Cell adhesion molecule-related/down-regulated by oncogenes isoform 2

Overview
NameCell adhesion molecule-related/down-regulated by oncogenes isoform 2
Smed IDSMED30014599
Length (bp)5849
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 (SMED30014599) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 (SMED30014599) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 (SMED30014599) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 (SMED30014599) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014599

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014599SMESG000063656.1 SmedASXL_017693SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014599SMESG000063656.1 dd_Smed_v4_13217_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014599SMESG000063656.1 dd_Smed_v4_13217_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014599SMESG000063656.1 dd_Smed_v4_13217_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014599SMESG000063656.1 dd_Smed_v4_13217_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014599SMESG000063656.1 dd_Smed_v6_13217_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30014599SMESG000063656.1 dd_Smed_v4_13217_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 76.2554 bits (186), Expect = 2.452e-13
Identity = 89/358 (24.86%), Postives = 138/358 (38.55%), Query Frame = 1
Query:  811 KKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN-----SKRYESDTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE--DSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF-VELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAE--LLHTV 1845
            ++++L PG   L +      DSG YTC A      +  R     +L+V  P     P FR +     R  +  +    G    L C  ++ P   VTWY        ++R ++      L I   Q+ D   +SC  + V     R+F L V   P F  +P   +    A   + + C+V + VP PT+ W  D +M  E      +  R   LQ+  L+    G Y C  EN      +     KDF V +      R +    +     G  + L+C     + D +    V W  LKD   L +  G     +     G+++L  +  +   D G Y C  ++   E   LHTV
Sbjct:   23 EEVFLLPGTHTLQLGRARLSDSGMYTCEA----LNAAGRDQKLVQLSVLVP-----PAFRQA----PRGPQDAVLVRVGDKAVLSCETDALPEPTVTWYKDGQPLVLAQRTQALRGGQRLEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTF-ENPKTETVSQVAGSPLVLTCDV-SGVPAPTVTWLKD-RMPVESSAVHGVVSRGGRLQLSRLQPAQAGTYTCVAEN------TQAEARKDFVVAVLVAPRIRSSGVAREHHVLEGQEVRLDC-----EADGQPPPDVAW--LKDGSPLGQDMGPHLRFYLDG--GSLVLKGLRAS---DAGAYTCVAHNPAGEDARLHTV 346          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 74.7146 bits (182), Expect = 2.049e-12
Identity = 69/252 (27.38%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY---YP----NSKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE-DSLKFRKNILQIRSLEKKHLGIYQC 1470
            PP + ++ D  P+   KG     + +     IL +KN+   D+G Y C A  +       +D K  L+V  P   I          N R  E  I   E ++++L C     P   +TW+   +P    NS R  S  +   L +    ++DA  ++C+   A   + + F L VL  P           K   +Q+V + CEV  N P P I W  DG+ L E E   +      LQI +++  H G Y C
Sbjct: 2321 PPTVTWMKDGHPLIKAKG-----VEILDEGHILQLKNIHVSDTGRYVCVAVNVA----GMTDKKYDLSVHAPPSII---------GNHRSPEN-ISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRM--LRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGN-PVPEITWHKDGQPLQEDEAHHIISGGRFLQITNVQVPHTGRYTC 2550          

HSP 2 Score: 70.4774 bits (171), Expect = 3.996e-11
Identity = 104/452 (23.01%), Postives = 175/452 (38.72%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVH----HESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLS------INNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISI-IDKRTAPGLT-----IHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEP 1887
            +A N  G V+      I KVL P P ++    HE    I+ N  ++ C+   S    P + ++ D  P+  T      ++    G  +L I   + +D+G YTC AS     S    D K  L           R  +        E + I       +TL C  ++ P   +TW   N +R ++  +   LS      INN  L D ++++C+A+ +    TR F L V   P     P   S      ++  ++C +   VP P I W  DG +L          +N  L I+S      G Y C   N     A+G            T+ +R ++ + +    APG T     ++++ + L  +       ++ W R    L  ++   N Y +    S     L I++P+ + D   Y C + +   +   TV   + +     +EP
Sbjct: 3507 IASNEAGEVSKH---FILKVLEP-PHINGSEEHEEISVIVNNPLELTCIA--SGIPAPKMTWMKDGRPLPQTD-----QVQTLGGGEVLRISTAQVEDTGRYTCLAS-----SPAGDDDKEYLV----------RVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLR-NGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ--SLVILLNKSTVLEC-IAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATN-----AAG------------TDRRRIDLQVHVPPSIAPGPTNMTVIVNVQ-TTLACEATGIPKPSINW-RKNGHLLNVDQNQNSYRLLSSGS-----LVIISPSVD-DTATYECTVTNGAGDDKRTVDLTVQVPPSIADEP 3903          

HSP 3 Score: 68.1662 bits (165), Expect = 2.489e-10
Identity = 57/222 (25.68%), Postives = 93/222 (41.89%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS------KRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L I  ++P D+G YTC A+ +       S   T+LTV  P     PR         R  E      E S   L C+ +  P   + W   N        +Y ++  +G L + NV L+D+  ++C+AN      T +  L V  LP F+  P  +S      + + + C+    +P P + W  +  ++    DS+     ++ I  + K+  G Y C  EN
Sbjct: 4133 LQIAFVQPGDAGHYTCMAANVAGS----SSTSTKLTVHVP-----PRI--------RSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLANLLGKYTAE-PYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNK--GEQLRLSCKA-TGIPLPKLTWTFNNNIIPAHFDSVNGHSELV-IERVSKEDSGTYVCTAEN 4332          

HSP 4 Score: 64.6994 bits (156), Expect = 2.299e-9
Identity = 70/275 (25.45%), Postives = 106/275 (38.55%), Query Frame = 1
Query:  811 KKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS-----KRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSS--SPLGISFKS-YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLENE-------WNLWASGVTVIKDFVELQETESQRENISII 1575
            +  +LP G+M   I      DSG Y C A+ +     Q      +L V  P K              ++  K ++   G  + + C  + TP   +TW    S       +      GTLSI+     DA  ++C+A  +         L V   P       P   +F+   A Q +E  C      P PTIKW H+G+ LT +E  +   ++  +L I S+     G Y C   NE       +NL      VIKD       + Q  N+S++
Sbjct: 1126 RHTFLPSGSM--KITETRTSDSGMYLCVATNIAGNVTQ----AVKLNVHVPPKI-------------QRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERVANQRIEFPCPA-KGTPKPTIKWLHNGRELTGREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKD-------KEQVTNVSVL 1373          

HSP 5 Score: 63.5438 bits (153), Expect = 5.411e-9
Identity = 60/257 (23.35%), Postives = 109/257 (42.41%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQL--------DDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKF--RKNILQIRSLEKKHLGIYQCWLEN 1482
            P I++LH+   +      +   I +     +L+I ++ P D+G Y C A      + ++ ++K           + P  +    D E+     +   + +N  L+C  E TP+  + WY  N +  ES T     ++NN ++        +DA  +SC A  +   S   F + VL  P    +           + V ++C+V    P P I WF DGK L   + +++   R  +L +++  +   G YQC + N
Sbjct: 1296 PTIKWLHNGRELT----GREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVH---------VPPVIK----DKEQVTNVSVLLNQLTN--LFCEVEGTPSPIIMWYKDNVQVTESST---IQTVNNGKILKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQV-KGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSN 1529          

HSP 6 Score: 63.1586 bits (152), Expect = 8.162e-9
Identity = 69/290 (23.79%), Postives = 116/290 (40.00%), Query Frame = 1
Query:  679 ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDI-KPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG------TLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALPRFS-----SSPLGISFKSYARQT-----VEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENE 1485
            E    I+ +   +VC   +S P P  I +  D  P+ + +      I + PG   L I N +  ++G Y+C A+    +  +  ++K  +     K D+  P           KE KI      + +TL C   + P+A ++WY  + +  +SD          TL I   Q+ D   ++C+A+ +       F + +   P F       + L       A+       + + CE  N  P PT+ W+ DG  LT  +  L      +LQI   + +  G Y C   NE
Sbjct: 2583 EDVTVILNSPTSLVCEA-YSYP-PATITWFKDGTPLESNR-----NIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGL-------SPKEVKI---KVNNTLTLECEAYAIPSASLSWYK-DGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCET-NAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNE 2853          

HSP 7 Score: 62.003 bits (149), Expect = 1.597e-8
Identity = 66/259 (25.48%), Postives = 99/259 (38.22%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES-------DTQFGTLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR----KNILQIRSLEKKHLGIYQCWLEN 1482
            PP + +L +  PI     +      + PG   L I   +  D G YTC A          S  K  LTV  P          S  D++ +   ++   EG++++L C   + P   +TWY       ES       D Q   L I   ++ D   + C A  V  R   +F L V   P        +  ++ +   V + C+    +P PTI W  + K + E  DSL+ R     + LQI   +    G Y C   N
Sbjct: 2993 PPDLSWLKNEQPIKLNTNT-----LIVPGGRTLQIIRAKVSDGGEYTCIA----INQAGESKKKFSLTVYVPP---------SIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQM--LHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETIS-NPVTLTCDA-TGIPPPTIAWLKNHKRI-ENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASN 3228          

HSP 8 Score: 58.5362 bits (140), Expect = 1.835e-7
Identity = 58/219 (26.48%), Postives = 90/219 (41.10%), Query Frame = 1
Query:  868 KDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNER--KEEKIIEAT--EGSNITLYCLYESTPAAEVTWY------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            ++SG Y CTA    T +   +  K +LTV      ++PR     + ++R   ++K +E +   G  +TL C  +S P   +TW        P S R+ +    G++ I   +  D+  + C+A  +    T++ KL V   P+    P     K    Q V+I C      P P I W   G  ML + E  +      L I        GIY C   N
Sbjct: 1044 EESGEYVCTA----TNTAGYAKRKVQLTVY-----VRPRV----FGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRH-TFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPK--HLKVQVGQRVDIPCNA-QGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATN 1245          

HSP 9 Score: 57.7658 bits (138), Expect = 2.767e-7
Identity = 56/230 (24.35%), Postives = 88/230 (38.26%), Query Frame = 1
Query:  835 AMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF--------GTLSINNVQLDDASDFSCLANEVQTRSFKLKVLAL---PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE-DSLKFRKN--ILQIRSLEKKHLGIYQCWLEN 1482
              +L IK  E  D+G Y C A  +      R D    L V  P     P         E  E ++I  T  + +TL C     P   + W   N KR E+              L I   Q  D+ +++C+A+ ++ ++ K   L++   P  + + +         + VE+ C   N +P P I+W  DGK +   E + ++   N   L I        G Y C   N
Sbjct: 3112 GQMLHIKKAEVSDTGQYVCRAINVA----GRDDKNFHLNVYVP-----PSI-------EGPEREVIVETISNPVTLTCDATGIPPPTIAWLK-NHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNA-NGIPTPLIQWLKDGKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVATN 3323          

HSP 10 Score: 55.4546 bits (132), Expect = 1.652e-6
Identity = 81/380 (21.32%), Postives = 150/380 (39.47%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS-------KRYESDTQFGTLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRFSSSPLGISFKSYAR-QTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETES------QRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKW-LRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAE 1830
            PP + +L D  P+    G     + +     +L I++ + +D+G YTC A+ +  K+ +  ++   +       D               E   +   EG+ I+L C     P   + W    S        R    +    L I+  +  DA+ +SC+A+ V     + + L+V   P  ++S    +     R +++ ++CEV   +P PT+ W  DG  ++  K   +    +ILQ++++     G Y C   N      +G+T  K  + +    S        ENIS+++K      ++ L C        S T F   W + L +S+ +  L+G + +   +             T   D G Y C + +   E
Sbjct: 2132 PPTLTWLKDGHPLLKKPG-----LSISENRSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSD---------------ELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEV-QGIPPPTVTWMKDGHPLIKAKGVEILDEGHILQLKNIHVSDTGRYVCVAVN-----VAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKN-----SVSLTCEASGIPLPSITWFKDGWPVSLSNSVRI--LSGGRMLRLMQ-------------TTMEDAGQYTCVVRNAAGE 2465          

HSP 11 Score: 54.6842 bits (130), Expect = 2.431e-6
Identity = 65/237 (27.43%), Postives = 93/237 (39.24%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES-----DTQFGTLSINNVQLDDASDFSCLA-NEV--QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFH-DGKMLTEKEDSL----KFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTV 1515
            L IKN  PKD+G Y C AS       Q S ++    +  PK  +              + +++ A  G    + C     P  +V W+  + +   S     D   G L I   Q  DA D++C+A NE    T    L V + P F   P  +S +      V + C V    P PTIKW   D   +  +  S+    + R   L I +L     G Y C  EN++    S  TV
Sbjct:  666 LFIKNAAPKDAGIYGCLASNSAGTDKQNSTLR---YIEAPKLMV-------------VQSELLVAL-GDITVMECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEPADVSME--IGSNVTLPCYV-QGYPEPTIKWRRLDNMPIFSRPFSVSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTV 882          

HSP 12 Score: 54.299 bits (129), Expect = 3.855e-6
Identity = 65/235 (27.66%), Postives = 100/235 (42.55%), Query Frame = 1
Query:  832 GAMILLIKNLEPKDSGSYTCTASF-LGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF------GTLSINNVQLDDASDFSCLA-NEV--QTRSFKLKVLALPRFSSSPL---GISFKSY---ARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLEN 1482
            G   L I N++   +G YTC AS   G KS   S     L V      + P       D   ++  +I     S  +L C   S P A +TW+  +    ES+          TL I N Q D+A  +SC+A NE     + +++KV   P  +   L   G+S K        T+ ++CE    +P+ ++ W+ DG+ L + +D +    N   LQI+  +    G Y C   N
Sbjct: 2531 GGRFLQITNVQVPHTGRYTCLASSPAGHKSRSFS-----LNVF-----VSPTIAGVGSDGNPEDVTVI---LNSPTSLVCEAYSYPPATITWFK-DGTPLESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAY-AIPSASLSWYKDGQPL-KSDDHVNIAANGHTLQIKEAQISDTGRYTCVASN 2749          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Match: NEO1 (neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754])

HSP 1 Score: 74.3294 bits (181), Expect = 2.340e-12
Identity = 83/317 (26.18%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  604 SLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI 1518
            SLGT+ SR  ++I   L  F     E +    GN   + C +  +    P++ +  +  P+        + I LP G  +L+I N    D G Y C     G   +  SD +  L V    + I     L       K+   +    G ++ L C+    P   + W   N +  ++++         G+L I++V  DDA  + C+A   NE      +L V A P F   P  I    YA ++++I  +CEV    P PT+KW  +G M+   +     +++ LQ+  L K   G YQC  EN+     +G  +I
Sbjct:  135 SLGTIISRTAKLIVAGLPRF-TSQPEPSSVYAGNNAILNCEV--NADLVPFVRWEQNRQPLLLDD----RVIKLPSG--MLVISNATEGDGGLYRCVVESGGPPKY--SD-EVELKVLPDPEVISDLVFL-------KQPSPLVRVIGQDVVLPCVASGLPTPTIKWMK-NEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNI----YAHESMDIVFECEVTGK-PTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLI 426          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Match: NEO1 (neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754])

HSP 1 Score: 73.9442 bits (180), Expect = 3.720e-12
Identity = 83/317 (26.18%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  604 SLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI 1518
            SLGT+ SR  ++I   L  F     E +    GN   + C +  +    P++ +  +  P+        + I LP G  +L+I N    D G Y C     G   +  SD +  L V    + I     L       K+   +    G ++ L C+    P   + W   N +  ++++         G+L I++V  DDA  + C+A   NE      +L V A P F   P  I    YA ++++I  +CEV    P PT+KW  +G M+   +     +++ LQ+  L K   G YQC  EN+     +G  +I
Sbjct:  135 SLGTIISRTAKLIVAGLPRF-TSQPEPSSVYAGNNAILNCEV--NADLVPFVRWEQNRQPLLLDD----RVIKLPSG--MLVISNATEGDGGLYRCVVESGGPPKY--SD-EVELKVLPDPEVISDLVFL-------KQPSPLVRVIGQDVVLPCVASGLPTPTIKWMK-NEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNI----YAHESMDIVFECEVTGK-PTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLI 426          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Match: NEO1 (neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754])

HSP 1 Score: 73.9442 bits (180), Expect = 3.759e-12
Identity = 83/317 (26.18%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  604 SLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI 1518
            SLGT+ SR  ++I   L  F     E +    GN   + C +  +    P++ +  +  P+        + I LP G  +L+I N    D G Y C     G   +  SD +  L V    + I     L       K+   +    G ++ L C+    P   + W   N +  ++++         G+L I++V  DDA  + C+A   NE      +L V A P F   P  I    YA ++++I  +CEV    P PT+KW  +G M+   +     +++ LQ+  L K   G YQC  EN+     +G  +I
Sbjct:  135 SLGTIISRTAKLIVAGLPRF-TSQPEPSSVYAGNNAILNCEV--NADLVPFVRWEQNRQPLLLDD----RVIKLPSG--MLVISNATEGDGGLYRCVVESGGPPKY--SD-EVELKVLPDPEVISDLVFL-------KQPSPLVRVIGQDVVLPCVASGLPTPTIKWMK-NEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNI----YAHESMDIVFECEVTGK-PTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLI 426          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 73.1738 bits (178), Expect = 2.924e-12
Identity = 86/366 (23.50%), Postives = 141/366 (38.52%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD-----TQFGTLSINNVQLDDASDFSCL----ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF---VELQET-ESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            PP I +  D  PI    G  YK+     G + L I N++P   G YTC A         R++  T + ++ P     PR  ++S        +++   EG   T+ C     P   V W   + + Y SD     T+   L +    L D   ++C+    A E QT +  ++VL  PR       +  K     T  + C+V    P P + W  +GK + +      F   +L IR+  +   G Y C   NE        T + DF   V  + T E+     +I++  +A      +EC +     D     T+ WL+      +        ++   + +  +IL      +  D G+Y C
Sbjct: 3064 PPEISWFLDGKPILEMPGVTYKQ-----GDLSLRIDNIKPNQEGRYTCVAE----NKAGRAEQDTYVEISEP-----PRVVMAS--------EVMRVVEGRQTTIRCEVFGNPEPVVNWLK-DGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTT-DVEVLVPPRIEDEERVLQGKE--GNTYMVHCQVTGR-PVPYVTWKRNGKEIEQ------FNP-VLHIRNATRADEGKYSCIASNEAG------TAVADFLIDVFTKPTFETHETTFNIVEGESA-----KIECKI-----DGHPKPTISWLKGGRPFNM------DNIILSPRGDTLMILK----AQRFDGGLYTC 3369          

HSP 2 Score: 68.1662 bits (165), Expect = 8.112e-11
Identity = 75/278 (26.98%), Postives = 109/278 (39.21%), Query Frame = 1
Query:  871 DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG-TLSINNVQLDDASDFSCLA-NEVQTR--SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF-VELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSL 1689
            D G+YTC A    T     S   T + V  P     PR           EE++++  EG+   ++C     P   VTW   N K  E   QF   L I N    D   +SC+A NE  T    F + V   P F +     +F     ++ +I+C++ +  P PTI W   G+        L  R + L I   ++   G+Y C   N +          +DF V +       E I    K  A G  I L+C +L +        TV W R  D++
Sbjct: 3190 DGGTYTCIA----TNKAGESQTTTDVEVLVP-----PRIE--------DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIE---QFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHE--TTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYG------DSEQDFKVNVYTKPYIDETIDQTPKAVAGGEII-LKCPVLGNPTP-----TVTWKRGDDAV 3431          

HSP 3 Score: 64.6994 bits (156), Expect = 9.642e-10
Identity = 77/317 (24.29%), Postives = 130/317 (41.01%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAE-FIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTA-SFLGTKSFQRSD--MKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEAT----EGSNITLYCLYESTPAAEVTWYY------PNSKRYESDTQFGTLSINNVQLDDASDFSCLA------NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            +ARN+ G  +     ++  +++P  L H    E  I G    + C++    P P  I ++ D+ P+      +   I +  G  +L ++   PKD G YTC A S  G  +   +   +K    V  P+  I  +  +S  D   K   ++ +T    +G    + C+   TP   +TWY       PNS+ + + T   TL +       +  ++C A      NE +T    ++++  P    SP   SF         I C+V  + P P I W  D K  TE    +      L I ++ + H G + C  +N
Sbjct:  865 IARNTYGQQSQSTTLMVTGLVSPV-LGHVPPEEQLIEGQDLTLSCVVVLGTPKP-SIVWIKDDKPV-----EEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMD--EKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF-TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKT---TIRIMNTPMI--SPGQSSFNMVVDDLFTIPCDVYGD-PKPVITWLLDDKPFTE---GVVNEDGSLTIPNVNEAHRGTFTCHAQN 1162          

HSP 4 Score: 64.3142 bits (155), Expect = 1.261e-9
Identity = 76/287 (26.48%), Postives = 110/287 (38.33%), Query Frame = 1
Query:  544 LKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMI-PHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-----YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQ--TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK 1377
            L I   +   E     +A N  GT  +    +I     P    H  +   + G   +I C I  H KP+   I +L    P N         I L P    L+I   +  D G YTC A    T S+  S+   ++ V T     KP         +   ++  +A  G  I L C     P   VTW       PN  R+     +  L IN+V  +DA  +SC+A NE    T  +  +V+  P F     G  ++     T+ + C V +  P P+I WF   K
Sbjct: 3264 LHIRNATRADEGKYSCIASNEAGTAVAD--FLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT---ISWLKGGRPFN------MDNIILSPRGDTLMILKAQRFDGGLYTCVA----TNSYGDSEQDFKVNVYT-----KPYI-------DETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNY-DLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKG-GNLYEVIENDTITMDCGVTSR-PLPSISWFRGDK 3520          

HSP 5 Score: 63.1586 bits (152), Expect = 2.729e-9
Identity = 91/356 (25.56%), Postives = 140/356 (39.33%), Query Frame = 1
Query:  517 YLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSK------RYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRS--FKLKVLALPRFSSSPLGISFKS---YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIR--SLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQE 1542
            Y  NE+   L +    L  E   +  A N  G +T + F++I  +  P+ L   +    I+G    + C    +   PP I F+ D   +N +                L+I N + +  G YTC A         RS+    + V  P K       LS      KE   +E   G  +TL C  E T    +TW     K      R +S +    L I     +DA  +SC+A N+       F++ V   P+      G SF +    A  T+EI C     +P P I WF DGK + E    + +++  L +R  +++    G Y C  EN+     +G      +VE+ E
Sbjct: 2811 YAANEK--TLNVTNIQLDDEGFYYCTAVNEAG-ITKKFFKLI-VIETPYFLDQQKLYPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEVDII-------GSTLVIDNPQKEVEGRYTCIAE----NKAGRSEKDMMVEVLLPPK-------LS------KEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKI----FGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMP-GVTYKQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISE 3125          

HSP 6 Score: 59.3066 bits (142), Expect = 4.242e-8
Identity = 61/283 (21.55%), Postives = 107/283 (37.81%), Query Frame = 1
Query:  706 VGQIVCMIPHSKPSPPYIEFLHDNVPINTT--KGSKYKKIYLPPGAMIL--------------LIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--------PNSKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            +G ++   P +  SP + EF+  ++ ++ T    S Y   ++  G  I+               I  L  KD+G Y C                 R+        +K R        E    + +    G    L+C   S    E+ W          PN++R  ++   GTL I++V   DA  + C+   A  + TR  +L ++  P    +P  + F    R+ V + CE + + P P + W+  G+ +L + +  +      L IR       G Y+C
Sbjct:  422 IGSVIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYEC-----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTN---GTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFN--MREGVNLSCEAMGD-PKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYEC 681          

