbjct:   73 IKNTLNPDFVRKYILDYFFEEKQNLRFDVYDIDSKSPDLGKHDFLGQVYCTLGEIVGSPASRLEKPLGGIPGKTCGT-IILSAEELGNCRDYATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPMWQPFSIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFSTSYKELCRGQSESNVYEVVNAKKKLKKKRYINSGTVSLLSFSVESEHTFLDYIKGGTQIHFTVAIDFTASNGNPSQSTSLHYMNPYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNVENPYCNGMEGILEAYHQSLKLVQLYGPTNFAPVVNHVARYAAAVEDGSQYFILLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQLISYM 543          
BLAST of Copine-3 vs. Ensembl Medaka
Match: CPNE8 (copine 8 [Source:NCBI gene;Acc:101158741])

HSP 1 Score: 362.844 bits (930), Expect = 3.019e-117
Identity = 203/490 (41.43%), Postives = 299/490 (61.02%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE+Q +R++L+ +        +   +    C++G I+ S G              C   II K  E    ++++ ++  G  LDKKD FGKSDP++I YR N+ G     +++EVVKNTLNP W+A    +  LC  D D  +  + +DWD       D   +F   IGEF+T+ R L     +   +E+VN +KK KKK Y +SG +T+ +     +++FLDY+ GGT +NF VAID T+SNG+   PTSLHYM     N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+ LNG+  NP+C G++GVM+AY + L  V+L GPT+FAPVI  V+  +   +DGS YF+LLI+TDG + D   TK A++ AS LP+SI+++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q L YM R +G
Sbjct:   69 IDNTLNPDFVRKFILDYFFEERQNLRLDLYDVDSKSANLSKHDFLGQAYCTLGEIVGSLGSRLEKPLGGIPGKKCGT-IIVKAEELNNCRESVMMQFCGNKLDKKDFFGKSDPFLIFYRSNEDGTFTICHKTEVVKNTLNPVWQAFKIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGEFSTSYRELSRGQSQFNVYEVVNPKKKGKKKKYLNSGTVTLLSFLVDIEVTFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMSPYQLNTYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFALNGNPQNPYCDGIDGVMEAYYQTLKSVQLYGPTNFAPVINHVARYAASVKDGSQYFVLLIITDGVITDMALTKEAIVNASGLPMSILIVGVGPAEFDAMVELDGDEVRISSRGRLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFLSYM-RTRG 543          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne8 (copine-8 [Source:NCBI gene;Acc:101173626])

HSP 1 Score: 362.459 bits (929), Expect = 3.902e-117
Identity = 199/491 (40.53%), Postives = 304/491 (61.91%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGI-----YFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXN-YQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKG 1630
            + ++ + DF++K  L+Y FEE+Q +R +L+ +        +   +    C++G I+ S G              C   II +  E +  ++++ ++  G  LDKKD FGKSDP+++ YR N+ G     +++EVVKNTL+P W+A    +  LC  D D  +  + +DWD   G          + IGEF+T+ R +  +  +   +E++N +KK KKK  Y +SG +T+ +    T+LSFLDY+ GGT +NF VAID T+SNG+   PTSLHYM     N+Y++A++AV EI+Q+YD+D++FPA GFGA++PPD ++SHE+PLNG+  NP+C G++GV++AY ++L  V+L GPTHF+PVI  V+  +    DGS YFILLI++DG + D  +TK +++ A+ LP+SII++GVG  +F +M  LD D + +      A RD VQFVP R ++    D   +   +   LAKEVLAE+P Q L YM R +G
Sbjct:   64 IDNTLNPDFVRKFILDYFFEERQNLRFDLYDLDCKSDNLSKHDFLGQAFCTLGEIVGSLGSRLEKPLIGIPGKKCGT-IIVRAEELSNCRESVMLQFCGNKLDKKDFFGKSDPFLVFYRSNEDGSYTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRSIKVEVYDWDRDGGH---------DFIGEFSTSYREMSRSQSQFHIYEVLNPKKKGKKKKKYLNSGTVTLLSCLVDTELSFLDYIRGGTQINFTVAIDFTASNGNPSQPTSLHYMSPYQLNDYAMALRAVGEIIQDYDSDKLFPALGFGAKLPPDGRVSHEFPLNGNPQNPYCNGIDGVLEAYYQSLKSVRLYGPTHFSPVINHVARYASAVTDGSQYFILLIISDGVITDMAQTKESIVNAASLPMSIIIVGVGPAEFDEMIELDGDEERISSQGRYAERDIVQFVPFRDYI----DRRGNHILSMARLAKEVLAEIPDQFLSYM-RTRG 539          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5b (copine-8 [Source:NCBI gene;Acc:101170754])

HSP 1 Score: 363.614 bits (932), Expect = 8.556e-117
Identity = 195/485 (40.21%), Postives = 296/485 (61.03%), Query Frame = 2
Query:  176 VKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIY-----FGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYM 1615
            + ++ + DF++K  L+Y FEEKQ +R +L+ +        +   +  + C++G I+ S                C   II    E +  +D+  ++     LDKKD FGKSDP+++ YR N+ G     +++EVVKNTLNP W+     +  LC  D D  +  + +DWD       D   +F   IG+FTT+ R L     +   +E++N++KK KKK Y +SG +T+ +    ++ +FLDY+ GGT +NF VAID T+SNG+    TSLHYM+    N Y++A++AV EI+Q+YD+D+MFPA GFGA++PPD ++SHE+PLNG+  NP+C G+EG+++AY E+L  V+L GPT+FAPV+  V+  +   +DGS YF+LLI+TDG + D  +TK A++ A+ LP+SII++GVG  +F  M  LD D   +      A RD VQFVP R ++    D + +   +   LAK+VLAE+P Q + YM
Sbjct:  131 IDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQVFCTLGEIVGSPASRLEKPLGGIPGKKCGT-IILSAEELSNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD------RDGSHDF---IGDFTTSYRELARGQSQFNVYEVINTKKKMKKKKYVNSGTVTLLSFSVESEFTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMNPYQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNLENPYCNGIEGILEAYHESLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRVSSRGKLAERDIVQFVPFRDYM----DRTGNHVLSMARLAKDVLAEIPDQFISYM 601          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000007275.1 (SMESG000007275.1)

HSP 1 Score: 1176.77 bits (3043), Expect = 0.000e+0
Identity = 570/570 (100.00%), Postives = 570/570 (100.00%), Query Frame = 2
Query:  173 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQRRASSCLLKTGRQCSVDTSLQESDNKSRSGYFGNSLYP 1882
            KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRKKKKKKNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQRRASSCLLKTGRQCSVDTSLQESDNKSRSGYFGNSLYP
Sbjct:   46 KVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRKKKKKKNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQRRASSCLLKTGRQCSVDTSLQESDNKSRSGYFGNSLYP 615          

HSP 2 Score: 95.9005 bits (237), Expect = 2.336e-20
Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1
Query:   40 MTEKSKVLISLSCRNLPTESFEMYYATLRVATGGYFHDKDTISTE 174
            MTEKSKVLISLSCRNLPTESFEMYYATLRVATGGYFHDKDTISTE
Sbjct:    1 MTEKSKVLISLSCRNLPTESFEMYYATLRVATGGYFHDKDTISTE 45          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000029196.1 (SMESG000029196.1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 333/554 (60.11%), Postives = 427/554 (77.08%), Query Frame = 2
Query:  200 FIQKLQLEYIFEEKQIIRIELHGIYF-GESACVATLECSVGRIIHSGGEL------SRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHK-GALGPRRSEHYRYCSMKDL-LRQFSQDTRLRRCATSSYDDQSPKHMSQRRASSCLLKTGRQCSVDTSLQE 1834