HSP 7 Score: 58.9214 bits (141), Expect = 5.596e-8
Identity = 56/225 (24.89%), Postives = 85/225 (37.78%), Query Frame = 1
Query:  829 PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-----NSKRYESDTQFGTLSINNVQLDDASDFSC--LANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            P    L I ++   D+G Y C A   G  S +    K RL +  P     P  +++  D            EG N  L C     P  EV WY+      N  +Y+       L I +    D   + C  ++   Q R     +LA P      +           V  +C+ +   P+P I+WF +GK L + +D +K  +  L I   + +  G Y C  EN
Sbjct:  570 PTNGTLKIHHVTRADAGVYECMARNAGGMSTR----KMRLDIMEP-----PSVKVTPQD------VYFNMREGVN--LSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPP-KVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGEN 776          

HSP 8 Score: 55.8398 bits (133), Expect = 4.999e-7
Identity = 47/217 (21.66%), Postives = 88/217 (40.55%), Query Frame = 1
Query:  847 LIKNLEPK--DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN------SKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            LIK L  +  D G Y+CTA+     + Q++++   +    PK   +PR ++                +G  +TL+C     P   +TWY  N           + T+  ++  +++    A  ++C A N V +    + ++ +      P  ++  +  RQTV + C     +P P I W  D  +  +  +  +     L IR++     G Y C
Sbjct: 4319 LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVA---PKIMERPRTQV--------------VHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNA-TGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHC 4517          

HSP 9 Score: 55.0694 bits (131), Expect = 7.111e-7
Identity = 68/308 (22.08%), Postives = 113/308 (36.69%), Query Frame = 1
Query:  673 HHESAEF---IMGNVGQIVCMIPHSKPSPPYIEFLHDNVPIN----------TTKGSKYKKI--------------YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-------NSKRYESDTQF--GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQC 1470
            HH+   +    M   GQ          +PP +E + + + +           T +G  + KI              Y+      L I   + +D+G+Y+C    +  K  Q +++      T  +     R  +     ER+            +TL CL    P  E+ W          N+ RY   TQ   G L I + Q++D   F+C+A      Q++S  L V  L  P     P     +    Q + + C V+   P P+I W  D K + E     ++   ++L++R    K  G Y C
Sbjct:  673 HHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNI-----ERQ------------VTLQCLAVGIPPPEIEWQKGNVLLATLNNPRY---TQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPP--EEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTC 958          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 72.7886 bits (177), Expect = 3.100e-12
Identity = 86/366 (23.50%), Postives = 141/366 (38.52%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD-----TQFGTLSINNVQLDDASDFSCL----ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF---VELQET-ESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            PP I +  D  PI    G  YK+     G + L I N++P   G YTC A         R++  T + ++ P     PR  ++S        +++   EG   T+ C     P   V W   + + Y SD     T+   L +    L D   ++C+    A E QT +  ++VL  PR       +  K     T  + C+V    P P + W  +GK + +      F   +L IR+  +   G Y C   NE        T + DF   V  + T E+     +I++  +A      +EC +     D     T+ WL+      +        ++   + +  +IL      +  D G+Y C
Sbjct: 3064 PPEISWFLDGKPILEMPGVTYKQ-----GDLSLRIDNIKPNQEGRYTCVAE----NKAGRAEQDTYVEISEP-----PRVVMAS--------EVMRVVEGRQTTIRCEVFGNPEPVVNWLK-DGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTT-DVEVLVPPRIEDEERVLQGKE--GNTYMVHCQVTGR-PVPYVTWKRNGKEIEQ------FNP-VLHIRNATRADEGKYSCIASNEAG------TAVADFLIDVFTKPTFETHETTFNIVEGESA-----KIECKI-----DGHPKPTISWLKGGRPFNM------DNIILSPRGDTLMILK----AQRFDGGLYTC 3369          

HSP 2 Score: 68.1662 bits (165), Expect = 8.529e-11
Identity = 75/278 (26.98%), Postives = 109/278 (39.21%), Query Frame = 1
Query:  871 DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG-TLSINNVQLDDASDFSCLA-NEVQTR--SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF-VELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSL 1689
            D G+YTC A    T     S   T + V  P     PR           EE++++  EG+   ++C     P   VTW   N K  E   QF   L I N    D   +SC+A NE  T    F + V   P F +     +F     ++ +I+C++ +  P PTI W   G+        L  R + L I   ++   G+Y C   N +          +DF V +       E I    K  A G  I L+C +L +        TV W R  D++
Sbjct: 3190 DGGTYTCIA----TNKAGESQTTTDVEVLVP-----PRIE--------DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIE---QFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHE--TTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYG------DSEQDFKVNVYTKPYIDETIDQTPKAVAGGEII-LKCPVLGNPTP-----TVTWKRGDDAV 3431          

HSP 3 Score: 64.6994 bits (156), Expect = 9.804e-10
Identity = 77/317 (24.29%), Postives = 130/317 (41.01%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAE-FIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTA-SFLGTKSFQRSD--MKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEAT----EGSNITLYCLYESTPAAEVTWYY------PNSKRYESDTQFGTLSINNVQLDDASDFSCLA------NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            +ARN+ G  +     ++  +++P  L H    E  I G    + C++    P P  I ++ D+ P+      +   I +  G  +L ++   PKD G YTC A S  G  +   +   +K    V  P+  I  +  +S  D   K   ++ +T    +G    + C+   TP   +TWY       PNS+ + + T   TL +       +  ++C A      NE +T    ++++  P    SP   SF         I C+V  + P P I W  D K  TE    +      L I ++ + H G + C  +N
Sbjct:  865 IARNTYGQQSQSTTLMVTGLVSPV-LGHVPPEEQLIEGQDLTLSCVVVLGTPKP-SIVWIKDDKPV-----EEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMD--EKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF-TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKT---TIRIMNTPMI--SPGQSSFNMVVDDLFTIPCDVYGD-PKPVITWLLDDKPFTE---GVVNEDGSLTIPNVNEAHRGTFTCHAQN 1162          

HSP 4 Score: 64.3142 bits (155), Expect = 1.219e-9
Identity = 76/287 (26.48%), Postives = 110/287 (38.33%), Query Frame = 1
Query:  544 LKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMI-PHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-----YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQ--TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK 1377
            L I   +   E     +A N  GT  +    +I     P    H  +   + G   +I C I  H KP+   I +L    P N         I L P    L+I   +  D G YTC A    T S+  S+   ++ V T     KP         +   ++  +A  G  I L C     P   VTW       PN  R+     +  L IN+V  +DA  +SC+A NE    T  +  +V+  P F     G  ++     T+ + C V +  P P+I WF   K
Sbjct: 3264 LHIRNATRADEGKYSCIASNEAGTAVAD--FLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT---ISWLKGGRPFN------MDNIILSPRGDTLMILKAQRFDGGLYTCVA----TNSYGDSEQDFKVNVYT-----KPYI-------DETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNY-DLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKG-GNLYEVIENDTITMDCGVTSR-PLPSISWFRGDK 3520          

HSP 5 Score: 63.5438 bits (153), Expect = 2.386e-9
Identity = 91/356 (25.56%), Postives = 140/356 (39.33%), Query Frame = 1
Query:  517 YLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSK------RYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRS--FKLKVLALPRFSSSPLGISFKS---YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIR--SLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQE 1542
            Y  NE+   L +    L  E   +  A N  G +T + F++I  +  P+ L   +    I+G    + C    +   PP I F+ D   +N +                L+I N + +  G YTC A         RS+    + V  P K       LS      KE   +E   G  +TL C  E T    +TW     K      R +S +    L I     +DA  +SC+A N+       F++ V   P+      G SF +    A  T+EI C     +P P I WF DGK + E    + +++  L +R  +++    G Y C  EN+     +G      +VE+ E
Sbjct: 2811 YAANEK--TLNVTNIQLDDEGFYYCTAVNEAG-ITKKFFKLI-VIETPYFLDQQKLYPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEVDII-------GSTLVIDNPQKEVEGRYTCIAE----NKAGRSEKDMMVEVLLPPK-------LS------KEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKI----FGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMP-GVTYKQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISE 3125          

HSP 6 Score: 61.6178 bits (148), Expect = 8.471e-9
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 1
Query:  850 IKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYC---LYE--STPAAEVTWYYPNSKRYESD--------TQFGTLSINNVQLDDASDFSCLA-NEVQTRS--FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLENEWNL 1494
            I+N++  D G YTCTA+  G K+         L V +P     P F +       K        EG  ITL C   L E  +    +V+W   +S+  + D             L+I+   L++A  ++C+A N     S  FK+++L+ P    S   +  +    Q   ++C V  + P P+IKW  +GK +T+ E+  +  +  +LQI   +  H G + C  EN+  +
Sbjct: 3633 IENVQVTDQGRYTCTATNRGGKASH----DFSLDVLSP-----PEFDIHGTQPTIKR-------EGDTITLTCPIKLAEDIADQVMDVSWTK-DSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGH-PFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGV 3846          

HSP 7 Score: 59.3066 bits (142), Expect = 4.575e-8
Identity = 61/283 (21.55%), Postives = 107/283 (37.81%), Query Frame = 1
Query:  706 VGQIVCMIPHSKPSPPYIEFLHDNVPINTT--KGSKYKKIYLPPGAMIL--------------LIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--------PNSKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            +G ++   P +  SP + EF+  ++ ++ T    S Y   ++  G  I+               I  L  KD+G Y C                 R+        +K R        E    + +    G    L+C   S    E+ W          PN++R  ++   GTL I++V   DA  + C+   A  + TR  +L ++  P    +P  + F    R+ V + CE + + P P + W+  G+ +L + +  +      L IR       G Y+C
Sbjct:  422 IGSVIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYEC-----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTN---GTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFN--MREGVNLSCEAMGD-PKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYEC 681          

HSP 8 Score: 58.9214 bits (141), Expect = 5.642e-8
Identity = 58/227 (25.55%), Postives = 89/227 (39.21%), Query Frame = 1
Query:  829 PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-----NSKRYE--SDTQFGTLSINNVQLDDASDFSC--LANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            P    L I ++   D+G Y C A   G  S +    K RL +  P     P  +++  D            EG N  L C     P  EV WY+      N  +Y+   D++F  L I +    D   + C  ++   Q R     +LA P      +           V  +C+ +   P+P I+WF +GK L + +D +K  +  L I   + +  G Y C  EN
Sbjct:  570 PTNGTLKIHHVTRADAGVYECMARNAGGMSTR----KMRLDIMEP-----PSVKVTPQD------VYFNMREGVN--LSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKF--LYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPP-KVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGEN 776          

HSP 9 Score: 55.8398 bits (133), Expect = 4.957e-7
Identity = 47/217 (21.66%), Postives = 88/217 (40.55%), Query Frame = 1
Query:  847 LIKNLEPK--DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN------SKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            LIK L  +  D G Y+CTA+     + Q++++   +    PK   +PR ++                +G  +TL+C     P   +TWY  N           + T+  ++  +++    A  ++C A N V +    + ++ +      P  ++  +  RQTV + C     +P P I W  D  +  +  +  +     L IR++     G Y C
Sbjct: 4281 LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVA---PKIMERPRTQV--------------VHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNA-TGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHC 4479          

HSP 10 Score: 55.0694 bits (131), Expect = 6.818e-7
Identity = 68/308 (22.08%), Postives = 113/308 (36.69%), Query Frame = 1
Query:  673 HHESAEF---IMGNVGQIVCMIPHSKPSPPYIEFLHDNVPIN----------TTKGSKYKKI--------------YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-------NSKRYESDTQF--GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQC 1470
            HH+   +    M   GQ          +PP +E + + + +           T +G  + KI              Y+      L I   + +D+G+Y+C    +  K  Q +++      T  +     R  +     ER+            +TL CL    P  E+ W          N+ RY   TQ   G L I + Q++D   F+C+A      Q++S  L V  L  P     P     +    Q + + C V+   P P+I W  D K + E     ++   ++L++R    K  G Y C
Sbjct:  673 HHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNI-----ERQ------------VTLQCLAVGIPPPEIEWQKGNVLLATLNNPRY---TQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPP--EEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTC 958          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 72.7886 bits (177), Expect = 3.205e-12
Identity = 86/366 (23.50%), Postives = 141/366 (38.52%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD-----TQFGTLSINNVQLDDASDFSCL----ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF---VELQET-ESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            PP I +  D  PI    G  YK+     G + L I N++P   G YTC A         R++  T + ++ P     PR  ++S        +++   EG   T+ C     P   V W   + + Y SD     T+   L +    L D   ++C+    A E QT +  ++VL  PR       +  K     T  + C+V    P P + W  +GK + +      F   +L IR+  +   G Y C   NE        T + DF   V  + T E+     +I++  +A      +EC +     D     T+ WL+      +        ++   + +  +IL      +  D G+Y C
Sbjct: 3064 PPEISWFLDGKPILEMPGVTYKQ-----GDLSLRIDNIKPNQEGRYTCVAE----NKAGRAEQDTYVEISEP-----PRVVMAS--------EVMRVVEGRQTTIRCEVFGNPEPVVNWLK-DGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTT-DVEVLVPPRIEDEERVLQGKE--GNTYMVHCQVTGR-PVPYVTWKRNGKEIEQ------FNP-VLHIRNATRADEGKYSCIASNEAG------TAVADFLIDVFTKPTFETHETTFNIVEGESA-----KIECKI-----DGHPKPTISWLKGGRPFNM------DNIILSPRGDTLMILK----AQRFDGGLYTC 3369          

HSP 2 Score: 68.1662 bits (165), Expect = 8.527e-11
Identity = 75/278 (26.98%), Postives = 108/278 (38.85%), Query Frame = 1
Query:  871 DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG-TLSINNVQLDDASDFSCLA-NEVQTR--SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDF-VELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSL 1689
            D G+YTC A    T     S   T + V  P     PR           EE++++  EG+   ++C     P   VTW   N K  E   QF   L I N    D   +SC+A NE  T    F + V   P F +     +F     ++ +I+C++ +  P PTI W   G+        L  R + L I   ++   G+Y C   N +          +DF V +       E I    K  A G  I L+C +L          TV W R  D++
Sbjct: 3190 DGGTYTCIA----TNKAGESQTTTDVEVLVP-----PRIE--------DEERVLQGKEGNTYMVHCQVTGRPVPYVTWKR-NGKEIE---QFNPVLHIRNATRADEGKYSCIASNEAGTAVADFLIDVFTKPTFETHE--TTFNIVEGESAKIECKI-DGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVATNSYG------DSEQDFKVNVYTKPYIDETIDQTPKAVAGGEII-LKCPVL-----GNPTPTVTWKRGDDAV 3431          

HSP 3 Score: 64.6994 bits (156), Expect = 9.801e-10
Identity = 77/317 (24.29%), Postives = 130/317 (41.01%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAE-FIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTA-SFLGTKSFQRSD--MKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEAT----EGSNITLYCLYESTPAAEVTWYY------PNSKRYESDTQFGTLSINNVQLDDASDFSCLA------NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            +ARN+ G  +     ++  +++P  L H    E  I G    + C++    P P  I ++ D+ P+      +   I +  G  +L ++   PKD G YTC A S  G  +   +   +K    V  P+  I  +  +S  D   K   ++ +T    +G    + C+   TP   +TWY       PNS+ + + T   TL +       +  ++C A      NE +T    ++++  P    SP   SF         I C+V  + P P I W  D K  TE    +      L I ++ + H G + C  +N
Sbjct:  865 IARNTYGQQSQSTTLMVTGLVSPV-LGHVPPEEQLIEGQDLTLSCVVVLGTPKP-SIVWIKDDKPV-----EEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVYKPEGGIVFKPTISGMD--EKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF-TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKT---TIRIMNTPMI--SPGQSSFNMVVDDLFTIPCDVYGD-PKPVITWLLDDKPFTE---GVVNEDGSLTIPNVNEAHRGTFTCHAQN 1162          

HSP 4 Score: 64.3142 bits (155), Expect = 1.293e-9
Identity = 76/287 (26.48%), Postives = 110/287 (38.33%), Query Frame = 1
Query:  544 LKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMI-PHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-----YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQ--TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK 1377
            L I   +   E     +A N  GT  +    +I     P    H  +   + G   +I C I  H KP+   I +L    P N         I L P    L+I   +  D G YTC A    T S+  S+   ++ V T     KP         +   ++  +A  G  I L C     P   VTW       PN  R+     +  L IN+V  +DA  +SC+A NE    T  +  +V+  P F     G  ++     T+ + C V +  P P+I WF   K
Sbjct: 3264 LHIRNATRADEGKYSCIASNEAGTAVAD--FLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT---ISWLKGGRPFN------MDNIILSPRGDTLMILKAQRFDGGLYTCVA----TNSYGDSEQDFKVNVYT-----KPYI-------DETIDQTPKAVAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNY-DLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKPTFVRKG-GNLYEVIENDTITMDCGVTSR-PLPSISWFRGDK 3520          

HSP 5 Score: 63.1586 bits (152), Expect = 2.638e-9
Identity = 91/356 (25.56%), Postives = 140/356 (39.33%), Query Frame = 1
Query:  517 YLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSK------RYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRS--FKLKVLALPRFSSSPLGISFKS---YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIR--SLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQE 1542
            Y  NE+   L +    L  E   +  A N  G +T + F++I  +  P+ L   +    I+G    + C    +   PP I F+ D   +N +                L+I N + +  G YTC A         RS+    + V  P K       LS      KE   +E   G  +TL C  E T    +TW     K      R +S +    L I     +DA  +SC+A N+       F++ V   P+      G SF +    A  T+EI C     +P P I WF DGK + E    + +++  L +R  +++    G Y C  EN+     +G      +VE+ E
Sbjct: 2811 YAANEK--TLNVTNIQLDDEGFYYCTAVNEAG-ITKKFFKLI-VIETPYFLDQQKLYPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEVDII-------GSTLVIDNPQKEVEGRYTCIAE----NKAGRSEKDMMVEVLLPPK-------LS------KEWINVEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLDMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTVNTPPKI----FGDSFSTTEIVADTTLEIPCRT-EGIPPPEISWFLDGKPILEMP-GVTYKQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISE 3125          

HSP 6 Score: 61.6178 bits (148), Expect = 8.469e-9
Identity = 62/232 (26.72%), Postives = 103/232 (44.40%), Query Frame = 1
Query:  850 IKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYC---LYE--STPAAEVTWYYPNSKRYESD--------TQFGTLSINNVQLDDASDFSCLA-NEVQTRS--FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLENEWNL 1494
            I+N++  D G YTCTA+  G K+         L V +P     P F +       K        EG  ITL C   L E  +    +V+W   +S+  + D             L+I+   L++A  ++C+A N     S  FK+++L+ P    S   +  +    Q   ++C V  + P P+IKW  +GK +T+ E+  +  +  +LQI   +  H G + C  EN+  +
Sbjct: 3633 IENVQVTDQGRYTCTATNRGGKASH----DFSLDVLSP-----PEFDIHGTQPTIKR-------EGDTITLTCPIKLAEDIADQVMDVSWTK-DSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGH-PFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGV 3846          

HSP 7 Score: 58.9214 bits (141), Expect = 4.651e-8
Identity = 61/283 (21.55%), Postives = 107/283 (37.81%), Query Frame = 1
Query:  706 VGQIVCMIPHSKPSPPYIEFLHDNVPINTT--KGSKYKKIYLPPGAMIL--------------LIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--------PNSKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            +G ++   P +  SP + EF+  ++ ++ T    S Y   ++  G  I+               I  L  KD+G Y C                 R+        +K R        E    + +    G    L+C   S    E+ W          PN++R  ++   GTL I++V   DA  + C+   A  + TR  +L ++  P    +P  + F    R+ V + CE + + P P + W+  G+ +L + +  +      L IR       G Y+C
Sbjct:  422 IGSVIVGGPRAFMSPIHQEFVGRDLNLSCTVESASAYTIYWVKTGEDIIGGPLFYHNTDTSVWTIPELSLKDAGEYEC-----------------RVISNNGNYSVKTRVETRESPPEIFGVRNVSVPLGEAAFLHCSTRSAGEVEIRWTRYGATVFNGPNTERNPTN---GTLKIHHVTRADAGVYECMARNAGGMSTRKMRLDIMEPPSVKVTPQDVYFN--MREGVNLSCEAMGD-PKPEVHWYFKGRHLLNDYKYQVGQDSKFLYIRDATHHDEGTYEC 681          

HSP 8 Score: 58.9214 bits (141), Expect = 5.932e-8
Identity = 58/227 (25.55%), Postives = 89/227 (39.21%), Query Frame = 1
Query:  829 PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-----NSKRYE--SDTQFGTLSINNVQLDDASDFSC--LANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            P    L I ++   D+G Y C A   G  S +    K RL +  P     P  +++  D            EG N  L C     P  EV WY+      N  +Y+   D++F  L I +    D   + C  ++   Q R     +LA P      +           V  +C+ +   P+P I+WF +GK L + +D +K  +  L I   + +  G Y C  EN
Sbjct:  570 PTNGTLKIHHVTRADAGVYECMARNAGGMSTR----KMRLDIMEP-----PSVKVTPQD------VYFNMREGVN--LSCEAMGDPKPEVHWYFKGRHLLNDYKYQVGQDSKF--LYIRDATHHDEGTYECRAMSQAGQARDTTDLMLATPP-KVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGEN 776          

HSP 9 Score: 55.8398 bits (133), Expect = 5.082e-7
Identity = 47/217 (21.66%), Postives = 88/217 (40.55%), Query Frame = 1
Query:  847 LIKNLEPK--DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN------SKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            LIK L  +  D G Y+CTA+     + Q++++   +    PK   +PR ++                +G  +TL+C     P   +TWY  N           + T+  ++  +++    A  ++C A N V +    + ++ +      P  ++  +  RQTV + C     +P P I W  D  +  +  +  +     L IR++     G Y C
Sbjct: 4281 LIKILSTRLSDQGEYSCTAANKAGNATQKTNLNVGVA---PKIMERPRTQV--------------VHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKAENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNA-TGIPEPVISWMRDSNIAIQNNEKYQILGTTLAIRNVLPDDDGFYHC 4479          