            F  +L L+Y FEEKQ I++E+ G+    + + +   E ++GR+IHSGGEL       +   +        I I Y V ED+  K+N+EIKMQG+ LDKKD+FGKSDPYVI+Y++N++GKL++TYRSE++KNTLNPDW++++ S+E+LC  +L  E+  KCFDWDGA GDPEDMD EFDE+IGEF+   +  L    +++KFEL+NSRKKKKKK Y +SG++T+RT Q   D SF+DYMFGGTDLNFIVAIDLTSSNGD+ DP+SLH++D N++NEYS+AIQAVLEILQEYDNDE+FPAFGFGARV PDFKI HEYPL GD+SNPFC GVEGV+ AY E L  +KLSGPT+FAPVIRQV NL+K++ DGSHYF+LLILTDG+VDDW+ETK+AVIEAS+LP+SIIV+GVGG KF DM+ LDQDF LL+VGN+QACRDNVQFVPMR+FLR AADGSD+++W+KV+LAKEVLAELP Q+L YM++H    +G  +S          L  ++F Q  +LRRCAT+    +S +  S    +    +  R+CSVD+   E
Sbjct:   52 FKCQLNLDYFFEEKQCIKVEIFGLSKDSKISKIGCAESTIGRVIHSGGELFLQINIDKDLSYGNNESHSPICIFY-VREDSDCKENIEIKMQGFNLDKKDLFGKSDPYVIMYKKNERGKLVKTYRSEIIKNTLNPDWRSIMVSVEKLCNKNLQSEIYVKCFDWDGAKGDPEDMDNEFDEIIGEFSIPAKEFLYPYIQERKFELINSRKKKKKKGYSNSGIVTVRTNQVSKDNSFIDYMFGGTDLNFIVAIDLTSSNGDIHDPSSLHFIDENSSNEYSIAIQAVLEILQEYDNDELFPAFGFGARVAPDFKICHEYPLTGDFSNPFCHGVEGVINAYHEVLQNIKLSGPTYFAPVIRQVINLAKQYCDGSHYFVLLILTDGTVDDWIETKKAVIEASFLPISIIVVGVGGGKFLDMKTLDQDFGLLKVGNEQACRDNVQFVPMRKFLRPAADGSDNVKWSKVALAKEVLAELPEQLLDYMNKHNLKPIGENKSLLSATLDNSKLNAKEFVQ-QKLRRCATAYGMTKSNRQGSTDGLNGRGFRGTRKCSVDSQFLE 603          

HSP 2 Score: 52.7582 bits (125), Expect = 7.393e-7
Identity = 23/44 (52.27%), Postives = 31/44 (70.45%), Query Frame = 1
Query:   49 KSKVLISLSCRNLPTESFEMYYATLRVATGGYFHDKDTISTESK 180
            K KV++ + C NLP ++F  YYA   VATGGY HDKD + TE++
Sbjct:    3 KPKVIVGIGCLNLP-DTFLSYYAEFSVATGGYIHDKDVMKTENQ 45          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000064685.1 (SMESG000064685.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 307/578 (53.11%), Postives = 402/578 (69.55%), Query Frame = 2
Query:  179 KDSKDIDFIQKLQLEYIFEEKQIIRIEL--HGIYFGESACVATLECSVGRIIHSGG------ELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSAN-GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGA------LGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQR-----RASSCLLKTGRQCSVDTSLQESDNKSR 1852
            K   DI F  KL +EY+FEEKQ+I IE+  + I       +  ++CS+GR+IHSGG      E++   +     ++ E+ I   V ED  +K+N+E+K++G GL K +IFGK+DPY++I+R N++ + ++ YR+EV+KNT NPDW  +V S ERLC NDL+  L  + +  DG   + E++D   D+L+GE   T R L+     E+K+FEL+N +KKKKKK+Y +SG+I++R  +T ++ +FLD+MF G +LNFIVAIDLT SNGD   P+SLH+MD + TNEYSVAIQAVLEILQEYDNDE+FPAFGFGARVPPD+KI HEYPLNGD+ NP+C+G EGV+ AY++ L +VKL+GPT F+PVIR +S L+K    G HYF+LLILTDGSVDDWVETK+AV+E SYLPVSIIV+GVGG KFSDME LDQDF LL V N++ACRDNVQFV MRR+LR AADGSD+IRW+KV+LAK+VLAELP QV  YM R          L  +RS       ++           L+R  T    +QS + +        +A S LLK  RQ SVD+SL      SR
Sbjct:   49 KSGHDITFDAKLCIEYLFEEKQMIIIEIFEYDITQDGDNLLGEVDCSIGRVIHSGGVILKPLEITNEFKTTLGPLSPEVGIY--VEEDLTAKENIELKIRGIGLAKTEIFGKTDPYLMIFRCNNRSRYVQCYRTEVLKNTQNPDWSPIVVSYERLCNNDLNSVLCLRVYCGDGTLKESEEVDIACDQLVGEIKVTARELIQMRRMEEKQFELINPKKKKKKKSYLNSGIISVRAQKTNSEPTFLDFMFQGLELNFIVAIDLTLSNGDSSLPSSLHFMDCSLTNEYSVAIQAVLEILQEYDNDELFPAFGFGARVPPDYKICHEYPLNGDFENPYCRGAEGVIHAYQQTLKEVKLAGPTCFSPVIRHISRLAKASESGKHYFVLLILTDGSVDDWVETKKAVVETSYLPVSIIVVGVGGGKFSDMETLDQDFGLLMVSNEKACRDNVQFVKMRRYLRVAADGSDNIRWSKVALAKDVLAELPYQVNEYMHRKTKLTNYLENLPTQRSTAVFSSCLRQNCSSDPNSLSLQRTPTL---NQSRRMLYNEGNISSQAKSRLLKNTRQYSVDSSLFSKQVSSR 621          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000064685.1 (SMESG000064685.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 307/578 (53.11%), Postives = 402/578 (69.55%), Query Frame = 2
Query:  179 KDSKDIDFIQKLQLEYIFEEKQIIRIEL--HGIYFGESACVATLECSVGRIIHSGG------ELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANG-EQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGA------LGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQR-----RASSCLLKTGRQCSVDTSLQESDNKSR 1852
            K   DI F  KL +EY+FEEKQ+I IE+  + I       +  ++CS+GR+IHSGG      E++   +     ++ E+ I   V ED  +K+N+E+K++G GL K +IFGK+DPY++I+R N++ + ++ YR+EV+KNT NPDW  +V S ERLC NDL+  L  + +  DG   + E++D   D+L+GE   T R L+     E+K+FEL+N +KKKKKK+Y +SG+I++R  +T ++ +FLD+MF G +LNFIVAIDLT SNGD   P+SLH+MD + TNEYSVAIQAVLEILQEYDNDE+FPAFGFGARVPPD+KI HEYPLNGD+ NP+C+G EGV+ AY++ L +VKL+GPT F+PVIR +S L+K    G HYF+LLILTDGSVDDWVETK+AV+E SYLPVSIIV+GVGG KFSDME LDQDF LL V N++ACRDNVQFV MRR+LR AADGSD+IRW+KV+LAK+VLAELP QV  YM R          L  +RS       ++           L+R  T    +QS + +        +A S LLK  RQ SVD+SL      SR
Sbjct:   49 KSGHDITFDAKLCIEYLFEEKQMIIIEIFEYDITQDGDNLLGEVDCSIGRVIHSGGVILKPLEITNEFKTTLGPLSPEVGIY--VEEDLTAKENIELKIRGIGLAKTEIFGKTDPYLMIFRCNNRSRYVQCYRTEVLKNTQNPDWSPIVVSYERLCNNDLNSVLCLRVYCGDGTLKESEEVDIACDQLVGEIKVTARELIQMRRMEEKQFELINPKKKKKKKSYLNSGIISVRAQKTNSEPTFLDFMFQGLELNFIVAIDLTLSNGDSSLPSSLHFMDCSLTNEYSVAIQAVLEILQEYDNDELFPAFGFGARVPPDYKICHEYPLNGDFENPYCRGAEGVIHAYQQTLKEVKLAGPTCFSPVIRHISRLAKASESGKHYFVLLILTDGSVDDWVETKKAVVETSYLPVSIIVVGVGGGKFSDMETLDQDFGLLMVSNEKACRDNVQFVKMRRYLRVAADGSDNIRWSKVALAKDVLAELPYQVNEYMHRKTKLTNYLENLPTQRSTAVFSSCLRQNCSSDPNSLSLQRTPTL---NQSRRMLYNEGNISSQAKSRLLKNTRQYSVDSSLFSKQVSSR 621          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000064685.1 (SMESG000064685.1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 305/570 (53.51%), Postives = 400/570 (70.18%), Query Frame = 2
Query:  179 KDSKDIDFIQKLQLEYIFEEKQIIRIEL--HGIYFGESACVATLECSVGRIIHSGG------ELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSAN-GEQKKFELVNSRXXXXXXNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGA------LGPRRSEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQR-----RASSCLLKTGRQCSVDTSL 1828
            K   DI F  KL +EY+FEEKQ+I IE+  + I       +  ++CS+GR+IHSGG      E++   +     ++ E+ I   V ED  +K+N+E+K++G GL K +IFGK+DPY++I+R N++ + ++ YR+EV+KNT NPDW  +V S ERLC NDL+  L  + +  DG   + E++D   D+L+GE   T R L+     E+K+FEL+N +KKKKKK+Y +SG+I++R  +T ++ +FLD+MF G +LNFIVAIDLT SNGD   P+SLH+MD + TNEYSVAIQAVLEILQEYDNDE+FPAFGFGARVPPD+KI HEYPLNGD+ NP+C+G EGV+ AY++ L +VKL+GPT F+PVIR +S L+K    G HYF+LLILTDGSVDDWVETK+AV+E SYLPVSIIV+GVGG KFSDME LDQDF LL V N++ACRDNVQFV MRR+LR AADGSD+IRW+KV+LAK+VLAELP QV  YM R          L  +RS       ++           L+R  T    +QS + +        +A S LLK  RQ SVD+SL
Sbjct:   49 KSGHDITFDAKLCIEYLFEEKQMIIIEIFEYDITQDGDNLLGEVDCSIGRVIHSGGVILKPLEITNEFKTTLGPLSPEVGIY--VEEDLTAKENIELKIRGIGLAKTEIFGKTDPYLMIFRCNNRSRYVQCYRTEVLKNTQNPDWSPIVVSYERLCNNDLNSVLCLRVYCGDGTLKESEEVDIACDQLVGEIKVTARELIQMRRMEEKQFELINPKKKKKKKSYLNSGIISVRAQKTNSEPTFLDFMFQGLELNFIVAIDLTLSNGDSSLPSSLHFMDCSLTNEYSVAIQAVLEILQEYDNDELFPAFGFGARVPPDYKICHEYPLNGDFENPYCRGAEGVIHAYQQTLKEVKLAGPTCFSPVIRHISRLAKASESGKHYFVLLILTDGSVDDWVETKKAVVETSYLPVSIIVVGVGGGKFSDMETLDQDFGLLMVSNEKACRDNVQFVKMRRYLRVAADGSDNIRWSKVALAKDVLAELPYQVNEYMHRKTKLTNYLENLPTQRSTAVFSSCLRQNCSSDPNSLSLQRTPTL---NQSRRMLYNEGNISSQAKSRLLKNTRQYSVDSSL 613          