HSP 10 Score: 55.0694 bits (131), Expect = 6.932e-7
Identity = 68/308 (22.08%), Postives = 113/308 (36.69%), Query Frame = 1
Query:  673 HHESAEF---IMGNVGQIVCMIPHSKPSPPYIEFLHDNVPIN----------TTKGSKYKKI--------------YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-------NSKRYESDTQF--GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQC 1470
            HH+   +    M   GQ          +PP +E + + + +           T +G  + KI              Y+      L I   + +D+G+Y+C    +  K  Q +++      T  +     R  +     ER+            +TL CL    P  E+ W          N+ RY   TQ   G L I + Q++D   F+C+A      Q++S  L V  L  P     P     +    Q + + C V+   P P+I W  D K + E     ++   ++L++R    K  G Y C
Sbjct:  673 HHDEGTYECRAMSQAGQARDTTDLMLATPPKVEIIQNKMMVGRGDRVSFECKTIRGKPHPKIRWFKNGKDLIKPDDYIKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRVPTIIESPHTVRVNI-----ERQ------------VTLQCLAVGIPPPEIEWQKGNVLLATLNNPRY---TQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMVTGLVSPVLGHVPP--EEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTC 958          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 70.4774 bits (171), Expect = 1.576e-11
Identity = 102/399 (25.56%), Postives = 160/399 (40.10%), Query Frame = 1
Query:  832 GAMILLIKNLEPKDSGSYTCTAS----FLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD--------TQFGTLSINNVQLDDASDFSCLA-NEVQTRSFK--LKVLALPRFSSS-------------------PLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK--------MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASG--VTVIKDFVELQETESQ-RENIS------IIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQK 1875
            G   L IKN    D G+Y C A+       TKSF R D      V T  +   PRF L   D        +  TEG  + L C  +++P  E+ WY   +    SD            TL I +   DD   +  +A N   T   K    V  LPR S +                   PL  + +   +Q+  ++C+   + P PTIKWF DG+         L E  D +      L + S  ++  G Y+C  EN +    +   V VI+   + ++ +S  RE  +      +  +R  PG ++  EC    +   S     +KW  LKD LEL     ++ +  +  ++GT  L I++    L EG + C   +++     + K +L I+  +
Sbjct: 4537 GVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQ--PPRFTLKMGD--------VRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLE-NIRIPEKQSFRLRCKFSGD-PKPTIKWFKDGERVFPYGRLQLIESPDGV----CELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFPS-----IKW--LKDGLELFS---DEKIKMEAAADGTQRL-ILSDVTFLSEGYFRCVATNEHG--TASTKAELVIEGDR 4906          

HSP 2 Score: 62.3882 bits (150), Expect = 4.536e-9
Identity = 91/392 (23.21%), Postives = 150/392 (38.27%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRF--RLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-------YPNSKRYESDTQFG--TLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYAR-------QTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN------ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQK--------DSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAE 1830
            P +E+L D  P+ T       K+    G+  + IK+   +DSG Y C A+          + KT       K  + P F  +LS           +E  E  + TL      TP   V W+         N    +  T  G  +L+IN+ +  D   +SC A      +       + R S  P    F    R       +T+++K  V+   P P ++WF D K +   ++S  F K+       L I+    + +G+Y C   NE               E + T     N+++ ++  AP     L+   ++  K        + K    VKW   KD + +     N++V+ KK   G+  L ++  T N D G Y CQ  ++  +
Sbjct: 2202 PSVEWLKDGQPVQTDSSHVIAKVE-GSGSYSITIKDARLEDSGKYACRATNPA------GEAKTEANFAVVKNLVPPEFVEKLSP----------LEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPP---EFTQKLRPLEVREQETLDLKVTVI-GTPVPNVEWFKDDKPIN-IDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAG-------------EAKTT----ANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI--AIDNQHVIEKKGENGSHTL-VIKDTNNADFGKYTCQATNKAGK 2549          

HSP 3 Score: 59.6918 bits (143), Expect = 3.096e-8
Identity = 77/317 (24.29%), Postives = 124/317 (39.12%), Query Frame = 1
Query:  820 YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIK-----PRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--------PNSKRYESDTQFGTLSINNVQLDDASDFSCLA----NEVQTRSFKLKVLAL-------------PRF--SSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEK---EDSLKFRKNILQIR--SLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQE-------TESQ--RENISIIDKRTAPGLTIHLECSLLQS 1632
            Y   G   L I +   +D G+Y C A    T +    +    + V  PK+++K     P F     D        + A  G + TL C     P  E+ WY         P +    S     +L++N   + D   + C A     + +T++     +AL             P+F    S + +S  +     ++++C+V   +PNP++KW  DG  L E    E S +  K + Q+R  +      G Y+C   NE     +G    K FV + +       T SQ  R  + + D RT  G  + LEC +  S
Sbjct: 4320 YEEDGTATLAINDSTEEDIGAYRCVA----TNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVD--------LWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGN----VIDLECKV-TGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNE-----NGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKVDAS 4614          

HSP 4 Score: 53.5286 bits (127), Expect = 2.446e-6
Identity = 96/480 (20.00%), Postives = 187/480 (38.96%), Query Frame = 1
Query:  487 IIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS----------KRYESDTQFGTLSINNVQLDDASDFSCL----ANEVQTRS--FKLKVLALPRFSS--SPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLT-------EKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWN--LWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTV 1845
            I   SR  +++ +    W++ I + +     S   +A NS+GT TS   +I  KV  P   V  +  +       + + M      S P +E+  D+ P++     + KK     G   L++K     D+G YT  AS     +   ++ +   ++       KP F         +E    E       TL    +  P   V W                + E    + +++I + +L+D+  ++C     A E +T +    +K L  P F    SPL +  K     +V++        P P+++WF D   ++       +K+ ++      L I    +  +GIY C   NE    L  +   +I+D +  + T+  R  + + ++      T+ L+ +++ +   +     V+W +    + +     N ++  K +  G   L+I    +  D G+Y C+  ++  E   T 
Sbjct: 2020 ITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATST-SKITTKVEAP---VFEQGLKKTSVKEKEEIKMEVKVGGSAPDVEWFKDDKPVSEDGNHEMKK-NPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLE------KPTF--------VRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSY-SITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVV-----GTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFS--LTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRP-LEVREQE-----TLDLKVTVIGTPVPN-----VEWFKDDKPINI----DNSHIFAKDEGSGHHTLTIKQ-ARGEDVGVYTCKATNEAGEAKTTA 2456          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 70.4774 bits (171), Expect = 1.763e-11
Identity = 102/399 (25.56%), Postives = 160/399 (40.10%), Query Frame = 1
Query:  832 GAMILLIKNLEPKDSGSYTCTAS----FLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD--------TQFGTLSINNVQLDDASDFSCLA-NEVQTRSFK--LKVLALPRFSSS-------------------PLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK--------MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASG--VTVIKDFVELQETESQ-RENIS------IIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQK 1875
            G   L IKN    D G+Y C A+       TKSF R D      V T  +   PRF L   D        +  TEG  + L C  +++P  E+ WY   +    SD            TL I +   DD   +  +A N   T   K    V  LPR S +                   PL  + +   +Q+  ++C+   + P PTIKWF DG+         L E  D +      L + S  ++  G Y+C  EN +    +   V VI+   + ++ +S  RE  +      +  +R  PG ++  EC    +   S     +KW  LKD LEL     ++ +  +  ++GT  L I++    L EG + C   +++     + K +L I+  +
Sbjct: 5010 GVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQ--PPRFTLKMGD--------VRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEPLE-NIRIPEKQSFRLRCKFSGD-PKPTIKWFKDGERVFPYGRLQLIESPDGV----CELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSVTFECLPFGNPFPS-----IKW--LKDGLELFS---DEKIKMEAAADGTQRL-ILSDVTFLSEGYFRCVATNEHG--TASTKAELVIEGDR 5379          

HSP 2 Score: 62.3882 bits (150), Expect = 4.287e-9
Identity = 91/385 (23.64%), Postives = 147/385 (38.18%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRF--RLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-------YPNSKRYESDTQFG--TLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYAR-------QTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN------ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQK--------DSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQ 1809
            P +E+L D  P+ T       K+    G+  + IK+   +DSG Y C A+          + KT       K  + P F  +LS           +E  E  + TL      TP   V W+         N    +  T  G  +L+IN+ +  D   +SC A      +       + R S  P    F    R       +T+++K  V+   P P ++WF D K +   ++S  F K+       L I+    + +G+Y C   NE               E + T     N+++ ++  AP     L+   ++  K        + K    VKW   KD + +     N++V+ KK   G+  L ++  T N D G Y CQ
Sbjct: 2675 PSVEWLKDGQPVQTDSSHVIAKVE-GSGSYSITIKDARLEDSGKYACRATNPA------GEAKTEANFAVVKNLVPPEFVEKLSP----------LEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPP---EFTQKLRPLEVREQETLDLKVTVI-GTPVPNVEWFKDDKPIN-IDNSHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAG-------------EAKTT----ANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI--AIDNQHVIEKKGENGSHTL-VIKDTNNADFGKYTCQ 3015          

HSP 3 Score: 59.6918 bits (143), Expect = 3.051e-8
Identity = 77/317 (24.29%), Postives = 124/317 (39.12%), Query Frame = 1
Query:  820 YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIK-----PRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--------PNSKRYESDTQFGTLSINNVQLDDASDFSCLA----NEVQTRSFKLKVLAL-------------PRF--SSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEK---EDSLKFRKNILQIR--SLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQE-------TESQ--RENISIIDKRTAPGLTIHLECSLLQS 1632
            Y   G   L I +   +D G+Y C A    T +    +    + V  PK+++K     P F     D        + A  G + TL C     P  E+ WY         P +    S     +L++N   + D   + C A     + +T++     +AL             P+F    S + +S  +     ++++C+V   +PNP++KW  DG  L E    E S +  K + Q+R  +      G Y+C   NE     +G    K FV + +       T SQ  R  + + D RT  G  + LEC +  S
Sbjct: 4793 YEEDGTATLAINDSTEEDIGAYRCVA----TNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVD--------LWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGN----VIDLECKV-TGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNE-----NGSATTKSFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKVDAS 5087          

HSP 4 Score: 53.1434 bits (126), Expect = 2.711e-6
Identity = 96/480 (20.00%), Postives = 187/480 (38.96%), Query Frame = 1
Query:  487 IIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS----------KRYESDTQFGTLSINNVQLDDASDFSCL----ANEVQTRS--FKLKVLALPRFSS--SPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLT-------EKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWN--LWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTV 1845
            I   SR  +++ +    W++ I + +     S   +A NS+GT TS   +I  KV  P   V  +  +       + + M      S P +E+  D+ P++     + KK     G   L++K     D+G YT  AS     +   ++ +   ++       KP F         +E    E       TL    +  P   V W                + E    + +++I + +L+D+  ++C     A E +T +    +K L  P F    SPL +  K     +V++        P P+++WF D   ++       +K+ ++      L I    +  +GIY C   NE    L  +   +I+D +  + T+  R  + + ++      T+ L+ +++ +   +     V+W +    + +     N ++  K +  G   L+I    +  D G+Y C+  ++  E   T 
Sbjct: 2493 ITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTS-KITTKVEAP---VFEQGLKKTSVKEKEEIKMEVKVGGSAPDVEWFKDDKPVSEDGNHEMKK-NPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLE------KPTF--------VRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSY-SITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVV-----GTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFS--LTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRP-LEVREQE-----TLDLKVTVIGTPVPN-----VEWFKDDKPINI----DNSHIFAKDEGSGHHTLTIKQ-ARGEDVGVYTCKATNEAGEAKTTA 2929          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111078)

HSP 1 Score: 80.8777 bits (198), Expect = 1.243e-14
Identity = 84/320 (26.25%), Postives = 133/320 (41.56%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL--HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------------FGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIK------CEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LARN  G++ SR   + R V+  +          I GN   I C+IP       ++E +  H +   N   G++Y   YL   +  L I+ + P+D   SY C      T   + S  K RL +T P   +KP+       N + + +  E ++G  I L C  +S P     WY    K  E  T+              GTL I +  ++D+  + C+ N          VL +    ++PL         QTV+        C+   N P  T+ W  DGK +   E        +L+I S++K+  G+YQC++ N+
Sbjct:  118 LARNQFGSIISRDVHV-RAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVAD--FVEVVSWHTDEEENYFPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVKPKI------NVQDKLQTREISQGIGIALLCPAQSYPIPAHRWY----KFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV----TAPLSAKIDP-PTQTVDFGRPAVFTCQYTGN-PIKTVSWMKDGKAIGHSEP-------VLRIESVKKEDKGMYQCFVRND 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0306785)

HSP 1 Score: 80.8777 bits (198), Expect = 1.308e-14
Identity = 87/323 (26.93%), Postives = 132/323 (40.87%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPI-----NTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------------FGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIK------CEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LARN  G++ SR   + R V++ F +   E+   I GN   + C IP        +E   D   +     N T     K + LP G   L I+ + P+D   SY C      T   + S  K RL +T P   + PR  LS  D      K+++ +     TL C  +S P     WY    K  E  T+              GTL I +  ++D+  + C+ N          VL +    ++PL         QTV+        C+   N P  T+ W  DGK +   E        +L+I S++K+  G+YQC++ N+
Sbjct:  118 LARNQFGSIISRDVHV-RAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMELWRNNATDAYDGKYLVLPSGE--LHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPIASVGPRL-LSGND-----IKVLQFSASQASTLLCPAQSYPVPVFRWY----KFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV----TAPLSAKIDP-PTQTVDFGRPAVFTCQYTGN-PIKTVSWMKDGKAIGHSEP-------VLRIESVKKEDKGMYQCFVRND 414          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0306770)

HSP 1 Score: 79.337 bits (194), Expect = 4.005e-14
Identity = 85/318 (26.73%), Postives = 131/318 (41.19%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------------FGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIK------CEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LARN  G++ SR   + R V+  +       A  I GN   + C IP        +   H +   +   GS+Y   YL   +  L I+ + P+D   SY C      T   + S  K RL +T P   I PR  L+S D    E +I+     ++ TL C  ++ P     WY    K  E  T+              GTL I +  ++D+  + C+ N          VL +    ++PL         QTV+        C+   N P  T+ W  DGK +   E        +L+I S++K+  G+YQC++ N+
Sbjct:  118 LARNQFGSIISRDVHV-RAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDFLPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSIGPR--LTSGD----ESRILRVYLAASATLLCPAQAYPVPFFRWY----KFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV----TAPLSAKIDP-PTQTVDFGRPAVFTCQYTGN-PIKTVSWMKDGKAIGHSEP-------VLRIESVKKEDKGMYQCFVRND 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111092)

HSP 1 Score: 79.337 bits (194), Expect = 4.275e-14
Identity = 85/318 (26.73%), Postives = 131/318 (41.19%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------------FGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIK------CEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LARN  G++ SR   + R V+  +       A  I GN   + C IP        +   H +   +   GS+Y   YL   +  L I+ + P+D   SY C      T   + S  K RL +T P   I PR  L+S D    E +I+     ++ TL C  ++ P     WY    K  E  T+              GTL I +  ++D+  + C+ N          VL +    ++PL         QTV+        C+   N P  T+ W  DGK +   E        +L+I S++K+  G+YQC++ N+
Sbjct:  118 LARNQFGSIISRDVHV-RAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDFLPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSIGPR--LTSGD----ESRILRVYLAASATLLCPAQAYPVPFFRWY----KFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV----TAPLSAKIDP-PTQTVDFGRPAVFTCQYTGN-PIKTVSWMKDGKAIGHSEP-------VLRIESVKKEDKGMYQCFVRND 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111082)

HSP 1 Score: 78.9518 bits (193), Expect = 4.543e-14
Identity = 83/320 (25.94%), Postives = 134/320 (41.88%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL--HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------------FGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIK------CEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LARN  G++ SR   + R V+  +          I GN   I C+IP       ++E +  H +   N   G++Y   YL   +  L I+ + P+D   SY C      T   + S  K RL +T P   + P+  L+S D+ R     +   +  ++TL C  ++ P     WY    K  E  T+              GTL I +  ++D+  + C+ N          VL +    ++PL         QTV+        C+   N P  T+ W  DGK +   E        +L+I S++K+  G+YQC++ N+
Sbjct:  118 LARNQFGSIISRDVHV-RAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVAD--FVEVVSWHTDEEENYFPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVGPK--LTSGDDSR----TVRIRQEDSVTLLCPAQAYPVPVYRWY----KFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV----TAPLSAKIDP-PTQTVDFGRPAVFTCQYTGN-PIKTVSWMKDGKAIGHSEP-------VLRIESVKKEDKGMYQCFVRND 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 87.0409 bits (214), Expect = 2.347e-16
Identity = 85/320 (26.56%), Postives = 142/320 (44.38%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKDF 1527
            ++LGT++SR  R+    L  F L   E      G    + C +  ++   P+  +  D  P+        + I LP GA  L+I N    D+G Y CT   LG     ++  +  L V T   D     +L +        K++    G ++ L C+ +  P   + W + +    E+  +F     G+L I N+  +DA  + C A+     S    +L V   PRF + P      +YA+++++I  +C+V  + P PT+KW  DG  +   +     +++ LQ+  L K   G YQC  EN+  N+ AS   +I D 
Sbjct:  116 DNLGTISSRTARLTVAGLPRF-LSQPEGVSVRSGGTEMLSCEV--TEELVPFTRWDRDARPVELDS----RVIQLPSGA--LVISNASQADAGLYRCTIDGLGPP---KTTEEAELQVVT---DSGAGEKLETLQGPVAVAKVV----GESVLLPCVMKGHPIPAIRWTFNDQPIEEAHERFSVIGGGSLQIVNLTEEDAGIYVCQADSGNMTSEIQAELTVHVPPRFLTRP----SNTYAQESMDIIFECDVTGS-PPPTVKWMKDGDTVIPSDYFRIVKQHNLQVLGLVKSDEGFYQCLAENDAGNVQASAQLIILDI 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 80.1073 bits (196), Expect = 2.156e-14
Identity = 92/341 (26.98%), Postives = 138/341 (40.47%), Query Frame = 1
Query:  574 EKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLY------CLYESTPAAEVTWYYPNSK--RYESDTQFGT--LSINNVQLDDASDFSCLANEVQTRSFK-----LKVLALPRFSSSPLGISFKSYAR--QTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLENEWN----------LWASGV 1509
            E     +A+N  G V SR  R+    +  F  V  ES    +G VG+  C I H  P P  I +  D  P++T   S  +   LP G  +L I  + P+DSG Y C A      +  +     +LTV+  +  +             KE  I+   E   +T++      C+    P   V+W   + +    E     GT  L I++V++  +  + C AN+  TR  +     L V A   F   P     +S AR   T  I   +    P P I W  +G++L E +  +K R N   L I  + ++   IYQC  EN             LWA G+
Sbjct:   99 EGDYECIAQNFFGLVVSRKARVQAATMADF-HVQPESVRADVGGVGRFQCQI-HGLPEP-VISWERDGRPVDT---SDERFTLLPTG--VLQITGVRPEDSGVYCCVAH---NSAGVKHSAGAQLTVSGSQSSV------------YKEPMILVGPENLTLTVHQTAILECVATGYPRPIVSWSRLDGRPIGVEGIQVLGTGNLMISDVRVQHSGVYVCAANKPGTRVRRTAQGLLVVQAPAEFVQPP-----QSIARPVGTTAIFTCLAQGEPVPQITWLKNGQIL-EPDGHVKLRNNNSTLTIYGVTQEDEAIYQCIAENSAGSTQASARLTVLWADGL 410          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 78.1814 bits (191), Expect = 1.399e-13
Identity = 64/257 (24.90%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  736 SKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTR---LTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD-----TQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQC 1470
            S   PP + +L + +P+  +      +I L     +L I   +  D GSYTC AS        R+ +  R   L V  P           S D     E++    +GS  +  C+ + TP+  + W    +   +        Q  T+ I NV ++    ++C A+      +R F LKVL  PR + S +           +E+ CE  + +P PT+ W  DG+ L + E+    R   +L++ S + ++ G Y C
Sbjct: 3352 SGSPPPQLNWLKNGLPLPVSS-----QIRLLSAGQVLRIARAQVSDGGSYTCVAS-------NRAGVDNRHYTLQVYVPP----------SLDGAGSTEEVT-VVKGSTASFICIADGTPSPVIIWLRTGASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQAGDASRHFSLKVLDPPRINGSGVPAEVSVVVNHVLELLCEA-DGIPLPTLTWLKDGRPLPQTENIRLLRDGQMLRVASAQVENTGRYTC 3584          

HSP 2 Score: 73.9442 bits (180), Expect = 2.637e-12
Identity = 91/357 (25.49%), Postives = 150/357 (42.02%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFR-LSSYDNERKEEKIIEATE--GSNITLYCLYESTPAAEVTWY------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR--KNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENI--SIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTID 1866
            L I +   ++SG + CTA    T +   S  K +LTV      ++P+   +   D     EK++E +   G +ITL C  ES P   +TW        P S R+      G++ I + ++ D+  + C+A  +    +++ KL VL  P  S+ P   + K      +++ C V   VP P++ W  DG +L   +D  ++R     L +  +     GIY C      N+     T I+  V++       E    S + +R A    I   C    + +       +KW R        ELTGN+  +   +    +IL+ V+P   LD G Y C   +         KYQL ++
Sbjct: 1028 LHIHSPSGEESGEFVCTA----TNAAGYSSRKVQLTVY-----VRPKLSGVGEADIHDNSEKLLEMSVIVGDDITLPCEVESVPPPIITWAKDKQLISPFSPRH-IQLPSGSMRITDTRVTDSGMYLCVATNIAGNFSQTVKLSVLVPPSISAGPR--AMKVQIGHAIDLPC-VTQGVPEPSVSWLKDGTVL---QDGSRYRISDGALTLNQVALTDEGIYVC---RAVNIAGKEETAIQLHVQVPPVVEVSEPPFNSPLQERVA-NQQIAFPCPAKGTPEP-----VIKWFRNGH-----ELTGNEPGVSILEDGTLLILASVSP---LDNGEYTCMAVNDAGTTEK--KYQLKVN 1349          

HSP 3 Score: 68.5514 bits (166), Expect = 1.210e-10
Identity = 98/435 (22.53%), Postives = 165/435 (37.93%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRF--RLSSYDNERKEEKI--IEATEGSNITLYCLYESTPAAEVTWYYPN-----SKRYESDTQFGTLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENI------SIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGV 1998
            P + +L D  P+  T+      I L     +L + + + +++G YTC AS                   +P  D    F  R+    N   +  +  +   +   +TL C  ++ P   +TW   +     S R    +    L INN  L D + +SC+A+ V     R FKL V   P     P  +S   +  Q V ++C V+N VP P I W   G +L       KF ++  L+I S +    G Y C   N+                   TE +R ++      SI +  T   +T++++ + L  +       +V W +   +L     T     M++  S G+++  ++ P+                  +  T  Y+  + ++   E   +QL     P+   E  E  VSR   V I   A GV
Sbjct: 3543 PTLTWLKDGRPLPQTE-----NIRLLRDGQMLRVASAQVENTGRYTCLAS-------------------SPAGDDDKEFLVRVHVPPNIAGDRGVQDVSVLQNRQVTLECKSDAVPPPTLTWLKDDAPLKMSPRVRVLSSGRYLQINNAVLGDGAQYSCVASNVAGETRRHFKLSVNVPPTIKDGPQSVSV--HINQPVVLEC-VVNGVPAPRITWRKQGSILAGNNPRYKFGEDGSLRILSAQVTDTGRYLCMATNQAG-----------------TERKRVDLQVYVPPSIAEGPTNITVTVNVQ-TTLSCEATGIPKPSVSWTKNTQALN----TDQNQNMYRLLSSGSLV--VIAPS------------------VEDTALYECVVSNEAGQESRAIQLTVHVPPSIADEATELVVSRLSPVVIGCTASGV 3908          