The following BLAST results are available for this feature:
BLAST of Copine-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPNE82.038e-11942.24copine 8 [Source:HGNC Symbol;Acc:HGNC:23498][more]
CPNE84.584e-11942.24copine 8 [Source:HGNC Symbol;Acc:HGNC:23498][more]
CPNE91.740e-11440.12copine family member 9 [Source:HGNC Symbol;Acc:HGN... [more]
CPNE21.126e-11140.61copine 2 [Source:HGNC Symbol;Acc:HGNC:2315][more]
CPNE21.126e-11140.61copine 2 [Source:HGNC Symbol;Acc:HGNC:2315][more]
back to top
BLAST of Copine-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gem-41.614e-8937.37Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMB... [more]
gem-41.614e-8937.37Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMB... [more]
nra-16.884e-8837.08Nicotinic receptor-associated protein 1 [Source:U... [more]
nra-12.740e-8636.71Nicotinic receptor-associated protein 1 [Source:U... [more]
cpna-54.437e-4627.52Copine family protein 5 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Copine-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Copine-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne82.468e-11739.88copine VIII [Source:ZFIN;Acc:ZDB-GENE-100809-1][more]
cpne5b7.767e-11740.86copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398][more]
cpne4b1.481e-11539.77copine IVb [Source:ZFIN;Acc:ZDB-GENE-060503-926][more]
cpne4b1.481e-11539.77copine IVb [Source:ZFIN;Acc:ZDB-GENE-060503-926][more]
cpne5b4.292e-11539.92copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398][more]
back to top
BLAST of Copine-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acot118.615e-11641.41acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GE... [more]
cpne93.969e-11539.45copine family member IX [Source:NCBI gene;Acc:1001... [more]
cpne92.842e-11439.01copine family member IX [Source:NCBI gene;Acc:1001... [more]
acot111.298e-11241.82acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GE... [more]
cpne34.089e-11239.64copine III [Source:NCBI gene;Acc:493363][more]
back to top
BLAST of Copine-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpne81.538e-11942.24copine VIII [Source:MGI Symbol;Acc:MGI:1914121][more]
Cpne91.302e-11440.24copine family member IX [Source:MGI Symbol;Acc:MGI... [more]
Cpne13.103e-11140.63copine I [Source:MGI Symbol;Acc:MGI:2386621][more]
Cpne13.103e-11140.63copine I [Source:MGI Symbol;Acc:MGI:2386621][more]
Cpne52.582e-10838.22copine V [Source:MGI Symbol;Acc:MGI:2385908][more]
back to top
BLAST of Copine-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86YQ8|CPNE8_HUMAN9.786e-11942.24Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8 PE=1 SV=... [more]
sp|Q9DC53|CPNE8_MOUSE1.076e-11842.24Copine-8 OS=Mus musculus OX=10090 GN=Cpne8 PE=2 SV... [more]
sp|Q5BJS7|CPNE9_RAT7.273e-11440.24Copine-9 OS=Rattus norvegicus OX=10116 GN=Cpne9 PE... [more]
sp|Q1RLL3|CPNE9_MOUSE8.181e-11440.24Copine-9 OS=Mus musculus OX=10090 GN=Cpne9 PE=1 SV... [more]
sp|Q8IYJ1|CPNE9_HUMAN8.358e-11440.12Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=... [more]