HSP 4 Score: 66.6254 bits (161), Expect = 4.712e-10
Identity = 60/262 (22.90%), Postives = 105/262 (40.08%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG------TLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRF----SSSPL--GISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENE 1485
            P  I +L D  P  +++      + + PG   L I N + +D+G YTC A+    ++ +  ++K  +     K DI           E    K ++    + +TL C  ++ P   + WY  + +  ++D           + I + Q+ D   ++C+A  +     + F + +   P F     S P   G          + + CE  N VP P + W+ DG +LT  +  L      +LQI   +    G Y C   NE
Sbjct: 2593 PAIITWLKDGTPFESSR-----NVRVLPGGRTLQILNAKEEDAGRYTCVATNEAGETLKNYEVKVFVPPVINKNDIP---------GESLAPKEVKIKVNNTLTLECEAQAIPTPTLVWYK-DGQILKADGHLTITANGRIVQIKHTQVSDTGRYTCVATNIAGEDEKDFDVNIQVPPSFRGFGDSGPGNNGEVKDVILNNPISLYCET-NAVPPPVLTWYKDGHLLTSNDKVLILPGGRVLQIPRAQVDDTGRYTCVAVNE 2838          

HSP 5 Score: 60.077 bits (144), Expect = 3.545e-8
Identity = 86/387 (22.22%), Postives = 142/387 (36.69%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYC-LYESTPAAEVTWYYPN----SKRYESDTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVT----VIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLK---STDIPAKRTEHFEPSVS 1956
            L I NL  +D  +Y C A       F R  +K ++TVT     + P   LS          ++   E   +TL C L    P  E  W + N    S  Y +  + G+L I  V   D   ++CL   V     R+  L V  +P     P    F +     + + C   + VP P I W   G++L          ++  L I S   +  G + C   N     +  V     V      + E +    +  +++     G  I L C +     +S     + W + K   +LI     +++     S     + I + T+  D G+Y+C   +       TVK  + +       P  ++++   + D+P       EPSVS
Sbjct:  844 LFITNLWVEDEATYVCEAQ----NHFGRIQVKAKVTVT---GLVSPLIALS--------PTVVSVIEDQQVTLPCVLLAGNPLPERHWLHDNGLVTSSPYVTVRRDGSLHIEQVSQQDGGQYTCLTENVVGSSNRTTILNVYVMPTIQHGPQ--IFSTIEGTPISLPCRA-HGVPKPDITWSKRGELLDLSGSVFSLTEDGSLHIHSPSGEESGEFVCTATNAAGYSSRKVQLTVYVRPKLSGVGEADIHDNSEKLLEMSVIVGDDITLPCEV-----ESVPPPIITWAKDK---QLISPFSPRHIQLPSGS-----MRITD-TRVTDSGMYLCVATNIAGNFSQTVKLSVLVPPSISAGPRAMKVQIGHAIDLPCVTQGVPEPSVS 1198          

HSP 6 Score: 60.077 bits (144), Expect = 3.760e-8
Identity = 74/343 (21.57%), Postives = 126/343 (36.73%), Query Frame = 1
Query:  484 GIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANE---VQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            G ++E+ + ++        KL+I R  L    +   +A N  G        +I    N            ++ +  Q+VC      P+P  I++L D + I+ T     K I + P    L +  +   DSG YTC A    T      D    L V  P     P  +           K +     S+I + C+   +P  ++ W       P S +    +    L I   Q+ D   ++C+A+    V  R + L+V   P    +            T    C + +  P+P I W   G  +++    SL  + + +QI ++   H G Y C   N+
Sbjct: 3174 GRVIENSESLEMHILSGGSKLQISRSQLSDSGTYTCVASNVEGKAQKNYHLVIHVPPNIIGSELPSEMSVLLNDSVQLVCRA-EGTPTP-EIQWLKDGMTISRTA---QKNIKISPDGSTLTVTAVHTSDSGKYTCVA----TNQAGEEDRIFNLNVYVP-----PLIQ-----GNGPAAKELTTVLDSSINIECVASGSPPPQLNWLKNGLPLPVSSQIRLLSAGQVLRIARAQVSDGGSYTCVASNRAGVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFIC-IADGTPSPVIIWLRTGASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQ 3496          

HSP 7 Score: 60.077 bits (144), Expect = 3.921e-8
Identity = 86/367 (23.43%), Postives = 148/367 (40.33%), Query Frame = 1
Query:  817 IYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW------------YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA----NEVQTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTI 1863
            + + P    L I+  +   +G YTC A      S   +     L V +      P+F         K+   + A  G+NITL C  +  P  +++W            + P++  +  D   G L I N+ ++D + + C A      +Q ++ K+ V  L  P  + SP  +S      Q V + C +L   P P   W HD  ++T        R   L I  + ++  G Y C  EN   + +S  T I +   +   +   +  S I+     G  I L C   ++    K + T  W +     EL++L+G+ + + +  S     L I +P+   + G ++C     NA    + K QLT+
Sbjct:  740 LSMDPQRGTLTIQQTQDTHAGQYTCVA----VNSAGSAQGYITLDVGS-----APQFT--------KKPSDLSADIGTNITLPCYAQGHPKPQLSWRREDNIALFTQRHGPSTVTHRMD---GGLFITNLWVEDEATYVCEAQNHFGRIQVKA-KVTVTGLVSPLIALSPTVVSV--IEDQQVTLPCVLLAGNPLPERHWLHDNGLVTSSPYVTVRRDGSLHIEQVSQQDGGQYTCLTENV--VGSSNRTTILNVYVMPTIQHGPQIFSTIE-----GTPISLPC---RAHGVPKPDIT--WSKRG---ELLDLSGSVFSLTEDGS-----LHIHSPSGE-ESGEFVCTA--TNAAGYSSRKVQLTV 1060          

HSP 8 Score: 59.6918 bits (143), Expect = 5.865e-8
Identity = 70/262 (26.72%), Postives = 102/262 (38.93%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLS------INNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFS-SSPLGIS--FKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR----KNILQIRSLEKKHLGIYQCWLENE 1485
            PP I +L D  PI+T+       + +  G   L + +    D+G YTC  S    +  +  D    L V  P   +          NE   E  ++  E  N  L C     P  E+TW   + +   SDT+   +S      I+  Q+ D   +SCLA+     ++R F L VL  P  + S P G +            + CE   + P   I W  DG   T  E S   R       LQI + +++  G Y C   NE
Sbjct: 2404 PPAITWLKDGQPISTS-----SSVRVISGGRGLRLMHAASSDAGRYTCIVSNSAGEERKNFD----LYVLVPPSIV----------NEGTVED-VKVKERQNAILACEVTGNPVPEITWLK-DGQPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSAGDRSRHFNLNVLVSPTIAGSGPEGSAEEVTVTLNSPTSLVCEA-QSYPPAIITWLKDG---TPFESSRNVRVLPGGRTLQILNAKEEDAGRYTCVATNE 2640          

HSP 9 Score: 55.4546 bits (132), Expect = 8.887e-7
Identity = 51/222 (22.97%), Postives = 89/222 (40.09%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCT-ASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L I   +P D+G YTCT A+  G+ S   S     LTV  P     P  R+         E  +   E +   L C+ +  P   +TW   +    ++  ++     G L I+  Q +D+  ++C+        +R+  L +   P F+     ++     R+ + + C V   +P P I W  +  ++  + D       ++ I  + K   G Y C  EN
Sbjct: 4118 LQIAFAQPGDTGRYTCTVANVAGSSSLDIS-----LTVQIP-----PSIRVG--------ESEVSVVENTQALLTCVADGVPQPTITWEKDDIPLTDTTAEYTILPTGDLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPAFTELLGDVALNK--RERLLMVCGV-TGIPPPKITWTFNNNIVPAQYDHYNGHSELV-IERVSKDDSGTYTCMAEN 4317          

HSP 10 Score: 55.4546 bits (132), Expect = 1.096e-6
Identity = 57/273 (20.88%), Postives = 113/273 (41.39%), Query Frame = 1
Query:  685 AEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-------GTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQC 1470
            A  I+ N+ ++ C     +P+P  I +L D VP+   +G     + +      L+I   +  D+  + C A    T      + + +++V  P     P  R +       E  ++  T   +I+L C+    P    TW   + +  ++  +F         L I   +L+DA  ++C+A      +    +L V   P    +   ++    A   +++KC+   + P P + W+ DG+ LT     ++  R ++L+I   +    G Y+C
Sbjct: 1737 ATVILNNILELECYA-TGRPTP-TITWLKDGVPVKHGEG-----VRITSNGRRLVISRAQVSDTALFHCVA----TNEAGEQEREFKVSVHVP-----PAIRSTG----PAERSVVLHT---SISLQCVVSGIPPPSTTWLK-DGRPVDTTQEFLKLESAGRVLHIKKARLEDAGKYTCVATNAAGEAQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGS-PLPAVTWYKDGRPLTSAAGVNILSRGHVLEIDRAQVSDAGFYKC 1984          

HSP 11 Score: 53.5286 bits (127), Expect = 3.547e-6
Identity = 94/416 (22.60%), Postives = 169/416 (40.62%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTA-SFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNI-TLYCLYESTPAAEVTWY-------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEV--QTRSFKLKVLALPRFSSSPLGISFKSYARQT-VEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRK--NILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD--QNAELLHTVKYQL--TIDDQK------FNEPNQLQLKSTDIP 1920
            PP + +L D  P+   +  +     L  G  I ++  L+  D+G Y C A S  G K     ++K  ++V  P         +    ++  +  +I     +NI  L C     P   +TW        +    R  S+ +   L I+  Q+ D + F C+A NE   Q R FK+ V   P   S+  G + +S    T + ++C V++ +P P+  W  DG+ +   ++ LK      +L I+    +  G Y C   N     A+G       + + E  S +    ++++    G  I L+C    S   +     V W   KD   L    G   +     S G V+   ++  +  D G Y C   +   + EL ++++  +  TI  +        N+P +L+ +++ +P
Sbjct: 1663 PPSLTWLKDGSPVAVRESLRV----LDQGRKIEILNALQ-SDAGRYVCVATSVAGEK-----EIKYDVSVLVPP--------VVDGASDTTDATVIL----NNILELECYATGRPTPTITWLKDGVPVKHGEGVRITSNGR--RLVISRAQVSDTALFHCVATNEAGEQEREFKVSVHVPPAIRST--GPAERSVVLHTSISLQC-VVSGIPPPSTTWLKDGRPVDTTQEFLKLESAGRVLHIKKARLEDAGKYTCVATN-----AAGEAQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGSPLPA-----VTW--YKDGRPLTSAAGVNIL-----SRGHVLE--IDRAQVSDAGFYKCVAINVAGSTELTYSLQVYVPPTISSKGGMVTVVVNDPVRLECEASGVP 2032          

HSP 12 Score: 53.5286 bits (127), Expect = 3.923e-6
Identity = 57/226 (25.22%), Postives = 89/226 (39.38%), Query Frame = 1
Query:  835 AMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRY-ESDTQF----GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK--MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
              +L++ ++ P D+G YTC A          ++ K +L V  P  DI+    LS+          +         L C    TP   +TWY    +    SD Q      TL +    + DA  + C A  +   + R F L VL  P    +       +   Q + ++C+V  + P PTI+W+ D K   L +    +  R   L+I+S        YQC   N
Sbjct: 1313 GTLLILASVSPLDNGEYTCMA----VNDAGTTEKKYQLKVNVPP-DIRDNGLLSN----------VSVVINQPTNLVCDVTGTPVPVITWYKDGVEVVPSSDVQILQKGKTLKLLKAAVQDAGRYICKAINIAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGD-PFPTIQWYKDRKPVFLGDPNIEVLNRGQQLKIKSARLGDQARYQCSATN 1522          

HSP 13 Score: 53.1434 bits (126), Expect = 5.722e-6
Identity = 61/240 (25.42%), Postives = 91/240 (37.92%), Query Frame = 1
Query:  811 KKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKK-DIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-----YYPNSKRYE-SDTQFGTLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALP--RFSSSPLGISFKS-YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLENE 1485
            + I LP G+M   I +    DSG Y C A+ +     Q      +L+V  P      PR               ++   G  I L C+ +  P   V+W        +  RY  SD   G L++N V L D   + C A  +  +   + +L V   P    S  P     +   A Q +   C      P P IKWF +G  LT  E  +   ++  +L + S+     G Y C   N+
Sbjct: 1121 RHIQLPSGSM--RITDTRVTDSGMYLCVATNIAGNFSQ----TVKLSVLVPPSISAGPR--------------AMKVQIGHAIDLPCVTQGVPEPSVSWLKDGTVLQDGSRYRISD---GALTLNQVALTDEGIYVCRAVNIAGKEETAIQLHVQVPPVVEVSEPPFNSPLQERVANQQIAFPCPA-KGTPEPVIKWFRNGHELTGNEPGVSILEDGTLLILASVSPLDNGEYTCMAVND 1336          

HSP 14 Score: 53.1434 bits (126), Expect = 5.722e-6
Identity = 64/261 (24.52%), Postives = 104/261 (39.85%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRF-RLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS---KRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQT-RSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTV 1515
            P I +  D++P+  T  ++Y    LP G   LLI   +P+DSGSYTC    +GT S  +      L++ T      P F  L       K E+++         + C     P  ++TW + N+    +Y+       L I  V  DD+  ++C+A N V + +S     +  P      +  +          + CEV  + P PTI+W   G  +       +     L I     +  G Y C   N+  +    VT+
Sbjct: 4183 PTITWEKDDIPLTDTT-AEYT--ILPTGD--LLIDTAQPEDSGSYTC----VGTNSMGQDSRTISLSIHT-----HPAFTELLGDVALNKRERLL---------MVCGVTGIPPPKITWTFNNNIVPAQYDHYNGHSELVIERVSKDDSGTYTCMAENSVGSIKSLGFVYVKEPPIIDGDVHSNRIEPLGGNAILNCEVRGD-PLPTIQWSKKGINVQISNRIRQLDNGSLAIYGTVSEDAGNYMCVATNDAGVVERTVTL 4419          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 78.1814 bits (191), Expect = 1.410e-13
Identity = 64/257 (24.90%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  736 SKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTR---LTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD-----TQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQC 1470
            S   PP + +L + +P+  +      +I L     +L I   +  D GSYTC AS        R+ +  R   L V  P           S D     E++    +GS  +  C+ + TP+  + W    +   +        Q  T+ I NV ++    ++C A+      +R F LKVL  PR + S +           +E+ CE  + +P PT+ W  DG+ L + E+    R   +L++ S + ++ G Y C
Sbjct: 3351 SGSPPPQLNWLKNGLPLPVSS-----QIRLLSAGQVLRIARAQVSDGGSYTCVAS-------NRAGVDNRHYTLQVYVPP----------SLDGAGSTEEVT-VVKGSTASFICIADGTPSPVIIWLRTGASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQAGDASRHFSLKVLDPPRINGSGVPAEVSVVVNHVLELLCEA-DGIPLPTLTWLKDGRPLPQTENIRLLRDGQMLRVASAQVENTGRYTC 3583          

HSP 2 Score: 73.9442 bits (180), Expect = 2.774e-12
Identity = 91/357 (25.49%), Postives = 150/357 (42.02%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFR-LSSYDNERKEEKIIEATE--GSNITLYCLYESTPAAEVTWY------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR--KNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENI--SIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTID 1866
            L I +   ++SG + CTA    T +   S  K +LTV      ++P+   +   D     EK++E +   G +ITL C  ES P   +TW        P S R+      G++ I + ++ D+  + C+A  +    +++ KL VL  P  S+ P   + K      +++ C V   VP P++ W  DG +L   +D  ++R     L +  +     GIY C      N+     T I+  V++       E    S + +R A    I   C    + +       +KW R        ELTGN+  +   +    +IL+ V+P   LD G Y C   +         KYQL ++
Sbjct: 1027 LHIHSPSGEESGEFVCTA----TNAAGYSSRKVQLTVY-----VRPKLSGVGEADIHDNSEKLLEMSVIVGDDITLPCEVESVPPPIITWAKDKQLISPFSPRH-IQLPSGSMRITDTRVTDSGMYLCVATNIAGNFSQTVKLSVLVPPSISAGPR--AMKVQIGHAIDLPC-VTQGVPEPSVSWLKDGTVL---QDGSRYRISDGALTLNQVALTDEGIYVC---RAVNIAGKEETAIQLHVQVPPVVEVSEPPFNSPLQERVA-NQQIAFPCPAKGTPEP-----VIKWFRNGH-----ELTGNEPGVSILEDGTLLILASVSP---LDNGEYTCMAVNDAGTTEK--KYQLKVN 1348          

HSP 3 Score: 68.1662 bits (165), Expect = 1.252e-10
Identity = 98/435 (22.53%), Postives = 165/435 (37.93%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRF--RLSSYDNERKEEKI--IEATEGSNITLYCLYESTPAAEVTWYYPN-----SKRYESDTQFGTLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENI------SIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGV 1998
            P + +L D  P+  T+      I L     +L + + + +++G YTC AS                   +P  D    F  R+    N   +  +  +   +   +TL C  ++ P   +TW   +     S R    +    L INN  L D + +SC+A+ V     R FKL V   P     P  +S   +  Q V ++C V+N VP P I W   G +L       KF ++  L+I S +    G Y C   N+                   TE +R ++      SI +  T   +T++++ + L  +       +V W +   +L     T     M++  S G+++  ++ P+                  +  T  Y+  + ++   E   +QL     P+   E  E  VSR   V I   A GV
Sbjct: 3542 PTLTWLKDGRPLPQTE-----NIRLLRDGQMLRVASAQVENTGRYTCLAS-------------------SPAGDDDKEFLVRVHVPPNIAGDRGVQDVSVLQNRQVTLECKSDAVPPPTLTWLKDDAPLKMSPRVRVLSSGRYLQINNAVLGDGAQYSCVASNVAGETRRHFKLSVNVPPTIKDGPQSVSV--HINQPVVLEC-VVNGVPAPRITWRKQGSILAGNNPRYKFGEDGSLRILSAQVTDTGRYLCMATNQAG-----------------TERKRVDLQVYVPPSIAEGPTNITVTVNVQ-TTLSCEATGIPKPSVSWTKNTQALN----TDQNQNMYRLLSSGSLV--VIAPS------------------VEDTALYECVVSNEAGQESRAIQLTVHVPPSIADEATELVVSRLSPVVIGCTASGV 3907          

HSP 4 Score: 66.2402 bits (160), Expect = 4.872e-10
Identity = 60/262 (22.90%), Postives = 105/262 (40.08%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG------TLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRF----SSSPL--GISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENE 1485
            P  I +L D  P  +++      + + PG   L I N + +D+G YTC A+    ++ +  ++K  +     K DI           E    K ++    + +TL C  ++ P   + WY  + +  ++D           + I + Q+ D   ++C+A  +     + F + +   P F     S P   G          + + CE  N VP P + W+ DG +LT  +  L      +LQI   +    G Y C   NE
Sbjct: 2592 PAIITWLKDGTPFESSR-----NVRVLPGGRTLQILNAKEEDAGRYTCVATNEAGETLKNYEVKVFVPPVINKNDIP---------GESLAPKEVKIKVNNTLTLECEAQAIPTPTLVWYK-DGQILKADGHLTITANGRIVQIKHTQVSDTGRYTCVATNIAGEDEKDFDVNIQVPPSFRGFGDSGPGNNGEVKDVILNNPISLYCET-NAVPPPVLTWYKDGHLLTSNDKVLILPGGRVLQIPRAQVDDTGRYTCVAVNE 2837          

HSP 5 Score: 60.077 bits (144), Expect = 3.636e-8
Identity = 86/387 (22.22%), Postives = 142/387 (36.69%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYC-LYESTPAAEVTWYYPN----SKRYESDTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVT----VIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLK---STDIPAKRTEHFEPSVS 1956
            L I NL  +D  +Y C A       F R  +K ++TVT     + P   LS          ++   E   +TL C L    P  E  W + N    S  Y +  + G+L I  V   D   ++CL   V     R+  L V  +P     P    F +     + + C   + VP P I W   G++L          ++  L I S   +  G + C   N     +  V     V      + E +    +  +++     G  I L C +     +S     + W + K   +LI     +++     S     + I + T+  D G+Y+C   +       TVK  + +       P  ++++   + D+P       EPSVS
Sbjct:  843 LFITNLWVEDEATYVCEAQ----NHFGRIQVKAKVTVT---GLVSPLIALS--------PTVVSVIEDQQVTLPCVLLAGNPLPERHWLHDNGLVTSSPYVTVRRDGSLHIEQVSQQDGGQYTCLTENVVGSSNRTTILNVYVMPTIQHGPQ--IFSTIEGTPISLPCRA-HGVPKPDITWSKRGELLDLSGSVFSLTEDGSLHIHSPSGEESGEFVCTATNAAGYSSRKVQLTVYVRPKLSGVGEADIHDNSEKLLEMSVIVGDDITLPCEV-----ESVPPPIITWAKDK---QLISPFSPRHIQLPSGS-----MRITD-TRVTDSGMYLCVATNIAGNFSQTVKLSVLVPPSISAGPRAMKVQIGHAIDLPCVTQGVPEPSVS 1197          

HSP 6 Score: 60.077 bits (144), Expect = 3.856e-8
Identity = 74/343 (21.57%), Postives = 126/343 (36.73%), Query Frame = 1
Query:  484 GIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANE---VQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            G ++E+ + ++        KL+I R  L    +   +A N  G        +I    N            ++ +  Q+VC      P+P  I++L D + I+ T     K I + P    L +  +   DSG YTC A    T      D    L V  P     P  +           K +     S+I + C+   +P  ++ W       P S +    +    L I   Q+ D   ++C+A+    V  R + L+V   P    +            T    C + +  P+P I W   G  +++    SL  + + +QI ++   H G Y C   N+
Sbjct: 3173 GRVIENSESLEMHILSGGSKLQISRSQLSDSGTYTCVASNVEGKAQKNYHLVIHVPPNIIGSELPSEMSVLLNDSVQLVCRA-EGTPTP-EIQWLKDGMTISRTA---QKNIKISPDGSTLTVTAVHTSDSGKYTCVA----TNQAGEEDRIFNLNVYVP-----PLIQ-----GNGPAAKELTTVLDSSINIECVASGSPPPQLNWLKNGLPLPVSSQIRLLSAGQVLRIARAQVSDGGSYTCVASNRAGVDNRHYTLQVYVPPSLDGAGSTEEVTVVKGSTASFIC-IADGTPSPVIIWLRTGASVSKDAHISLLNQNSTMQIVNVLVNHTGRYTCTAHNQ 3495          

HSP 7 Score: 60.077 bits (144), Expect = 4.055e-8
Identity = 86/367 (23.43%), Postives = 148/367 (40.33%), Query Frame = 1
Query:  817 IYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW------------YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA----NEVQTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTI 1863
            + + P    L I+  +   +G YTC A      S   +     L V +      P+F         K+   + A  G+NITL C  +  P  +++W            + P++  +  D   G L I N+ ++D + + C A      +Q ++ K+ V  L  P  + SP  +S      Q V + C +L   P P   W HD  ++T        R   L I  + ++  G Y C  EN   + +S  T I +   +   +   +  S I+     G  I L C   ++    K + T  W +     EL++L+G+ + + +  S     L I +P+   + G ++C     NA    + K QLT+
Sbjct:  739 LSMDPQRGTLTIQQTQDTHAGQYTCVA----VNSAGSAQGYITLDVGS-----APQFT--------KKPSDLSADIGTNITLPCYAQGHPKPQLSWRREDNIALFTQRHGPSTVTHRMD---GGLFITNLWVEDEATYVCEAQNHFGRIQVKA-KVTVTGLVSPLIALSPTVVSV--IEDQQVTLPCVLLAGNPLPERHWLHDNGLVTSSPYVTVRRDGSLHIEQVSQQDGGQYTCLTENV--VGSSNRTTILNVYVMPTIQHGPQIFSTIE-----GTPISLPC---RAHGVPKPDIT--WSKRG---ELLDLSGSVFSLTEDGS-----LHIHSPSGE-ESGEFVCTA--TNAAGYSSRKVQLTV 1059          

HSP 8 Score: 59.6918 bits (143), Expect = 5.915e-8
Identity = 70/262 (26.72%), Postives = 102/262 (38.93%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLS------INNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFS-SSPLGIS--FKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR----KNILQIRSLEKKHLGIYQCWLENE 1485
            PP I +L D  PI+T+       + +  G   L + +    D+G YTC  S    +  +  D    L V  P   +          NE   E  ++  E  N  L C     P  E+TW   + +   SDT+   +S      I+  Q+ D   +SCLA+     ++R F L VL  P  + S P G +            + CE   + P   I W  DG   T  E S   R       LQI + +++  G Y C   NE
Sbjct: 2403 PPAITWLKDGQPISTS-----SSVRVISGGRGLRLMHAASSDAGRYTCIVSNSAGEERKNFD----LYVLVPPSIV----------NEGTVED-VKVKERQNAILACEVTGNPVPEITWLK-DGQPLASDTRLQVMSNGRFLQISASQVADTGRYSCLASNSAGDRSRHFNLNVLVSPTIAGSGPEGSAEEVTVTLNSPTSLVCEA-QSYPPAIITWLKDG---TPFESSRNVRVLPGGRTLQILNAKEEDAGRYTCVATNE 2639          

HSP 9 Score: 55.4546 bits (132), Expect = 8.962e-7
Identity = 51/222 (22.97%), Postives = 89/222 (40.09%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCT-ASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L I   +P D+G YTCT A+  G+ S   S     LTV  P     P  R+         E  +   E +   L C+ +  P   +TW   +    ++  ++     G L I+  Q +D+  ++C+        +R+  L +   P F+     ++     R+ + + C V   +P P I W  +  ++  + D       ++ I  + K   G Y C  EN
Sbjct: 4117 LQIAFAQPGDTGRYTCTVANVAGSSSLDIS-----LTVQIP-----PSIRVG--------ESEVSVVENTQALLTCVADGVPQPTITWEKDDIPLTDTTAEYTILPTGDLLIDTAQPEDSGSYTCVGTNSMGQDSRTISLSIHTHPAFTELLGDVALNK--RERLLMVCGV-TGIPPPKITWTFNNNIVPAQYDHYNGHSELV-IERVSKDDSGTYTCMAEN 4316          

HSP 10 Score: 55.4546 bits (132), Expect = 1.096e-6
Identity = 57/273 (20.88%), Postives = 113/273 (41.39%), Query Frame = 1
Query:  685 AEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-------GTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQC 1470
            A  I+ N+ ++ C     +P+P  I +L D VP+   +G     + +      L+I   +  D+  + C A    T      + + +++V  P     P  R +       E  ++  T   +I+L C+    P    TW   + +  ++  +F         L I   +L+DA  ++C+A      +    +L V   P    +   ++    A   +++KC+   + P P + W+ DG+ LT     ++  R ++L+I   +    G Y+C
Sbjct: 1736 ATVILNNILELECYA-TGRPTP-TITWLKDGVPVKHGEG-----VRITSNGRRLVISRAQVSDTALFHCVA----TNEAGEQEREFKVSVHVP-----PAIRSTG----PAERSVVLHT---SISLQCVVSGIPPPSTTWLK-DGRPVDTTQEFLKLESAGRVLHIKKARLEDAGKYTCVATNAAGEAQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGS-PLPAVTWYKDGRPLTSAAGVNILSRGHVLEIDRAQVSDAGFYKC 1983          

HSP 11 Score: 53.5286 bits (127), Expect = 3.699e-6
Identity = 94/416 (22.60%), Postives = 169/416 (40.62%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTA-SFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNI-TLYCLYESTPAAEVTWY-------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEV--QTRSFKLKVLALPRFSSSPLGISFKSYARQT-VEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRK--NILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD--QNAELLHTVKYQL--TIDDQK------FNEPNQLQLKSTDIP 1920
            PP + +L D  P+   +  +     L  G  I ++  L+  D+G Y C A S  G K     ++K  ++V  P         +    ++  +  +I     +NI  L C     P   +TW        +    R  S+ +   L I+  Q+ D + F C+A NE   Q R FK+ V   P   S+  G + +S    T + ++C V++ +P P+  W  DG+ +   ++ LK      +L I+    +  G Y C   N     A+G       + + E  S +    ++++    G  I L+C    S   +     V W   KD   L    G   +     S G V+   ++  +  D G Y C   +   + EL ++++  +  TI  +        N+P +L+ +++ +P
Sbjct: 1662 PPSLTWLKDGSPVAVRESLRV----LDQGRKIEILNALQ-SDAGRYVCVATSVAGEK-----EIKYDVSVLVPP--------VVDGASDTTDATVIL----NNILELECYATGRPTPTITWLKDGVPVKHGEGVRITSNGR--RLVISRAQVSDTALFHCVATNEAGEQEREFKVSVHVPPAIRST--GPAERSVVLHTSISLQC-VVSGIPPPSTTWLKDGRPVDTTQEFLKLESAGRVLHIKKARLEDAGKYTCVATN-----AAGEAQQHIRLSVHEPPSIQYAGEMLNETILAGFQIQLKCKATGSPLPA-----VTW--YKDGRPLTSAAGVNIL-----SRGHVLE--IDRAQVSDAGFYKCVAINVAGSTELTYSLQVYVPPTISSKGGMVTVVVNDPVRLECEASGVP 2031          

HSP 12 Score: 53.5286 bits (127), Expect = 3.989e-6
Identity = 57/226 (25.22%), Postives = 89/226 (39.38%), Query Frame = 1
Query:  835 AMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRY-ESDTQF----GTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK--MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
              +L++ ++ P D+G YTC A          ++ K +L V  P  DI+    LS+          +         L C    TP   +TWY    +    SD Q      TL +    + DA  + C A  +   + R F L VL  P    +       +   Q + ++C+V  + P PTI+W+ D K   L +    +  R   L+I+S        YQC   N
Sbjct: 1312 GTLLILASVSPLDNGEYTCMA----VNDAGTTEKKYQLKVNVPP-DIRDNGLLSN----------VSVVINQPTNLVCDVTGTPVPVITWYKDGVEVVPSSDVQILQKGKTLKLLKAAVQDAGRYICKAINIAGSRERDFYLDVLVPPTIIGTVGSRDLSAVLNQEIVLECKVKGD-PFPTIQWYKDRKPVFLGDPNIEVLNRGQQLKIKSARLGDQARYQCSATN 1521          

HSP 13 Score: 52.7582 bits (125), Expect = 5.770e-6
Identity = 61/240 (25.42%), Postives = 91/240 (37.92%), Query Frame = 1
Query:  811 KKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKK-DIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-----YYPNSKRYE-SDTQFGTLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALP--RFSSSPLGISFKS-YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLENE 1485
            + I LP G+M   I +    DSG Y C A+ +     Q      +L+V  P      PR               ++   G  I L C+ +  P   V+W        +  RY  SD   G L++N V L D   + C A  +  +   + +L V   P    S  P     +   A Q +   C      P P IKWF +G  LT  E  +   ++  +L + S+     G Y C   N+
Sbjct: 1120 RHIQLPSGSM--RITDTRVTDSGMYLCVATNIAGNFSQ----TVKLSVLVPPSISAGPR--------------AMKVQIGHAIDLPCVTQGVPEPSVSWLKDGTVLQDGSRYRISD---GALTLNQVALTDEGIYVCRAVNIAGKEETAIQLHVQVPPVVEVSEPPFNSPLQERVANQQIAFPCPA-KGTPEPVIKWFRNGHELTGNEPGVSILEDGTLLILASVSPLDNGEYTCMAVND 1335          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Match: neo1a (neogenin 1a [Source:ZFIN;Acc:ZDB-GENE-021031-1])

HSP 1 Score: 75.0998 bits (183), Expect = 8.533e-13
Identity = 83/325 (25.54%), Postives = 144/325 (44.31%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLH-----DNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLANEVQTRSFKLKVLAL---PRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            ++LGT+ SR  R+    +  F L   E A   +G+   + C +     +P  + F+      + V ++      ++   LP GA  L+I N    D+G Y C     G TK+ + + +   LT T  ++ ++            +E + +    G ++ L C+    P  E+TW Y +    +S  +F     G+L I N+  +DA  ++CLA            L L   P+F   P+ +    +A +  ++  +CEV +  P+PTIKW  +G  +   +     ++  LQ+  L K   G YQC  EN+  N+ +S   VI D
Sbjct:  115 DNLGTIISRTARLNVAGIARF-LSQPEMASVRVGDSQVLSCEV-----NPDLVSFIRWEQNKEAVELD------HRVFSLPSGA--LVISNATETDAGLYRCVIDNAGPTKTSEEAQLHI-LTETGEERTLE----------FLQEPQHVSKLVGESVLLPCVVTGYPTPEITWMYKDQLIEDSSGRFEILGGGSLRIFNLTEEDAGVYNCLAENTNGSIEAQAELTLKDSPQFLKKPVNV----FAHEATDVIFECEV-SGSPSPTIKWVKNGDAVIPSDYFKIIKEQNLQVLGLVKSDEGFYQCLAENDAGNVQSSAQLVILD 409          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Match: DCC (DCC netrin 1 receptor [Source:NCBI gene;Acc:100486082])

HSP 1 Score: 77.7962 bits (190), Expect = 1.942e-13
Identity = 81/304 (26.64%), Postives = 127/304 (41.78%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHH-ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            + +GT+ SR  +++  V  P  ++   ES    +G+   + C I   +P P  I +  +   +    G   + + LP G   L I  L+  D G Y C A   G+    R   +  L +  P+          S  N      +  A EG +  L C     P   + W       P   R  S      L I+NV  DDA  ++C+A   NE  + S  L V+  PRF + P   +  +Y    +E +C V +  P+PT+KW  +G+++   +       + L+I  L K   G YQC  ENE
Sbjct:  108 HGVGTIVSRTAKVL--VAGPLRILSQTESVTAFVGDTALLKCEI-VGEPMP-AISWQRNEEDVKVAPGDT-RLLVLPSGT--LQISRLQTADGGVYRCLAKNPGSS---RVGNEAELRILIPQ----------SVSNLLPANVV--AVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNVTDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHP--ANLYAYESMDIEFECAV-SGKPSPTVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENE 386          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Match: DCC (DCC netrin 1 receptor [Source:NCBI gene;Acc:100486082])

HSP 1 Score: 77.0258 bits (188), Expect = 3.046e-13
Identity = 80/304 (26.32%), Postives = 128/304 (42.11%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHH-ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            + +GT+ SR  +++  V  P  ++   ES    +G+   + C I   +P P  I +  +   +    G   + + LP G   L I  L+  D G Y C A   G+    R   +  L + +     + +  L    N       + A EG +  L C     P   + W       P   R  S      L I+NV  DDA  ++C+A   NE  + S  L V+  PRF + P   +  +Y    +E +C V +  P+PT+KW  +G+++   +       + L+I  L K   G YQC  ENE
Sbjct:  118 HGVGTIVSRTAKVL--VAGPLRILSQTESVTAFVGDTALLKCEI-VGEPMP-AISWQRNEEDVKVAPGDT-RLLVLPSGT--LQISRLQTADGGVYRCLAKNPGSS---RVGNEAELRILSESGLHRQQVFLQRPAN-------VVAVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNVTDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHP--ANLYAYESMDIEFECAV-SGKPSPTVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENE 401          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Match: DCC (DCC netrin 1 receptor [Source:NCBI gene;Acc:100486082])

HSP 1 Score: 77.0258 bits (188), Expect = 3.074e-13
Identity = 80/304 (26.32%), Postives = 128/304 (42.11%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHH-ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            + +GT+ SR  +++  V  P  ++   ES    +G+   + C I   +P P  I +  +   +    G   + + LP G   L I  L+  D G Y C A   G+    R   +  L + +     + +  L    N       + A EG +  L C     P   + W       P   R  S      L I+NV  DDA  ++C+A   NE  + S  L V+  PRF + P   +  +Y    +E +C V +  P+PT+KW  +G+++   +       + L+I  L K   G YQC  ENE
Sbjct:  122 HGVGTIVSRTAKVL--VAGPLRILSQTESVTAFVGDTALLKCEI-VGEPMP-AISWQRNEEDVKVAPGDT-RLLVLPSGT--LQISRLQTADGGVYRCLAKNPGSS---RVGNEAELRILSESGLHRQQVFLQRPAN-------VVAVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNVTDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHP--ANLYAYESMDIEFECAV-SGKPSPTVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENE 405          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Match: DCC (DCC netrin 1 receptor [Source:NCBI gene;Acc:100486082])

HSP 1 Score: 77.0258 bits (188), Expect = 3.144e-13
Identity = 80/304 (26.32%), Postives = 128/304 (42.11%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHH-ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            + +GT+ SR  +++  V  P  ++   ES    +G+   + C I   +P P  I +  +   +    G   + + LP G   L I  L+  D G Y C A   G+    R   +  L + +     + +  L    N       + A EG +  L C     P   + W       P   R  S      L I+NV  DDA  ++C+A   NE  + S  L V+  PRF + P   +  +Y    +E +C V +  P+PT+KW  +G+++   +       + L+I  L K   G YQC  ENE
Sbjct:  122 HGVGTIVSRTAKVL--VAGPLRILSQTESVTAFVGDTALLKCEI-VGEPMP-AISWQRNEEDVKVAPGDT-RLLVLPSGT--LQISRLQTADGGVYRCLAKNPGSS---RVGNEAELRILSESGLHRQQVFLQRPAN-------VVAVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNVTDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHP--ANLYAYESMDIEFECAV-SGKPSPTVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENE 405          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Match: DCC (DCC netrin 1 receptor [Source:NCBI gene;Acc:100486082])

HSP 1 Score: 77.0258 bits (188), Expect = 3.217e-13
Identity = 80/304 (26.32%), Postives = 128/304 (42.11%), Query Frame = 1
Query:  601 NSLGTVTSRPFRIIRKVLNPFPLVHH-ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            + +GT+ SR  +++  V  P  ++   ES    +G+   + C I   +P P  I +  +   +    G   + + LP G   L I  L+  D G Y C A   G+    R   +  L + +     + +  L    N       + A EG +  L C     P   + W       P   R  S      L I+NV  DDA  ++C+A   NE  + S  L V+  PRF + P   +  +Y    +E +C V +  P+PT+KW  +G+++   +       + L+I  L K   G YQC  ENE
Sbjct:   97 HGVGTIVSRTAKVL--VAGPLRILSQTESVTAFVGDTALLKCEI-VGEPMP-AISWQRNEEDVKVAPGDT-RLLVLPSGT--LQISRLQTADGGVYRCLAKNPGSS---RVGNEAELRILSESGLHRQQVFLQRPAN-------VVAVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNVTDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHP--ANLYAYESMDIEFECAV-SGKPSPTVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENE 380          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Match: Igdcc4 (immunoglobulin superfamily, DCC subclass, member 4 [Source:MGI Symbol;Acc:MGI:1858497])

HSP 1 Score: 74.7146 bits (182), Expect = 1.265e-12
Identity = 88/337 (26.11%), Postives = 137/337 (40.65%), Query Frame = 1
Query:  520 LKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSP-PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE------GSNITLYCLYESTPAAEVTWYYPNSKRYESDT---QFGTLSINNVQLDDASDFSCLANEVQTRSF-----KLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDG-KMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L+ E+    + +R   + E S   LA + LG V S+   +    L  F L H ES         +  C   H+K  P P I +  D V    T   + + I LP G  +L I +++  D+GSY C A+     + QR   +  LTV           R S      ++  I+ A E      G ++ + C+  + P   V+W   + K   +D        L I + Q   +  + C AN+ +TR F     +L+VLA P  S +P  +S    +  T    C   +  P P + W HDG  +       ++     L I  +  +  G YQC  EN
Sbjct:   97 LEQEDSDDEEALRIWKVTEGSYSCLAHSPLGVVASQVAVVKLATLEDFSL-HPESQIVEENGTARFEC---HTKGLPAPIITWEKDQV----TVPEESRLITLPNG--VLQILDVQDSDAGSYRCVAT---NSARQRFSQEASLTVA---------LRGSLEATRGQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIASAQPRHSGVYVCRANKPRTRDFATAAAELRVLAAPAISQAPEALSRTRAS--TARFVCRA-SGEPRPALHWLHDGIPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAEN 408          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Match: Igdcc4 (immunoglobulin superfamily, DCC subclass, member 4 [Source:MGI Symbol;Acc:MGI:1858497])

HSP 1 Score: 74.7146 bits (182), Expect = 1.309e-12
Identity = 88/337 (26.11%), Postives = 137/337 (40.65%), Query Frame = 1
Query:  520 LKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSP-PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE------GSNITLYCLYESTPAAEVTWYYPNSKRYESDT---QFGTLSINNVQLDDASDFSCLANEVQTRSF-----KLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDG-KMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L+ E+    + +R   + E S   LA + LG V S+   +    L  F L H ES         +  C   H+K  P P I +  D V    T   + + I LP G  +L I +++  D+GSY C A+     + QR   +  LTV           R S      ++  I+ A E      G ++ + C+  + P   V+W   + K   +D        L I + Q   +  + C AN+ +TR F     +L+VLA P  S +P  +S    +  T    C   +  P P + W HDG  +       ++     L I  +  +  G YQC  EN
Sbjct:   97 LEQEDSDDEEALRIWKVTEGSYSCLAHSPLGVVASQVAVVKLATLEDFSL-HPESQIVEENGTARFEC---HTKGLPAPIITWEKDQV----TVPEESRLITLPNG--VLQILDVQDSDAGSYRCVAT---NSARQRFSQEASLTVA---------LRGSLEATRGQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIASAQPRHSGVYVCRANKPRTRDFATAAAELRVLAAPAISQAPEALSRTRAS--TARFVCRA-SGEPRPALHWLHDGIPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAEN 408          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Match: Chl1 (cell adhesion molecule L1-like [Source:MGI Symbol;Acc:MGI:1098266])

HSP 1 Score: 73.1738 bits (178), Expect = 3.684e-12
Identity = 102/425 (24.00%), Postives = 164/425 (38.59%), Query Frame = 1
Query:  571 FEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSF-QRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES----DTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE---DSLKFRKNILQIRSLEKKHLGIYQCWLEN-EWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            F+      A N LGT  S     I   +  FP    E  +   G+   + C  P   P P +I +++    I      + +++Y+      L   N+E  DS   Y C A+F   ++  Q+  MK  +  +   K  KP+  L          K +   +G  + L C  E  P   + W  P S+  E     +    TL I N+   D  ++ C AN +    +  F + V   PR+   P    + + +     + CE     P PTIKW  +G +  EK        F + I    +L   H G+YQC   N    + A+    + D + L +T+++    +++      G +  L C    S K      TV W  + D  E   L G++Y   +  +     L I   T+  D G Y C
Sbjct:  103 FQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLP-PLHIYWMN----IELEHIEQDERVYMSQRGD-LYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPAQMGSLSAKTV--LKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGI--LLCEA-EGEPQPTIKWRLNG-LPIEKHPFPGDFMFPREI-SFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVV------GYSAFLHCEYFASPK-----ATVVW-EVAD--ETHPLEGDRYHTHENGT-----LEIYRTTEE-DAGSYSC 494          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Match: Chl1 (cell adhesion molecule L1-like [Source:MGI Symbol;Acc:MGI:1098266])

HSP 1 Score: 73.1738 bits (178), Expect = 3.684e-12
Identity = 102/425 (24.00%), Postives = 164/425 (38.59%), Query Frame = 1
Query:  571 FEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSF-QRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES----DTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE---DSLKFRKNILQIRSLEKKHLGIYQCWLEN-EWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            F+      A N LGT  S     I   +  FP    E  +   G+   + C  P   P P +I +++    I      + +++Y+      L   N+E  DS   Y C A+F   ++  Q+  MK  +  +   K  KP+  L          K +   +G  + L C  E  P   + W  P S+  E     +    TL I N+   D  ++ C AN +    +  F + V   PR+   P    + + +     + CE     P PTIKW  +G +  EK        F + I    +L   H G+YQC   N    + A+    + D + L +T+++    +++      G +  L C    S K      TV W  + D  E   L G++Y   +  +     L I   T+  D G Y C
Sbjct:  103 FQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLP-PLHIYWMN----IELEHIEQDERVYMSQRGD-LYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPAQMGSLSAKTV--LKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGI--LLCEA-EGEPQPTIKWRLNG-LPIEKHPFPGDFMFPREI-SFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVV------GYSAFLHCEYFASPK-----ATVVW-EVAD--ETHPLEGDRYHTHENGT-----LEIYRTTEE-DAGSYSC 494          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Match: Igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:MGI Symbol;Acc:MGI:1202390])