back to top
BLAST of Copine-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G9Y00.000e+057.41Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FGY60.000e+057.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EEV50.000e+059.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267ER930.000e+056.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H4K50.000e+059.01Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Copine-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne5b5.299e-11740.45copine-5 [Source:NCBI gene;Acc:103046149][more]
cpne5b2.055e-11640.45copine-5 [Source:NCBI gene;Acc:103046149][more]
cpne4a3.699e-11540.80copine-4-like [Source:NCBI gene;Acc:111188392][more]
cpne4b1.064e-11439.31copine-4 [Source:NCBI gene;Acc:103033161][more]
cpne37.472e-11442.03copine 3 [Source:NCBI gene;Acc:103047700][more]
back to top
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne24.065e-10538.68copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
ENSPMAT00000007777.16.615e-8536.05pep scaffold:Pmarinus_7.0:GL477373:3581:22444:1 ge... [more]
ENSPMAT00000000748.14.860e-7637.53pep scaffold:Pmarinus_7.0:GL477446:179420:193439:1... [more]
cpne25.604e-6546.22copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
cpne22.901e-2431.98copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
back to top
BLAST of Copine-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Copine-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443525.310e-11341.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459274.512e-10138.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395006.954e-10136.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499022.251e-4730.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268012.302e-3844.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Copine-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne5b1.219e-11740.21copine-8 [Source:NCBI gene;Acc:101170754][more]
cpne5a1.988e-11740.62copine-5 [Source:NCBI gene;Acc:101166794][more]
CPNE83.019e-11741.43copine 8 [Source:NCBI gene;Acc:101158741][more]
cpne83.902e-11740.53copine-8 [Source:NCBI gene;Acc:101173626][more]
cpne5b8.556e-11740.21copine-8 [Source:NCBI gene;Acc:101170754][more]
back to top
BLAST of Copine-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007275.12.336e-20100.00SMESG000007275.1[more]
SMESG000029196.17.393e-760.11SMESG000029196.1[more]
SMESG000064685.10.000e+053.11SMESG000064685.1[more]
SMESG000064685.10.000e+053.11SMESG000064685.1[more]
SMESG000064685.10.000e+053.51SMESG000064685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014606 ID=SMED30014606|Name=Copine-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1994bp
AATAATTTGAAAAGTATTTTTTTAGAAATTTGCATCAAAATGACTGAAAA
ATCAAAAGTTTTGATTAGTTTATCATGCCGTAATTTACCAACAGAGTCCT
TCGAAATGTATTACGCAACACTGAGAGTGGCTACAGGTGGATATTTCCAT
GATAAAGATACAATTTCTACTGAAAGTAAAAGATAGTAAAGACATTGATT
TTATACAGAAACTGCAATTAGAATATATTTTCGAAGAAAAACAAATAATA
AGGATAGAATTACATGGGATTTATTTTGGTGAGAGTGCTTGTGTTGCAAC
CTTGGAATGCTCAGTAGGAAGAATAATTCACAGCGGCGGTGAGCTTTCAC
GCTTCACTGAATGGTGCTGGAAATCAATAACATGTGAAATTGAAATAATT