HSP 1 Score: 72.4034 bits (176), Expect = 5.438e-12
Identity = 87/338 (25.74%), Postives = 130/338 (38.46%), Query Frame = 1
Query:  574 EKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLY------CLYESTPAAEVTWYYPNSKRYESDT----QFGTLSINNVQLDDASDFSCLANEVQTR-----SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLENEWN----------LWASGV 1509
            E     +A+N  G + SR  R+    ++ F  VH ++     G V +  C I H  P P  I +  + VPI+T      +   LP G  +L I  L  +DSG + C AS + +    R     RLTV+             S     KE  I+   E   +T++      C+    P   V+W   + +    +       G L I++V +  +  + C AN   TR       +L V A   F   P  IS    A  T    C+     P P + W  +G++L       LK   + L I  +  +   IYQC  EN             LWA G+
Sbjct:  124 EGDYECVAQNRFGLLVSRKARLQAATMSDF-HVHPQAVTGEEGGVARFQCQI-HGLPKP-LITWEKNRVPIDT---DDERYTLLPKG--VLQITGLRAEDSGIFHCVASNIASV---RVSHGARLTVS------------GSGSGTYKEPTILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRP--AGTTAMFTCQAQGE-PPPHVTWLKNGQVLGAGGHVRLKNNNSTLSISGVGPEDEAIYQCVAENIAGSSQASARLTVLWAEGL 435          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Match: sp|Q9EQS9|IGDC4_MOUSE (Immunoglobulin superfamily DCC subclass member 4 OS=Mus musculus OX=10090 GN=Igdcc4 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.848e-12
Identity = 88/337 (26.11%), Postives = 137/337 (40.65%), Query Frame = 1
Query:  520 LKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSP-PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE------GSNITLYCLYESTPAAEVTWYYPNSKRYESDT---QFGTLSINNVQLDDASDFSCLANEVQTRSF-----KLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDG-KMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L+ E+    + +R   + E S   LA + LG V S+   +    L  F L H ES         +  C   H+K  P P I +  D V    T   + + I LP G  +L I +++  D+GSY C A+     + QR   +  LTV           R S      ++  I+ A E      G ++ + C+  + P   V+W   + K   +D        L I + Q   +  + C AN+ +TR F     +L+VLA P  S +P  +S    +  T    C   +  P P + W HDG  +       ++     L I  +  +  G YQC  EN
Sbjct:   97 LEQEDSDDEEALRIWKVTEGSYSCLAHSPLGVVASQVAVVKLATLEDFSL-HPESQIVEENGTARFEC---HTKGLPAPIITWEKDQV----TVPEESRLITLPNG--VLQILDVQDSDAGSYRCVAT---NSARQRFSQEASLTVA---------LRGSLEATRGQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIASAQPRHSGVYVCRANKPRTRDFATAAAELRVLAAPAISQAPEALSRTRAS--TARFVCRA-SGEPRPALHWLHDGIPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAEN 408          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Match: sp|Q2VWP9|PRTG_RAT (Protogenin OS=Rattus norvegicus OX=10116 GN=Prtg PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.548e-12
Identity = 75/306 (24.51%), Postives = 129/306 (42.16%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES-DTQF---GTLSINNVQLDDASDFSCLANEVQTRSF-----KLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            LA N  G + S+   +    ++ F  VH  S E   G V +  C I  + P+    EF    +P+        +   LP G  +L I +  P+D+G Y C A+   T + +R  M+  LT+  P  + +  +  +   + +     + A+    + L C+    P   ++W   + K  +  +T+    G L I++V+L  A  + C A    TR+F      L VLA P F   P  ++       T    C+    +P+P + W  +G+ +      +K   + L I  +  +   IYQC  EN
Sbjct:  108 LAVNKYGAILSQKAHLTLSTISAFE-VHPVSTEVPEGGVARFSCKISSTPPAVITWEFNRTALPMTMDS----RVTALPSG--VLQIYDAGPEDAGKYRCVAA---THAHKRKSMEASLTI-VPANETRSFYMPTIIASPQN----VTASLHQTVVLECMATGYPKPIISWSRLDHKSIDVFNTRVLGNGNLIISDVKLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAG--TARFVCQA-EGIPSPKMSWLKNGRRI-HSNGRIKMYNSKLVINQIIPEDDAIYQCMAEN 394          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 9.841e-12
Identity = 69/252 (27.38%), Postives = 105/252 (41.67%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY---YP----NSKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE-DSLKFRKNILQIRSLEKKHLGIYQC 1470
            PP + ++ D  P+   KG     + +     IL +KN+   D+G Y C A  +       +D K  L+V  P   I          N R  E  I   E ++++L C     P   +TW+   +P    NS R  S  +   L +    ++DA  ++C+   A   + + F L VL  P           K   +Q+V + CEV  N P P I W  DG+ L E E   +      LQI +++  H G Y C
Sbjct: 2321 PPTVTWMKDGHPLIKAKG-----VEILDEGHILQLKNIHVSDTGRYVCVAVNVA----GMTDKKYDLSVHAPPSII---------GNHRSPEN-ISVVEKNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRM--LRLMQTTMEDAGQYTCVVRNAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGN-PVPEITWHKDGQPLQEDEAHHIISGGRFLQITNVQVPHTGRYTC 2550          

HSP 2 Score: 70.4774 bits (171), Expect = 1.919e-10
Identity = 104/452 (23.01%), Postives = 175/452 (38.72%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLVH----HESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLS------INNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISI-IDKRTAPGLT-----IHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEP 1887
            +A N  G V+      I KVL P P ++    HE    I+ N  ++ C+   S    P + ++ D  P+  T      ++    G  +L I   + +D+G YTC AS     S    D K  L           R  +        E + I       +TL C  ++ P   +TW   N +R ++  +   LS      INN  L D ++++C+A+ +    TR F L V   P     P   S      ++  ++C +   VP P I W  DG +L          +N  L I+S      G Y C   N     A+G            T+ +R ++ + +    APG T     ++++ + L  +       ++ W R    L  ++   N Y +    S     L I++P+ + D   Y C + +   +   TV   + +     +EP
Sbjct: 3507 IASNEAGEVSKH---FILKVLEP-PHINGSEEHEEISVIVNNPLELTCIA--SGIPAPKMTWMKDGRPLPQTD-----QVQTLGGGEVLRISTAQVEDTGRYTCLAS-----SPAGDDDKEYLV----------RVHVPPNIAGTDEPRDITVLRNRQVTLECKSDAVPPPVITWLR-NGERLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ--SLVILLNKSTVLEC-IAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATN-----AAG------------TDRRRIDLQVHVPPSIAPGPTNMTVIVNVQ-TTLACEATGIPKPSINW-RKNGHLLNVDQNQNSYRLLSSGS-----LVIISPSVD-DTATYECTVTNGAGDDKRTVDLTVQVPPSIADEP 3903          

HSP 3 Score: 68.1662 bits (165), Expect = 1.195e-9
Identity = 57/222 (25.68%), Postives = 93/222 (41.89%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS------KRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L I  ++P D+G YTC A+ +       S   T+LTV  P     PR         R  E      E S   L C+ +  P   + W   N        +Y ++  +G L + NV L+D+  ++C+AN      T +  L V  LP F+  P  +S      + + + C+    +P P + W  +  ++    DS+     ++ I  + K+  G Y C  EN
Sbjct: 4133 LQIAFVQPGDAGHYTCMAANVAGS----SSTSTKLTVHVP-----PRI--------RSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNVLLANLLGKYTAE-PYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPGDVSLNK--GEQLRLSCKA-TGIPLPKLTWTFNNNIIPAHFDSVNGHSELV-IERVSKEDSGTYVCTAEN 4332          

HSP 4 Score: 64.6994 bits (156), Expect = 1.104e-8
Identity = 70/275 (25.45%), Postives = 106/275 (38.55%), Query Frame = 1
Query:  811 KKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS-----KRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSS--SPLGISFKS-YARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN--ILQIRSLEKKHLGIYQCWLENE-------WNLWASGVTVIKDFVELQETESQRENISII 1575
            +  +LP G+M   I      DSG Y C A+ +     Q      +L V  P K              ++  K ++   G  + + C  + TP   +TW    S       +      GTLSI+     DA  ++C+A  +         L V   P       P   +F+   A Q +E  C      P PTIKW H+G+ LT +E  +   ++  +L I S+     G Y C   NE       +NL      VIKD       + Q  N+S++
Sbjct: 1126 RHTFLPSGSM--KITETRTSDSGMYLCVATNIAGNVTQ----AVKLNVHVPPKI-------------QRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTTFQERVANQRIEFPCPA-KGTPKPTIKWLHNGRELTGREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKD-------KEQVTNVSVL 1373          

HSP 5 Score: 63.5438 bits (153), Expect = 2.598e-8
Identity = 60/257 (23.35%), Postives = 109/257 (42.41%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQL--------DDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKF--RKNILQIRSLEKKHLGIYQCWLEN 1482
            P I++LH+   +      +   I +     +L+I ++ P D+G Y C A      + ++ ++K           + P  +    D E+     +   + +N  L+C  E TP+  + WY  N +  ES T     ++NN ++        +DA  +SC A  +   S   F + VL  P    +           + V ++C+V    P P I WF DGK L   + +++   R  +L +++  +   G YQC + N
Sbjct: 1296 PTIKWLHNGRELT----GREPGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVH---------VPPVIK----DKEQVTNVSVLLNQLTN--LFCEVEGTPSPIIMWYKDNVQVTESST---IQTVNNGKILKLFRATPEDAGRYSCKAINIAGTSQKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQV-KGTPFPDIHWFKDGKPLFLGDPNVELLDRGQVLHLKNARRNDKGRYQCTVSN 1529          

HSP 6 Score: 63.1586 bits (152), Expect = 3.920e-8
Identity = 69/290 (23.79%), Postives = 116/290 (40.00%), Query Frame = 1
Query:  679 ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDI-KPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG------TLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALPRFS-----SSPLGISFKSYARQT-----VEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN-ILQIRSLEKKHLGIYQCWLENE 1485
            E    I+ +   +VC   +S P P  I +  D  P+ + +      I + PG   L I N +  ++G Y+C A+    +  +  ++K  +     K D+  P           KE KI      + +TL C   + P+A ++WY  + +  +SD          TL I   Q+ D   ++C+A+ +       F + +   P F       + L       A+       + + CE  N  P PT+ W+ DG  LT  +  L      +LQI   + +  G Y C   NE
Sbjct: 2583 EDVTVILNSPTSLVCEA-YSYP-PATITWFKDGTPLESNR-----NIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGL-------SPKEVKI---KVNNTLTLECEAYAIPSASLSWYK-DGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCET-NAAPPPTLTWYKDGHPLTSSDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNE 2853          

HSP 7 Score: 62.003 bits (149), Expect = 7.669e-8
Identity = 66/259 (25.48%), Postives = 99/259 (38.22%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES-------DTQFGTLSINNVQLDDASDFSCLANEVQTR---SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR----KNILQIRSLEKKHLGIYQCWLEN 1482
            PP + +L +  PI     +      + PG   L I   +  D G YTC A          S  K  LTV  P          S  D++ +   ++   EG++++L C   + P   +TWY       ES       D Q   L I   ++ D   + C A  V  R   +F L V   P        +  ++ +   V + C+    +P PTI W  + K + E  DSL+ R     + LQI   +    G Y C   N
Sbjct: 2993 PPDLSWLKNEQPIKLNTNT-----LIVPGGRTLQIIRAKVSDGGEYTCIA----INQAGESKKKFSLTVYVPP---------SIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQM--LHIKKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETIS-NPVTLTCDA-TGIPPPTIAWLKNHKRI-ENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASN 3228          

HSP 8 Score: 58.5362 bits (140), Expect = 8.810e-7
Identity = 58/219 (26.48%), Postives = 90/219 (41.10%), Query Frame = 1
Query:  868 KDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNER--KEEKIIEAT--EGSNITLYCLYESTPAAEVTWY------YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQ---TRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            ++SG Y CTA    T +   +  K +LTV      ++PR     + ++R   ++K +E +   G  +TL C  +S P   +TW        P S R+ +    G++ I   +  D+  + C+A  +    T++ KL V   P+    P     K    Q V+I C      P P I W   G  ML + E  +      L I        GIY C   N
Sbjct: 1044 EESGEYVCTA----TNTAGYAKRKVQLTVY-----VRPRV----FGDQRGLSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRH-TFLPSGSMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPK--HLKVQVGQRVDIPCNA-QGTPLPVITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATN 1245          

HSP 9 Score: 57.7658 bits (138), Expect = 1.329e-6
Identity = 56/230 (24.35%), Postives = 88/230 (38.26%), Query Frame = 1
Query:  835 AMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF--------GTLSINNVQLDDASDFSCLANEVQTRSFKLKVLAL---PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE-DSLKFRKN--ILQIRSLEKKHLGIYQCWLEN 1482
              +L IK  E  D+G Y C A  +      R D    L V  P     P         E  E ++I  T  + +TL C     P   + W   N KR E+              L I   Q  D+ +++C+A+ ++ ++ K   L++   P  + + +         + VE+ C   N +P P I+W  DGK +   E + ++   N   L I        G Y C   N
Sbjct: 3112 GQMLHIKKAEVSDTGQYVCRAINVA----GRDDKNFHLNVYVP-----PSI-------EGPEREVIVETISNPVTLTCDATGIPPPTIAWLK-NHKRIENSDSLEVRILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKYYFLSIQVPPSVAGAEIPSDVSVLLGENVELVCNA-NGIPTPLIQWLKDGKPIASGETERIRVSANGSTLNIYGALTSDTGKYTCVATN 3323          

HSP 10 Score: 55.4546 bits (132), Expect = 7.935e-6
Identity = 81/380 (21.32%), Postives = 150/380 (39.47%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS-------KRYESDTQFGTLSINNVQLDDASDFSCLANEVQT---RSFKLKVLALPRFSSSPLGISFKSYAR-QTVEIKCEVLNNVPNPTIKWFHDGK-MLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETES------QRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKW-LRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAE 1830
            PP + +L D  P+    G     + +     +L I++ + +D+G YTC A+ +  K+ +  ++   +       D               E   +   EG+ I+L C     P   + W    S        R    +    L I+  +  DA+ +SC+A+ V     + + L+V   P  ++S    +     R +++ ++CEV   +P PT+ W  DG  ++  K   +    +ILQ++++     G Y C   N      +G+T  K  + +    S        ENIS+++K      ++ L C        S T F   W + L +S+ +  L+G + +   +             T   D G Y C + +   E
Sbjct: 2132 PPTLTWLKDGHPLLKKPG-----LSISENRSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSD---------------ELTQLTVIEGNLISLLCESSGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEV-QGIPPPTVTWMKDGHPLIKAKGVEILDEGHILQLKNIHVSDTGRYVCVAVN-----VAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKN-----SVSLTCEASGIPLPSITWFKDGWPVSLSNSVRI--LSGGRMLRLMQ-------------TTMEDAGQYTCVVRNAAGE 2465          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Match: sp|Q92859|NEO1_HUMAN (Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.805e-11
Identity = 83/317 (26.18%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  604 SLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ-------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI 1518
            SLGT+ SR  ++I   L  F     E +    GN   + C +  +    P++ +  +  P+        + I LP G  +L+I N    D G Y C     G   +  SD +  L V    + I     L       K+   +    G ++ L C+    P   + W   N +  ++++         G+L I++V  DDA  + C+A   NE      +L V A P F   P  I    YA ++++I  +CEV    P PT+KW  +G M+   +     +++ LQ+  L K   G YQC  EN+     +G  +I
Sbjct:  135 SLGTIISRTAKLIVAGLPRF-TSQPEPSSVYAGNNAILNCEV--NADLVPFVRWEQNRQPLLLDD----RVIKLPSG--MLVISNATEGDGGLYRCVVESGGPPKY--SD-EVELKVLPDPEVISDLVFL-------KQPSPLVRVIGQDVVLPCVASGLPTPTIKWMK-NEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNI----YAHESMDIVFECEVTGK-PTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLI 426          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Match: sp|P70232|NCHL1_MOUSE (Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.577e-11
Identity = 102/425 (24.00%), Postives = 164/425 (38.59%), Query Frame = 1
Query:  571 FEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDS-GSYTCTASFLGTKSF-QRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYES----DTQFGTLSINNVQLDDASDFSCLANEV---QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKE---DSLKFRKNILQIRSLEKKHLGIYQCWLEN-EWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            F+      A N LGT  S     I   +  FP    E  +   G+   + C  P   P P +I +++    I      + +++Y+      L   N+E  DS   Y C A+F   ++  Q+  MK  +  +   K  KP+  L          K +   +G  + L C  E  P   + W  P S+  E     +    TL I N+   D  ++ C AN +    +  F + V   PR+   P    + + +     + CE     P PTIKW  +G +  EK        F + I    +L   H G+YQC   N    + A+    + D + L +T+++    +++      G +  L C    S K      TV W  + D  E   L G++Y   +  +     L I   T+  D G Y C
Sbjct:  103 FQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLP-PLHIYWMN----IELEHIEQDERVYMSQRGD-LYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPAQMGSLSAKTV--LKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGI--LLCEA-EGEPQPTIKWRLNG-LPIEKHPFPGDFMFPREI-SFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVV------GYSAFLHCEYFASPK-----ATVVW-EVAD--ETHPLEGDRYHTHENGT-----LEIYRTTEE-DAGSYSC 494          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Match: A0A419PC54 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_7201s PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.734e-41
Identity = 193/793 (24.34%), Postives = 323/793 (40.73%), Query Frame = 1
Query:  625 RPFR--IIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINT-TKGSKYKKIYLP--------------------------PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSS--------YDNERKEE-----KIIEATEGSNITLYCLYESTPAAEVTWYYPNS-KRYESDTQFGTLSINNVQLDDASDFSCLA----NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNV---------------------------------------PNPTIKWFHDGKMLTEKED------SLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENIS------IIDKRTAPGLTIHLEC--SLLQ----SQKDSKTNFTVKWLRLKDSLELIEL------TGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD-QNAELLHTVKYQLTID--------DQKFNEPNQLQLKSTDIPAK--------------RTEH--FEP----------SVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEF-------QNKTVDKIQQTNLMEERKPDEWSEIFMI---DDCPTTNQ--ITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSL-----RSTWSNVIEFNNILNCKLS-ISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKH 2514
            R FR  + R  L  FP    E    ++GN G+++C +P S+PS P + F H+   I+  T+ S+Y+ +Y+                           P A+IL I  LE  DSG Y C A  +  +    ++ KT L VT P   +K R + S+        YD     +     + +    G N+TL+CL+E  P     WYY  + K +  D+ FG L+I++V+L+DA  ++CLA    ++  ++SFK+KV         P   + K      + + C + +                                         P   I W ++GK + +  D             I ++++  +   G+YQCW  +    W +     +    L+E E +  N +      +I +RT  GLT HL C  S +Q     Q + +    V W R +   E I+L       G    +  + +  + +LSIVNP ++ D G Y C++YD +   LL  ++++L ID         ++ + P+   +   ++ AK              R E   + P          S+S+P  VRI+ ++ GV I W V  D+     I  F L++       Q+  V K +   + + +  DEW+  F     D   +TNQ    +      +P +    R+I             N +Q V  ++     +S+WS+ I   N+L  K   IS  A   +++E+ WT +  + S   P T D   + +   LI +  Q D H
Sbjct:   43 RVFRELVARLKLPRFPRYADERLSVLIGNTGRVICHLPRSQPSLPAVNFYHNGKQIDMLTEASRYRLVYVGGDGSGTPWSSGRSRGPRRDPLFWQQMPSAVILFIHPLELSDSGEYKCEAQLM--EHLIMAEQKTILNVTKPLAKVKARLQFSADDPGLSYLYDMYMSSQMVSGVRTLNVPVGLNLTLFCLFEGAPIVPTRWYYDGAHKNFREDSNFGILTIDSVELNDAGTYTCLAQSPESDAISKSFKIKVTTPTHLVPQPRS-TVKVRKGSNILLACLLSDKASTENGEAQSADLENRNTWQNSLDPQNRNRTDGNLIRGFQPGTDIGWLYNGKSIRKYRDEDMPLIEATEHATIFRVQNFSEHDQGVYQCWSLDNMGTWLTASISAR----LEEVEQEGWNPTTPSRHDVIQERTKEGLTGHLNCNISFMQIGRTDQFEGQEEMLVFWFRGRQIGEPIDLAESNNRAGRIKYLTSRVNRMSQLLSIVNPRRSEDSGAYSCRVYDPKTRALLGQIQFELIIDPNEEEGIETRRLSAPSVSSITVENVKAKISHSNSVETDPWVDRAEDMAYRPVTEENFLQQFSISKPTVVRISNFSTGVWISWRV-NDDTANHRISKFFLQYRVLMPAAQDYGVTKTRHRFIRQSKAHDEWAAKFWSQPKDTNVSTNQSFFCLHAPMYFQPGNIYSVRIIA------------NEDQFVQPTIQPKIYQSSWSDAISLENLLPTKPRVISLTAQNSSTLELEWTMDS-QFSQSIPNTDDAHQLGLYFLLIYRTLQ-DAH 813          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Match: A0A4Z2DKQ6 (Immunoglobulin domain-containing-like protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000017 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.094e-38
Identity = 202/811 (24.91%), Postives = 332/811 (40.94%), Query Frame = 1
Query:  526 NEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIY-------LP-------------------PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDN--------ERKEEKIIEAT---------------EGSNITLYCLYESTPAAEVTWYYPN-SKRYESDTQFGTLSINNVQLDDASDFSCLANEVQT----RSFKLKVLALPRFSSSPLGISFKSYARQTVEIKC---------------------------------EVLNNVPNP---------------TIKWFHDGKMLT--EKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI----------KDFVELQETES----QRENISIIDKRTAPGLTIHLEC---SLLQSQKDSKTN------FTVKWLRLKDSLELIEL-------TGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD-QNAELLHTVKYQLTI----DDQ------------KFNEPNQLQLKSTD----IPAKRTEHFEP---SVSRPEAVRINEYAFGVTIKWNVL--PDNKIVSVIDHFRLEF----QNKTVDK--IQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPAS-VEVMWTHNCVRESDWHPITFDI 2457
            NE+     I   + + +  L ILA    GT+TS    +   +L  FPL   +    ++GN   +VC +P S+PS P + F H+N+ ++ T+  +Y+ IY       LP                   P A ILLI +L+  D+G Y C+ S    K+   S+ +T L VT P + I+   + SS DN        E     II ++               E +N+TL+C++ES P    +WY+   +   E + +FG L IN  +L++   ++C  +   +    +SF++ V+  P  SSS L I      +Q V + C                                 +++NN   P               T +W H+G+ +T  E +++      IL+I  + K H GIYQ    N+     S V  I          K  ++L    +      + ++ I + T  GLT HL C   +LL +++   TN      +++ W R   S E + +        G KY++    +E T ILSIVNP K  D+G YIC++Y+    +LL   ++QL I    DD+            K    N+L  KS +    +P K++ H E     VS+P   R+  +   + +KW V   P  K+     H++L      QN+ +    I     +         +  ++ +    + I I  + + +P      RV++                     L S W+  + FNN+L+  L I +  V  AS + V W +   R S +     DI
Sbjct:  161 NEDINLWSIFVYNFLPDMKLLILASTQHGTITSHLIDMKPSILPAFPLHSDKYLSLLIGNTAAVVCHLPSSQPSLPTVYFYHNNIRLDLTQIDRYRLIYIGGDDSGLPWEIFTQKPHFKKANIKKHKPSAAILLIHSLQLSDTGQYYCSVSLFD-KTLS-SNQRTHLVVTKPNEKIRTHLKFSSDDNDLTYLYTDETTNNSIISSSKNENTLSTMKEIKIYENTNLTLFCIFESAPVVSTSWYFEGFTDNIEINQKFGVLMINYARLENDGIYTCSVDNSHSKLIGKSFRVVVMRSPLTSSSNLKIITTEIGKQ-VTLNCNNNELQTTNVTNELNIPLPKSPSRDEWNKWNMNKMINNTKYPIENQYDKRIINYSSVTNQWIHNGQFITMNEVKNNYHLDDGILKILKVTKSHTGIYQYMKSNQ----VSDVNSIVNDNDESISCKFHIQLDHENTIHNVTNDQVNTIFEYTLEGLTGHLNCNLSTLLLTEEYQNTNGYNEYQWSILWYRSVTSNEPLNIESINKASGGIKYII-SNVNEYTQILSIVNPKKVTDDGQYICRVYNTTTGKLLGEQRFQLIIESNNDDEMHKNKMKHELLIKKQNRNELPKKSNNNNEKLPLKQSIHHEKPQIKVSQPIIKRLANFTMAIHMKWIVYNSPIEKL-----HYQLGIKQLGQNRHIRSLIIPSNQYIHSENQSNLEQFSILPNIYENSSIIIDSRDLFQPKHTYCLRVLVLEH-----------------QLWSPWTEPVNFNNMLDTTLQIISLGVNNASCLYVEWIYIQSRNSSFTSDMTDI 941          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Match: A0A5K4EQR8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.318e-38
Identity = 218/1001 (21.78%), Postives = 392/1001 (39.16%), Query Frame = 1
Query:  583 LHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIY-------LP-------------------PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNE--------------------RKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS--KRYESDTQFGTLSINNVQLDDASDFSCLANEVQT----RSFKLKV-------LALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTI--------------------------------------KWFHDGKMLTEKED--SLKFRKNILQIRSLEKKHLGIYQCWLENEW----------NLWASGVTVIKDFVEL-------QETESQRENISIIDKRTAPGLTIHL----------ECSLLQSQKDSKTNFTVKWLRLKDSLELIEL-------TGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD-QNAELLHTVKYQLTIDDQKFNE-------------------------PNQLQLKS----TDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQNKTVDKIQQTN--------LMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPAS-VEVMWTHNCVRE--------SDWHPITFDILYVSMKDCLISKKCQPD-------KHLKNFESILIFPEFKDLIQIKTERSDVDF-FKANITD-LRSKCEYVIAVY---GKVITTMQDIFYIPLSN--------------------IIKVSTSEDKDE---------------NRISLEMSSDSDDARNR----------VIFLILGSLAGVLFVVAAVMFGMCTWY 2874
            L ILA  + GTV+S    +   VL  FP    +    ++GN   ++C +P S+PS P + F H+N+ ++ T+  +Y+ IY       LP                   PGA+ILLI +L+  D+G Y C+ S         S+ +T L VT P + I    + S  D +                        K I+  E +N+TL+C++ES P     WYY +   +  E + +FG L I   + ++   ++C  +   +    +SF++ V       L  P+  ++ +G                 +N +P P +                                      +W H+G+ +T  +D  +  F   +L+I  +E+ H GIYQ    N++          N +       K +++L        ET+ Q   +  I + T+ GLT HL          E     +Q +++  +++ W R   S E + +        G KY++    +E T ILSIVNP K  D+G YIC++Y+    +LL   ++QL I+    +E                         PN+ +L S     ++  K+TE  +  VSRP   R+  +   V IKW V       S I     +   K +  I+QT          +  R      E  ++ +    + I    + + +P ++   RV++                     L S W+  + F+N+L+  L I +   +  + + + W +   R         +D++ +TF+I+Y ++ + L  +K   +        + K F   +   +   L  +   R + D   K  + D L+    Y ++VY    K+       ++  LSN                     +K ST+E+ ++               ++++ ++ ++ +D  ++          V+ +ILGSLAGVL ++  V+   C WY
Sbjct:  164 LLILATTNYGTVSSHLIDLKTSVLPAFPPHSDKYLSLLIGNTAVVICHLPLSQPSLPTVHFYHNNIKLDLTQTDRYRLIYIGGDDSGLPWEIYSQKPHFRQENFKKHKPGAVILLIHSLQLSDTGQYYCSVSLFDKTI--SSNQRTHLVVTKPNEKIWTHLKFSLDDPDLSYLYNNNNNNGNNNNNENSLNRIKEIKINENTNLTLFCIFESAPVVSTRWYYKDEFMENIEINQKFGVLIIKYARPENEGIYTCSVDNSHSKLIGKSFRIIVIRAPTTNLLNPKLITTEIGKQVTLNCNNNNNNNVINMNQIPFPKLPTPDEWNKWDYNKRINHSKYYIEKQYKKKKLNYSPYINQWIHNGQFITMNDDNNNYHFEDGLLKILKIEQSHTGIYQYMKSNQYTNSMDDNTNENEYDEESVNCKFYIQLNDEKFVHNETDQQ---LKTIFEHTSEGLTGHLNCNLSSLLLTESYQNTNQVNNQYQWSILWYRSVTSNEPLNIESVNKASGGIKYII-SNVNEYTQILSIVNPRKITDDGQYICRVYNTTTGKLLGEQRFQLIIESINNDENIHKNFIKHETFLTKSSLSSISSEIPNKYELPSKRNEQNLVLKQTEKPQIKVSRPIVKRLANFTMAVHIKWTVYH-----SPIKELHYQLGIKHLGNIRQTKSIITFSNEYIHSRNKSNGEEFSILPNIYDNSSIIFDSRDLFQPQNSYSLRVLVLEH-----------------QLWSPWTEPVNFDNMLDTNLQIISIVTSNQTCLYIEWIYIQSRNHSFTTMNITDFNDLTFNIIYRNLSENLNERKSLLELWTEFIFNNEKQFS--MDLSQMNQLGDLYIRRINGDHTLKGYLLDGLQPNVTYAVSVYIEVTKIYHYQSQKYFTRLSNEVVQKTLPKLISLSINENQFFVKNSTNENINQLMMVDSFVQSTSNMKSKMTGQVGNNKNDLTSKLTKNYQHDSYVLIVILGSLAGVLLIIFIVLITFCIWY 1134          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Match: A0A3Q0KNN1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.336e-37
Identity = 218/1001 (21.78%), Postives = 392/1001 (39.16%), Query Frame = 1
Query:  583 LHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIY-------LP-------------------PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNE--------------------RKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNS--KRYESDTQFGTLSINNVQLDDASDFSCLANEVQT----RSFKLKV-------LALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTI--------------------------------------KWFHDGKMLTEKED--SLKFRKNILQIRSLEKKHLGIYQCWLENEW----------NLWASGVTVIKDFVEL-------QETESQRENISIIDKRTAPGLTIHL----------ECSLLQSQKDSKTNFTVKWLRLKDSLELIEL-------TGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYD-QNAELLHTVKYQLTIDDQKFNE-------------------------PNQLQLKS----TDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQNKTVDKIQQTN--------LMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPAS-VEVMWTHNCVRE--------SDWHPITFDILYVSMKDCLISKKCQPD-------KHLKNFESILIFPEFKDLIQIKTERSDVDF-FKANITD-LRSKCEYVIAVY---GKVITTMQDIFYIPLSN--------------------IIKVSTSEDKDE---------------NRISLEMSSDSDDARNR----------VIFLILGSLAGVLFVVAAVMFGMCTWY 2874
            L ILA  + GTV+S    +   VL  FP    +    ++GN   ++C +P S+PS P + F H+N+ ++ T+  +Y+ IY       LP                   PGA+ILLI +L+  D+G Y C+ S         S+ +T L VT P + I    + S  D +                        K I+  E +N+TL+C++ES P     WYY +   +  E + +FG L I   + ++   ++C  +   +    +SF++ V       L  P+  ++ +G                 +N +P P +                                      +W H+G+ +T  +D  +  F   +L+I  +E+ H GIYQ    N++          N +       K +++L        ET+ Q   +  I + T+ GLT HL          E     +Q +++  +++ W R   S E + +        G KY++    +E T ILSIVNP K  D+G YIC++Y+    +LL   ++QL I+    +E                         PN+ +L S     ++  K+TE  +  VSRP   R+  +   V IKW V       S I     +   K +  I+QT          +  R      E  ++ +    + I    + + +P ++   RV++                     L S W+  + F+N+L+  L I +   +  + + + W +   R         +D++ +TF+I+Y ++ + L  +K   +        + K F   +   +   L  +   R + D   K  + D L+    Y ++VY    K+       ++  LSN                     +K ST+E+ ++               ++++ ++ ++ +D  ++          V+ +ILGSLAGVL ++  V+   C WY
Sbjct:  164 LLILATTNYGTVSSHLIDLKTSVLPAFPPHSDKYLSLLIGNTAVVICHLPLSQPSLPTVHFYHNNIKLDLTQTDRYRLIYIGGDDSGLPWEIYSQKPHFRQENFKKHKPGAVILLIHSLQLSDTGQYYCSVSLFDKTI--SSNQRTHLVVTKPNEKIWTHLKFSLDDPDLSYLYNNNNNNGNNNNNENSLNRIKEIKINENTNLTLFCIFESAPVVSTRWYYKDEFMENIEINQKFGVLIIKYARPENEGIYTCSVDNSHSKLIGKSFRIIVIRAPTTNLLNPKLITTEIGKQVTLNCNNNNNNNVINMNQIPFPKLPTPDEWNKWDYNKRINHSKYYIEKQYKKKKLNYSPYINQWIHNGQFITMNDDNNNYHFEDGLLKILKIEQSHTGIYQYMKSNQYTNSMDDNTNENEYDEESVNCKFYIQLNDEKFVHNETDQQ---LKTIFEHTSEGLTGHLNCNLSSLLLTESYQNTNQVNNQYQWSILWYRSVTSNEPLNIESVNKASGGIKYII-SNVNEYTQILSIVNPRKITDDGQYICRVYNTTTGKLLGEQRFQLIIESINNDENIHKNFIKHETFLTKSSLSSISSEIPNKYELPSKRNEQNLVLKQTEKPQIKVSRPIVKRLANFTMAVHIKWTVYH-----SPIKELHYQLGIKHLGNIRQTKSIITFSNEYIHSRNKSNGEEFSILPNIYDNSSIIFDSRDLFQPQNSYSLRVLVLEH-----------------QLWSPWTEPVNFDNMLDTNLQIISIVTSNQTCLYIEWIYIQSRNHSFTTMNITDFNDLTFNIIYRNLSENLNERKSLLELWTEFIFNNEKQFS--MDLSQMNQLGDLYIRRINGDHTLKGYLLDGLQPNVTYAVSVYIEVTKIYHYQSQKYFTRLSNEVVQKTLPKLISLSINENQFFVKNSTNENINQLMMVDSFVQSTSNMKSKMTGQVGNNKNDLTSKLTKNYQHDSYVLIVILGSLAGVLLIIFIVLITFCIWY 1134          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Match: A0A504YZV4 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_00507 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 2.713e-37
Identity = 198/891 (22.22%), Postives = 372/891 (41.75%), Query Frame = 1
Query:  214 MKDLLVLYTIW--MNIALLVRLN---QEIPQFLQLPDPEIYE---------DENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDV----------GIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKG-----------SKYKKIYLP---PGAMI---LLIKNLEPKDSGSY---------TCTASFLGTKSFQRSD--MKTRLTVTTPKKDIKPRFRLSSYDNE----RKEEKIIEATEGSNITLYCLYESTPAAEVTWYY--PNSKRYESDTQFGTLSINNVQLDDASDFSCLAN----EVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKC------------EVLNNVPNPT---------------IKWFHDGKMLTEKEDSLKFRKNILQIRSLEKK-HL--------GIYQCWLENEWNLWASGVTVIKDFVELQ---ETESQRENISIIDKRTAPGLTIHLEC---SLLQSQKDSKTNFTVK-------WLRLKDSLELIELTGNKYVMFKKKSE----GTVILSIVNPTKNLDEGIYICQLYDQNA-ELLHTVKYQLTIDDQKF----NEPNQLQLKSTDIPAKRTEHF-------------------------EPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQ--NKTVD------KIQQTNLMEERKP---DE--WSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISN-KAVTPASVEVMWT 2409
            MK   V++ ++  +N+A +V  N   Q++P F++ P   +Y          +E      ++ IV P N+++ +A     +    D    L      +    D             I+  + Q      ++  WK ++   +L+    LH+LA  S GT+ SRP R+I   L  FP    ES   ++GN G++VC +P ++PS P + F  + + ++ + G           +K K+   P   P   +   L   + +P+ S  Y         T + S  G       D  +    ++TT K  I    R+++ D          ++    EG N+TL+C YES P     W++  P S  Y+ D +FG L I++V  ++ + ++C  N    E   +SFK+ V         P G        Q + + C            +  + +P  +               + W+HDGK +  K+   K+ K  +++ +   + H+        GIYQCW  +    W++  +V+    E +   E +  +    I  +RT  GLT H+ C   ++L+     +T+  ++       W R     E I+L+ N++   K         + ILS+VNP K+ D+G+Y C++YD++   +L  +K++L ID ++     + P +++ K+      + +H                          E  +S P+  R+  +  G+ + W +L D  + S I+ F +E +    T D      +  +T L     P   DE  W+    I +    N+I + +      N  I+   +  ++++  +   + +  T   +++S WSN I F N+++ + +I+   A     +++ WT
Sbjct:    1 MKFFAVVHFLFCSVNVATIVDNNEDKQDLPSFIKEPPSVVYYPFSERAFEINEQPAAFDLEAIVYPSNSTVTIA-----ASVPDDPENYLFLPVLRTSTHVDHSSSSVSFHQPYAILYTTSQQATQPYDKHTWKARVY--NLLPNAMLHLLASTSSGTIRSRPIRLIHTELPGFPRFADESLSLLIGNTGRLVCHLPRAQPSLPVVNFYQNGIRLDLSDGQWYTVFGFGFENKIKECCEPIAEPHEKVPVRLQFSSDDPEISYLYGHLVTSSSSTSSLSSSGPDLTHEKDAALANLKSITTSKNLISIGGRINNADGSTVISSTPTRVFMVPEGMNLTLFCTYESAPIVSTRWFFDAPQSNVYQ-DGRFGVLMISHVTKNNEATYTCSPNIPALETTRKSFKILVKQRKLLKMEP-GPMVTVGTGQNISLHCGHQKTKHQAHSSKEFSALPTMSHDSDSDFRHLTLGTDLGWYHDGKSIGIKQ---KYDKTFIEVNTDGTRLHIINISNYDQGIYQCWKIDGTGAWSTASSVVTMGSETRHESEMQEAKAGEGITQERTREGLTGHMTCNVSAILRKGPLKRTDSGIQPNDVVIVWYRGASDSEPIDLSSNQFGGIKYLRTTVDWASQILSVVNPRKSKDDGLYACKVYDRSTNSVLGEMKFELIIDSERKVVPEDTPKEMESKALTSVQAKNDHMKIQTVMGEISNIQDISSRIKSVLKREFPISTPKIRRLANFTTGIHVSW-LLSDRTVASQIERFEVELRMLKSTTDGRSMRIRRSETALRASLLPFSVDETYWTLPSRIANAGVKNEICLAE------NKGIQAGRVYSVRIVGIVRPEDQIEFTSEIAVKSPWSNRISFENLVSLQPTITTLLAANRTQLKLEWT 872          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 82.0333 bits (201), Expect = 6.091e-15
Identity = 85/322 (26.40%), Postives = 140/322 (43.48%), Query Frame = 1
Query:  589 ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL---HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            I + +SLG + SR  R+    +  F     E++   +G+   + C +     +P  + F+   HD  P+   +    +   LP GA  L+I N   +D+G Y C     G TK+ + +++            I P F+        K+   +    G ++ L C+    PAA V W   +          G+L I N+  +DA  + CLA   N+      +L V   P+F   P+     ++A +  +I  +CEV  + P PTIKW  +G  +   +     ++  LQ++ L K   G YQC  ENE  N+ A+   VI D
Sbjct:  117 IASIDSLGMIISRSARLSVAGMPRF-SGQPEASSVFLGDSQVLSCEV-----NPDLVAFIRWEHDKEPVLLDQ----RVFTLPSGA--LVISNATEEDAGLYRCVLENAGPTKTSEEAELT-----------ILPEFKF------LKQPGPVSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVLGG----GSLQIFNLTEEDAGMYRCLAENMNDSIEAQAELTVQVPPQFLKRPV----STFAHEATDIVFECEVTGS-PAPTIKWVKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVILD 400          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 80.1073 bits (196), Expect = 2.418e-14
Identity = 88/328 (26.83%), Postives = 144/328 (43.90%), Query Frame = 1
Query:  589 ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL---HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            I + +SLG + SR  R+    +  F     E++   +G+   + C +     +P  + F+   HD  P+   +    +   LP GA  L+I N   +D+G Y C     G TK+ + +++ T L  T   ++ K            K+   +    G ++ L C+    PAA V W   +    ES          G+L I N+  +DA  + CLA   N+      +L V   P+F   P+     ++A +  +I  +CEV  + P PTIKW  +G  +   +     ++  LQ++ L K   G YQC  ENE  N+ A+   VI D
Sbjct:  112 IASIDSLGMIISRSARLSVAGMPRF-SGQPEASSVFLGDSQVLSCEV-----NPDLVAFIRWEHDKEPVLLDQ----RVFTLPSGA--LVISNATEEDAGLYRCVLENAGPTKTSEEAEL-TILPETLEGREFK----------FLKQPGPVSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVEESSDGRVQVLGGGSLQIFNLTEEDAGMYRCLAENMNDSIEAQAELTVQVPPQFLKRPV----STFAHEATDIVFECEVTGS-PAPTIKWVKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVILD 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 80.1073 bits (196), Expect = 2.446e-14
Identity = 89/328 (27.13%), Postives = 145/328 (44.21%), Query Frame = 1
Query:  589 ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL---HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            I + +SLG + SR  R+    +  F     E++   +G+   + C +     +P  + F+   HD  P+   +    +   LP GA  L+I N   +D+G Y C     G TK+ + +++ T L  T   ++ K  F         K+   +    G ++ L C+    PAA V W   +    ES          G+L I N+  +DA  + CLA   N+      +L V   P+F   P+     ++A +  +I  +CEV  + P PTIKW  +G  +   +     ++  LQ++ L K   G YQC  ENE  N+ A+   VI D
Sbjct:   98 IASIDSLGMIISRSARLSVAGMPRF-SGQPEASSVFLGDSQVLSCEV-----NPDLVAFIRWEHDKEPVLLDQ----RVFTLPSGA--LVISNATEEDAGLYRCVLENAGPTKTSEEAEL-TILPETLEGREFK--FL--------KQPGPVSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVEESSDGRVQVLGGGSLQIFNLTEEDAGMYRCLAENMNDSIEAQAELTVQVPPQFLKRPV----STFAHEATDIVFECEVTGS-PAPTIKWVKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVILD 397          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 80.1073 bits (196), Expect = 2.506e-14
Identity = 89/328 (27.13%), Postives = 145/328 (44.21%), Query Frame = 1
Query:  589 ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL---HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            I + +SLG + SR  R+    +  F     E++   +G+   + C +     +P  + F+   HD  P+   +    +   LP GA  L+I N   +D+G Y C     G TK+ + +++ T L  T   ++ K  F         K+   +    G ++ L C+    PAA V W   +    ES          G+L I N+  +DA  + CLA   N+      +L V   P+F   P+     ++A +  +I  +CEV  + P PTIKW  +G  +   +     ++  LQ++ L K   G YQC  ENE  N+ A+   VI D
Sbjct:  112 IASIDSLGMIISRSARLSVAGMPRF-SGQPEASSVFLGDSQVLSCEV-----NPDLVAFIRWEHDKEPVLLDQ----RVFTLPSGA--LVISNATEEDAGLYRCVLENAGPTKTSEEAEL-TILPETLEGREFK--FL--------KQPGPVSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVEESSDGRVQVLGGGSLQIFNLTEEDAGMYRCLAENMNDSIEAQAELTVQVPPQFLKRPV----STFAHEATDIVFECEVTGS-PAPTIKWVKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVILD 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Match: neo1a (neogenin-like [Source:NCBI gene;Acc:103031419])

HSP 1 Score: 79.7221 bits (195), Expect = 2.930e-14
Identity = 89/328 (27.13%), Postives = 145/328 (44.21%), Query Frame = 1
Query:  589 ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFL---HDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQ------FGTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKD 1524
            I + +SLG + SR  R+    +  F     E++   +G+   + C +     +P  + F+   HD  P+   +    +   LP GA  L+I N   +D+G Y C     G TK+ + +++ T L  T   ++ K  F         K+   +    G ++ L C+    PAA V W   +    ES          G+L I N+  +DA  + CLA   N+      +L V   P+F   P+     ++A +  +I  +CEV  + P PTIKW  +G  +   +     ++  LQ++ L K   G YQC  ENE  N+ A+   VI D
Sbjct:  112 IASIDSLGMIISRSARLSVAGMPRF-SGQPEASSVFLGDSQVLSCEV-----NPDLVAFIRWEHDKEPVLLDQ----RVFTLPSGA--LVISNATEEDAGLYRCVLENAGPTKTSEEAEL-TILPETLEGREFK--FL--------KQPGPVSRVAGDSVLLPCVVTGYPAAYVRWMLDDQPVEESSDGRVQVLGGGSLQIFNLTEEDAGMYRCLAENMNDSIEAQAELTVQVPPQFLKRPV----STFAHEATDIVFECEVTGS-PAPTIKWVKNGDSVIPSDYFRIMKEQNLQVQGLVKSDEGFYQCLAENEAGNIQATAQLVILD 411          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Match: igdcc3 (immunoglobulin superfamily, DCC subclass, member 3 [Source:ZFIN;Acc:ZDB-GENE-080303-24])

HSP 1 Score: 77.7962 bits (190), Expect = 1.561e-14
Identity = 87/313 (27.80%), Postives = 130/313 (41.53%), Query Frame = 1
Query:  595 ARNSLGTVTSRPFRIIRKVL-----NPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVT--TPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESD----TQFGTLSINNVQLDDASDFSCLANEVQTR-----SFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKED-SLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            A+N  G + SR  R++   L     +P P+V  E      G V +  C+I +++P P  +     N    T    +Y   +LP G  +L I  + P+DSG + C AS +  +   R  M   LTVT   P K  K    LS   N       +  T      L C+    P   V+W   + +    +       G L I++V +  A  + C AN   TR       +L V A P F   P  ++ +S     V + C      P+P I W H+G  L + E   L+   + L I+ +  +  GIYQC  EN
Sbjct:   80 AQNRFGLLLSRRARVLASTLPRFSQHPQPVVVEE------GGVARFQCLI-NARPDP--LVTWEKNRTALTEDDDRYT--FLPSG--VLQITGVRPEDSGYFRCIASNVAGR---RRSMDALLTVTPAVPAKSSKDPVILSGPQN-------LTLTVHQTAILECIATGNPRPIVSWSRLDGRPIGVEGIQVVGTGNLMISDVAVQHAGVYVCAANRPGTRVRRTAQGRLIVQAPPEFMQPPQSVT-RSLGASAV-LTCSA-QGTPSPRIIWLHNGLPLHQSERVRLQNGNSTLTIQRVCSEDEGIYQCTAEN 366          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 73.1738 bits (178), Expect = 4.260e-13
Identity = 60/221 (27.15%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN----SKRYESDTQFGTLSINNVQLDDASDFSCL---ANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            LL++N    D G Y C   F G ++F  ++  T L+V        P    +      +    +    G   TL C+    PA  V W        S+R+ S    G + I+NVQ DDA D++C+    NE Q    KL VL  PR    P   +  +     + ++C+     P P I WF +G ++   +D ++     L +  + +   G+YQC  E+E
Sbjct:   58 LLLQNASMADGGKYFCQLVF-GGRTF--TNQGTNLSVL-------PEMESNRLCVVLRHPVDVSVRLGHTATLECVVAGFPAPSVHWTRGTESVLSERF-SVVAGGIMRIDNVQEDDAGDYTCIIKAQNETQRLYAKLTVLEPPRILHGPE--NRNASVSDDIILECQA-EGRPRPVISWFQNGDLII-PDDFIQIVDGSLHVLGVMRSDEGVYQCMAESE 263          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 68.5514 bits (166), Expect = 1.761e-11
Identity = 64/223 (28.70%), Postives = 91/223 (40.81%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLALPR----FSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L ++   P D G YTC AS         +    R + T   K   P+F L+       E++++  TEG  + L+C  +  P   + W    S+   SD +      GTL I  V L D   F C A N V  R    ++  LPR    FS +P  I+  S   + V I C      P P++ W  DG  +TE        +  L+IR       G Y+C   N
Sbjct:  334 LHVERAGPGDEGRYTCHAS--------NNQDSIRASATILLKS-APQFILA------PEDQVV--TEGHTVDLHCEAQGRPLPVIAWTKAGSQ-LPSDRRLTVLSSGTLRIARVALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPVFSVTPSDITTDSG--RDVRIACSAQGE-PQPSLMWAKDGVHITESGKFHVSAEGYLEIRDAGPADQGRYECIARN 535          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001736.1 (pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 gene:ENSPMAG00000001554.1 transcript:ENSPMAT00000001736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 2.154e-11
Identity = 68/274 (24.82%), Postives = 108/274 (39.42%), Query Frame = 1
Query:  700 GNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYD----NERKEEKIIEATEGSNITLYCLYESTPAAEVTW----YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSF-----KLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            G V ++ C +   +P P  I +  D   +      +Y+   LP G  +L I  +  +D+G Y C A+ +    + R   +  ++V  P +       L  Y+     +R     +EA  G    L C+ +  P   V+W    + P    +      G L + +VQ   A  + C A+   TR+F     +L VLA P F   P  +S       T    C     VP P + W  +G+ +      +K   N L I  L  +    YQC  EN
Sbjct:   21 GEVARLECRV-SGRPEP-LIAWERDGTAL-PADSPRYRHTLLPSG--VLQISAIRSEDAGRYRCQATNMAATRYSR---EVEVSVLPPGE-------LEGYEKPNITQRPRNVTVEA--GGTAVLECVAQGRPRPIVSWSRLEHLPLDVYHSQVLGSGNLLLADVQPHHAGVYVCRASVPGTRNFTTATGQLTVLAAPWFVEQPESVSRPRAG--TARFMCHA-EGVPPPAVAWLKNGEPI-HSNGRVKVLDNRLVITQLIAEDEAYYQCVAEN 273          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005303.1 (pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1 gene:ENSPMAG00000004817.1 transcript:ENSPMAT00000005303.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 8.539e-9
Identity = 64/236 (27.12%), Postives = 92/236 (38.98%), Query Frame = 1
Query:  829 PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIK-PRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTW-------YYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANE-----VQTRSFKLK-VLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTI--KWFHDGKML-TEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            PG   L I +L   D G+YTCTA     ++     M   ++ +T    I  PR R             +   EGS   L C+    P   V W         P+   Y +++  G L + NV  D A  + C         V  R   ++ V+  P     P  +  +    Q+V ++C VL   P   I  +W   GK+L T + DS  F  +  +I SL     G Y C L NE
Sbjct:  267 PGTSSLDIIDLRFTDFGTYTCTARLSRARTLSDISMDVNISSSTVPPTISVPRGR-----------SPVVVREGSMADLQCIVSGKPKPVVLWSRVDQDALMPDGALY-TESHDGCLHLTNVTRDMAGSYRCQTGRFNGFNVSPREATVQLVVQYPPVVEPPTAV-LRQGLGQSVSMECRVLRANPARIIAYEWRFKGKVLATSRLDSGGFLSS-HRISSLSNDDYGSYSCILANE 488          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Match: EDO26294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCD9])