TATAAAGTCACAGAAGATGCAGCATCAAAGGATAATTTAGAGATCAAAAT
GCAAGGTTATGGTCTGGACAAGAAGGATATATTCGGGAAATCAGATCCAT
ATGTCATAATTTACAGACGAAATGATAAAGGAAAACTCATCCGGACATAT
CGGAGTGAAGTGGTGAAAAATACTTTAAACCCTGACTGGAAAGCCGTGGT
GGCGTCTTTAGAAAGACTTTGTGGAAATGATTTAGACTGTGAATTAATAT
TCAAATGTTTTGATTGGGATGGAGCGAATGGAGATCCAGAAGACATGGAC
ACAGAATTCGATGAACTGATTGGGGAATTCACAACAACGACCAGGTATCT
TTTATCCGCAAATGGTGAGCAGAAAAAGTTTGAGCTAGTGAACTCAAGAA
AAAAAAAGAAAAAGAAAAACTATCAACATTCTGGTTTGATTACAATACGA
ACTATCCAGACGATCACAGATTTGAGCTTTTTAGATTATATGTTTGGAGG
AACCGACTTGAATTTTATTGTTGCAATCGACTTGACCTCCTCAAATGGTG
ATGTCGAAGACCCTACCTCATTACATTATATGGACGTCAACAATACTAAT
GAATATTCGGTGGCCATCCAAGCAGTTTTAGAAATTTTACAGGAATATGA
TAACGATGAAATGTTTCCTGCTTTTGGATTCGGTGCTAGAGTGCCTCCAG
ACTTTAAAATATCTCATGAATATCCTTTAAATGGAGACTACTCGAATCCT
TTTTGTAAAGGTGTTGAAGGTGTAATGAAGGCTTATCGGGAAGCTTTGCT
GCAAGTGAAATTATCAGGTCCGACCCATTTTGCACCAGTCATACGACAGG
TTTCTAATTTATCCAAGGAGCACCGAGATGGGTCACATTATTTTATATTA
TTAATTCTAACAGATGGATCAGTAGATGATTGGGTTGAAACAAAAAGAGC
CGTTATTGAGGCGTCATATTTGCCGGTATCAATCATTGTAATCGGGGTTG
GAGGCAGAAAGTTTTCAGATATGGAAATTCTTGATCAAGATTTCAAACTT
TTACGAGTGGGGAATGATCAGGCCTGTCGAGATAATGTCCAGTTCGTGCC
GATGAGGAGATTTTTAAGAGCTGCAGCTGACGGAAGTGATAGTATCAGGT
GGAATAAAGTCTCACTAGCAAAAGAAGTTTTAGCAGAGCTTCCGGTTCAA
GTGCTGCATTATATGAGTCGACATAAAGGAGCCTTAGGTCCTAGACGGAG
TGAACATTATCGCTATTGCAGTATGAAAGATTTATTGCGCCAGTTTTCTC
AAGACACTCGCTTAAGGAGATGTGCTACATCTAGCTACGATGATCAGTCA
CCAAAACACATGTCACAACGTCGAGCCAGCAGTTGTTTATTAAAAACTGG
CAGACAATGTTCAGTTGACACTTCTCTACAAGAATCAGACAATAAATCAA
GATCAGGCTATTTTGGAAACTCATTGTATCCTTAATCGGATTGACTGTCA
TTTGTGCCTTTTGTGTTTACTTAATTGCTTATTTAATTTTTACTATTTTA
TAAAGTTGTAATTGATAATACAGTTCTTTTCCTTAAAGTCGTTT
back to top

protein sequence of SMED30014606-orf-1

>SMED30014606-orf-1 ID=SMED30014606-orf-1|Name=SMED30014606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MIKIQFLLKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVA
TLECSVGRIIHSGGELSRFTEWCWKSITCEIEIIYKVTEDAASKDNLEIK
MQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAV
VASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRY
LLSANGEQKKFELVNSRKKKKKKNYQHSGLITIRTIQTITDLSFLDYMFG
GTDLNFIVAIDLTSSNGDVEDPTSLHYMDVNNTNEYSVAIQAVLEILQEY
DNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREAL
LQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKR
AVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFV
PMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGALGPRR
SEHYRYCSMKDLLRQFSQDTRLRRCATSSYDDQSPKHMSQRRASSCLLKT
GRQCSVDTSLQESDNKSRSGYFGNSLYP*
back to top
Aliases
The feature 'Copine-3' has the following synonyms
Synonym
Smed_32587
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005544calcium-dependent phospholipid binding
GO:0048306calcium-dependent protein binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0016020membrane
GO:0030054cell junction
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0030335positive regulation of cell migration
GO:0038128ERBB2 signaling pathway
GO:0071277cellular response to calcium ion
GO:0071363cellular response to growth factor stimulus
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR002035VWF_A
IPR010734Copine