HSP 1 Score: 63.5438 bits (153), Expect = 2.453e-10
Identity = 58/222 (26.13%), Postives = 94/222 (42.34%), Query Frame = 1
Query:  844 LLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN----SKRYESDTQFGTLSINNVQLDDASDFSCLANE----VQTRS-FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            L +  L+  DSG YTCTA     ++ + +D  T +T   P + +K    +S           + A E + +TL C     P   V W        SK +E     G L +    L D+ ++ C A      V  +S  ++KVL   + S+  LG +  + +  TV + C     VP+P + W+ DG       ++L     +L + +L     G+YQC   N
Sbjct:   46 LTVAKLQLSDSGVYTCTA-----RNLKGNDTMTSVTSIVPVEALKNLEPVSVLIGAN-----LTAFEKAPVTLTCKATGLPLPTVRWIKGGRQLVSKGHEI-VAGGRLFLGKATLGDSGEYECTATSPLGYVSAKSNLEIKVLRRDKISTD-LGKNVTTLSGNTVSLLCNA-TGVPSPKLSWYKDG-------ETLNISHAVLTLPTLSPSDSGLYQCEARN 247          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Match: EDO49556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM0])

HSP 1 Score: 63.5438 bits (153), Expect = 6.644e-10
Identity = 83/380 (21.84%), Postives = 143/380 (37.63%), Query Frame = 1
Query:  751 PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPN-----SKR--YESDTQFGTLSINNVQLDDASDFSC-LANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEK---EDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQL 1857
            P I++  D+ P+   K S+  ++        L I    P D+  YTC A+            K+  T      DI     +   ++E      I+  EG ++ L C+    P A+V WY  +      +R  Y++D    TL I + +LDD +++ C + N   +   K +++  P F   P   +F       V +   V    P P ++WF D K +      E   K  ++ L+I+  +    G Y               TV+ +    ++T +   NI    K   P     ++  L   + D K     ++L + D                   EG +   I+   K LD G+YICQ  +   +     + Q+
Sbjct:    8 PEIQWFKDDKPV---KPSQKIRVDYRDDIHSLTIVGASPDDTAKYTCKAT-----------NKSGTTTRNINVDISAPIIIKPLNDE------IDVLEGDSVRLECVISGGPDAQVLWYKDDYLLEEDERIMYDTDGDQHTLIIQSAELDDEAEYKCVVTNIAGSVDVKTELIIAPEFQKEPEKSTFDVNTGDDVSLDLTVTGK-PTPKVEWFKDDKPVKGTRRLEVKAKDDEHSLKIKGGKPDDSGKY---------------TVVAESPAGRDTRTYEVNI----KGEKPEFKQKMQ-PLQVLEGDEKVAEEGRFLIVDD------------------EEGDLFSLIIGNAKPLDSGVYICQATNDTGKATAEAEIQI 328          

HSP 2 Score: 54.6842 bits (130), Expect = 3.514e-7
Identity = 73/326 (22.39%), Postives = 127/326 (38.96%), Query Frame = 1
Query:  595 ARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLP--PGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP-----NSKRYE--SDTQFGTLSINNVQLDDASDFSCLA-NEVQ--TRSFKLKV---LALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKN----ILQIRSLEKKHLGIYQCWLENEWNLWASGVTV 1515
            A N  G  T+     I ++L        E+ +  +     +   +  +    P + +  DN P+     ++  +I +     + I+ I  + P DSG+Y C A         ++ + TR  +   ++   P    S  +        +E  EG+ +TL C +  TPA    W+       ++ RYE   +    TL I     DD   + C+A N+V   T    LKV   +  P  +            ++ + I   +L N P P +KWF DGK + +    L  R       L I + E +  G Y C  +N+    ++ + V
Sbjct:  313 ATNDTGKATAEAEIQIEELLVAPEFAEEEATQLTLIEDDDMTLELHVTGKPKPEVHWTKDNKPL-----TEDDRIIIDHKGDSCIVDIMAVTPNDSGTYKCEAK-------NKAGVNTRTFIVNVEE--APEITESLQE--------MEELEGNPVTLTCKFTGTPAPVAEWFKASTPLTDTDRYEFIEEGDSYTLIIKTTVRDDDDTYKCVASNQVGKVTCRGDLKVTEKMFPPEITRPERTEKIVLLEKEELVINVTILGN-PRPDVKWFKDGKPIRQSS-RLNIRPRGDTYTLNIHTTEPEDAGSYTCEAQNKMGTSSTTIDV 614          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Match: EDO49550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL4])

HSP 1 Score: 60.4622 bits (145), Expect = 2.416e-9
Identity = 73/312 (23.40%), Postives = 128/312 (41.03%), Query Frame = 1
Query:  694 IMGNVGQIVCMIPHSKPSP-PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPK-----------KDIKPRFRLSSYDN----ERKE--EKI--IEATEGSNITLYCLYESTPAAEVTWYYPNSK-----RYE----SDTQFGTLSINNVQLDDASDFSCLAN------------EVQTRSFKLKVLALPRFSSSPLGI-----SFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKM-LTEKEDSLKFRKNI--LQIRSLEKKHLGIYQCWLEN 1482
            + G +G+ V      + +P P + F  ++  I    G +Y  +    G  +L I+N  P+D+G Y C A     +   +  +     +T P+           ++   R   S++ N     R E  EK+  +E TEG         +  P  EV WY+ +++     R+E     +T + +L++  V  +DA  + C+A             EV  R F       P F +    I        +   + ++++C V +  P PTI W  DG + LT+      F  ++  L IR ++    GIY+C  +N
Sbjct:   10 VEGRIGEDVRFEIQVEGTPVPAVTFHRESEQI--YDGGRYSIVEEENGLFVLTIRNTRPEDAGEYQCIAVNGAGEVTSKGYLHVEEELTIPQFIDMGTYKCQVRNDLGRTSTSAHLNIIVATRPEFKEKLTKVEVTEGDRAKFEVRVKGYPYPEVEWYHGSNRILDEDRFEIESVKETGYYSLTVGEVVQEDAGMYKCIAVNKAGKSTCRADLEVNERQF------APEFETEEPTILQRLQPVDTIEGEAIKMECRV-SGKPEPTITWLKDGLVFLTDNRIKTYFDGDVCTLTIRDVKLGDEGIYRCNAKN 312          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Match: EDO28796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5G7])

HSP 1 Score: 59.6918 bits (143), Expect = 2.494e-9
Identity = 62/271 (22.88%), Postives = 114/271 (42.07%), Query Frame = 1
Query: 1012 RKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLA----LPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYIC 1806
            R  E ++ A +G N+ + C+    P   + W +    RY +D   GT+++ +VQ +D   ++C A N + +     K+++    +PRF   P  +    Y      + C++    P P I+W    + +         R+  L I+  E++  G Y C   N+  +++A  V  +   V    T+S    +++  +    G T+ L C+   S        T++W   KD   LI    N         EG++++    P    D+G Y C
Sbjct:    4 RPPETLV-AKQGQNLKIPCIATGFPEPVIAWSHDGKPRYSTD--IGTMTLESVQFNDRGTYTCQAKNFIGSARITFKLISIFAVIPRFVQPPP-VYLPGYIGWETTLTCDIF-GFPPPHIEWTRALQQIHSGRTRQAGRR--LIIKKTEQQDRGPYMCTGTNKLGSVFALIVLTVYPVVPPTITKSPPPVVTVQRR----GATLQLTCAAQGSPTP-----TIEW--SKDG-RLIST--NDSRSEANTREGSLVMPYFQPE---DQGDYKC 250          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Match: EDO41500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4D5])

HSP 1 Score: 59.3066 bits (142), Expect = 1.283e-8
Identity = 104/473 (21.99%), Postives = 173/473 (36.58%), Query Frame = 1
Query:  226 LVLYTIWMNIALLVRLNQ-EIPQFLQLPDPEIYEDENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLH-ILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFL--------GTKSFQRSDMKTRLTVTT--PKKDIKPRFRLSSYDNERKEEKI--------IEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFG-----TLSINNVQLDDASDFSCLAN------------EVQTRSFKL---------KVLALPR-FSSSPLGISFKSYAR------QTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            L+L  I  N A+L   N  + P+F++ P   I   ++T +++   I +PV  +I L           D  ++            DD  +++ S  +           ++  R     ++ ++  LA N  GTV SR   +   VL+       +S     G   +  C +  + P+P  I + H+   I  +K    + + LP GA  L I N++  D G+Y C AS +         T + Q+   + R+  T   PK  +       S+   +  ++              G    L C+    P   V W          D          L I +    D  ++ C+ +             VQ R   L         +V  LP  +S  P  I+     +       T+ ++C     VP P I W  +GK L   +       N L I+SL  K  G+YQC+ EN+
Sbjct:    4 LILLVIAGNFAVLGSSNLLQPPRFVEEPSAVIALRKSTVQINCSTIATPVARTIWL----------KDGARI----------KPDDRHVVLTSGAL-------RIQSVQGRRKGFGNDEGVYQCLASNRAGTVASRKVTLHIAVLSRKFEEQPQSINAWEGTTARFSCKVKKAYPAP-SISWEHNGQVIVPSK----RHVVLPNGA--LQIHNVQQVDQGTYQCVASNIARIRRSNTATLTVQQVLWQGRIAPTAFLPKVKVIYLGTYCSFIKTKSSKQPNFTTIPSNTSVISGEEAVLECIATGVPVPTVQWKKVGGADRAYDYSLAKPGGCNLRIRSASPKDGGEYMCIVSASGRSMTHSTFLSVQGRLVDLDFFVVCNFRRVFFLPSVYSKPPHFINTPKLPKGLLDIGATLTLQCSA-TGVPPPRITWLKNGKELVGNQRQSGI-NNDLVIQSLSTKDSGVYQCFAEND 440          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Match: hmcn2 (hemicentin-1 [Source:NCBI gene;Acc:101165068])

HSP 1 Score: 84.7297 bits (208), Expect = 1.106e-15
Identity = 98/380 (25.79%), Postives = 162/380 (42.63%), Query Frame = 1
Query:  592 LARNSLGTVTSRPFRIIRKVLNPFPLV--HHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF----GTLSINNVQLDDASDFSC----LANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIE 1701
            +A N +GTV     ++    + P  +     ES   I G++  ++C +  + P PP I +  D   +  + G     +++ PG M+ L +    +D+G Y CTAS     S  +      L++  P   +KP   L   ++E    ++     GS++TL C+    P  EVTWY  N ++  +          L I  VQ+ D   ++C    +A +V  R+FKL V   P     PL  S  S     V + CE    VP P+I W  DG  ++  +     R N L++  L   H G Y C  +N     + G T  KD+    ++ +  ++    D     G  + L+C +     +      + W  LKD + L+E
Sbjct: 1801 VAENKVGTVE----KLFSLTVQPPTITGPREESVSVIEGHMASLLCDV-QAYP-PPEITWTRDGQVLQFSTG-----VHILPGQMLQLPR-ARLEDAGQYVCTAS----NSAGQDQKSFLLSIYLPT--LKP---LHDAESESMTPQL-----GSSVTLRCVANGFPKPEVTWY-KNGQQLAAGNGLKMNSNQLEIIGVQISDGGTYTCKVSNMAGQVD-RTFKLAVH--PPVLDGPLRESINSTLGSHVALLCEA-TGVPVPSITWLKDGSPISSLQWQWSVRGNRLELGPLSLSHAGTYTCVAKN-----SEGQTQ-KDYTLTVQSPTILDSDQASDVSAPMGEEVTLDCRV-----NGIPTPRISW--LKDGVTLVE 2136          

HSP 2 Score: 69.3218 bits (168), Expect = 5.883e-11
Identity = 83/313 (26.52%), Postives = 130/313 (41.53%), Query Frame = 1
Query:  586 HILARNSLGTVTSRPFRIIRKVLNPFP--LVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAM--ILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP----NSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLAL--PRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWF-HDGKMLTEKEDSLKFRKNILQIRSLEKK--HLGIYQCWLENE 1485
            H +A N+ G       RI   +  P P  +VH  S  F +G+  ++VC    S   PP + + H N+ +            LP G    IL I    P D+G+YTCTA    T     +     LT   PK  +               +++I ++ G++ TL C     P   V WY      ++   E D   GTL I  VQ  DA  +SC+A+     S     L +  P FS  P  ++  +   + + + C V   +P PT+ W   +G+ +    DS          R+ +K+  HL I + W+++E
Sbjct:  549 HCVASNAHGEN-----RIAVWLFVPAPSVVVHPPSQAFTLGDEIRLVC--SASGSPPPRLLWSHGNMFLTN----------LPFGQNNGILTIGGAVPDDAGNYTCTA----TNDAGTASQSVALTYAVPKITVP--------------QQVILSSVGADATLECKATGIPPPLVRWYKALEVGSAPFVEQDVHRGTLHIRAVQEVDAGQYSCVASSSAGTSSGTVSLVVGSPLFSEEPTDVT--ANVGENITLPC-VARGLPQPTVTWHRQNGRQVLPWTDS--------HSRTTQKENGHLEI-RIWVDDE 814          

HSP 3 Score: 65.855 bits (159), Expect = 5.262e-10
Identity = 63/249 (25.30%), Postives = 109/249 (43.78%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY---YPNS--KRYESDTQFGTLSINNVQLDDASDFSCLANE---VQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQC 1470
            PP I ++ +  P+  +  ++     L  G   LLI +++  DSG YTC A             ++R  +     D++   ++    +  +  + +   +GS +TL C     P   +TW     P S  +    D Q   L + +V   DA  +SC+A+      T+SF L VL  P+  SS   +         +E++C     VP PT+ W  DG+ L E+ D +    N ++I  ++ +  G+Y C
Sbjct: 2216 PPQISWMKNGRPLLLSPRTR-----LLSGDS-LLIAHVQQSDSGVYTCVA-------------RSRAGLAELSYDVQ--VQVPPGVDHVEPVEPVTVVQGSLVTLTCEAHGVPPPTLTWMKDGQPLSLHRNLLLDGQETRLQLPDVAPSDAGLYSCVASNQAGSSTKSFNLTVLP-PKIISSSFPVELTLAVNSPLELECSA-EGVPPPTLSWLKDGRPL-ERSDIVHQDGNFVRISKVQVEDAGLYTC 2440          

HSP 4 Score: 55.8398 bits (133), Expect = 5.823e-7
Identity = 53/222 (23.87%), Postives = 92/222 (41.44%), Query Frame = 1
Query:  748 PPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKS--FQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY-----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQT--RSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKML 1383
            PP I++  D V +    G + +++    G   L I+ + P+D G Y+C  + +   S  F   D+            + P  + SS         ++      +  L C  E   +  V W       P   RY + ++ G+L I+ VQL DA  + C A N+  +  ++  L+V A P  S  P  ++  +  R    + CE    +P+P + W  +G  L
Sbjct: 2490 PPDIQWYKDEVKLQL--GGRVQRL---AGGQYLEIQEMRPEDGGQYSCVVTNMAGSSSLFFTIDI------------VPPVIKESS--------SVVTVRVNQDAVLSCEVEGDSSPSVMWRKDGFPLPKHNRYTAMSE-GSLHIHQVQLSDAGRYYCTASNQAGSDHQAMDLRVFA-PSISPGPFNVTVTAGVRAL--LSCET-TGIPSPKVSWKRNGTPL 2681          

HSP 5 Score: 55.4546 bits (132), Expect = 7.491e-7
Identity = 77/321 (23.99%), Postives = 129/321 (40.19%), Query Frame = 1
Query:  544 LKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSP-PYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY---YPNSKRYESDTQFGTLSINNVQLDDASDFSCLA-NEVQTRSFKLKVLALPRFSSSPLGISFKSYAR-QTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRK--NILQIRSLEKKHLGIYQCWLEN 1482
            L+I R  ++ + +   +A+NS G  T     I  +VL           + IM  V      IP    SP P + +  + + I+  + S++       GA  L+I       SG + C A    T      + KTRL V   + D +P                +  T    +TL C     P+  +TW    +P+S           L I  VQ + A  F+C A N       K  ++  P   S    +   + A+ Q VE +C V +  P P ++W  DG +  + +  ++F +   +L+++S+  +  G+YQC   N
Sbjct: 1142 LRIQRVDVVHQGAYQCVAKNSAGQET---LEIQLEVL---------PGDVIMEKVVNSKVTIPCRAKSPRPKVRWFKNGLEIHPEQ-SEFS--VAKDGA--LVISTASASHSGDFKCVA----TNEAGSVEKKTRLKVNI-QDDGQPLN--------------LTVTLKQPLTLGCDASGIPSPSITWTKDGHPDSPGVYVQNGNRFLRIYRVQPEHAGQFACTAQNSAGEARRKYNIVVEPPVISGTSQLQELTVAQEQEVEFQCRV-SGRPAPRVEWSRDGVLSRDGDPHVEFLEEGQVLKVKSVRLRDQGLYQCLARN 1425          

HSP 6 Score: 52.373 bits (124), Expect = 7.163e-6
Identity = 43/172 (25.00%), Postives = 76/172 (44.19%), Query Frame = 1
Query: 1000 YDNERKEEKIIEATE---GSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF----GTLSINNVQLDDASDFSCLA-NEV--QTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE 1485
            ++ +  EE++ E  E   G +++L C   + P  +++WY    K   +D         L I  V+ +D   ++C A NE       F+L+VL      +S       +    TV + CEV  + P P I W  DG+ +  K+       +  Q++S++   +  Y C  EN+
Sbjct: 1636 HEGDDHEEEMTEKKEVVLGHSVSLSCENNAIPPPKLSWYKDGRKLTSADGLVLHPGQVLQIPRVRKEDTGKYTCKAVNEAGEDHMHFELEVLPPVIMGTSEFMEEMGAVVNSTVVLHCEVTGH-PAPAISWLKDGQPVY-KDSQHHISSDGTQLQSVQVSDMAGYMCVAENK 1805          

HSP 7 Score: 51.9878 bits (123), Expect = 9.609e-6
Identity = 63/273 (23.08%), Postives = 103/273 (37.73%), Query Frame = 1
Query:  679 ESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLS----INNVQLDDASDFSCLA-NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLEN 1482
            E  E ++G+   + C   ++   PP + +  D   + +  G     + L PG  +L I  +  +D+G YTC A            M   L V  P         +    +E  EE  + A   S + L+C     PA  ++W       Y+ D+Q    S    + +VQ+ D + + C+A N+V T      +   P   + P   S          + C+V    P P I W  DG++L            +LQ+     +  G Y C   N
Sbjct: 1647 EKKEVVLGHSVSLSC--ENNAIPPPKLSWYKDGRKLTSADG-----LVLHPG-QVLQIPRVRKEDTGKYTCKA----VNEAGEDHMHFELEVLPP---------VIMGTSEFMEE--MGAVVNSTVVLHCEVTGHPAPAISWLKDGQPVYK-DSQHHISSDGTQLQSVQVSDMAGYMCVAENKVGTVEKLFSLTVQPPTITGPREESVSVIEGHMASLLCDV-QAYPPPEITWTRDGQVLQFSTGVHILPGQMLQLPRARLEDAGQYVCTASN 1894          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Match: cntn3a.1 (contactin-4 [Source:NCBI gene;Acc:101159916])

HSP 1 Score: 80.1073 bits (196), Expect = 2.104e-14
Identity = 74/310 (23.87%), Postives = 127/310 (40.97%), Query Frame = 1
Query:  586 HILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSD-MKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWY----YPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRS---FKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWN 1491
              LA NS GT+ SR   +    L  F            G    ++C  P       +    +D+ P +  + ++   +++      L I  +EP D G+YTC  +   TKS  R       L       + +P+        E +  ++I     S + L C     P  +++W      P  ++ + +  FG L I   Q ++A  + CLA   + R+    KL   A P+    P  +  +     TV  +C+  +  P P+ +W  +G+ L   ED ++    +L IRSL    +G+YQC  EN++ 
Sbjct:  101 QCLASNSFGTIVSREANLHVAYLENFKTQRRSPVRVREGQGVVLLCGPPPHSGELTFRWIFNDD-PSSIVQDTR---LFVSQKTGNLYIAKVEPSDVGNYTCVVTNTVTKSSVRGPPTPLVLRADGVMGEYEPKI-------EVQFPEVIHVANSSTVKLECFALGNPVPKISWRRLDDAPFGRKVKVNEAFGVLEIPYFQQENAGIYECLAENSRGRNSVRGKLTFYASPQLIVKPQDV--QKTIDDTVVWECKA-SGKPKPSYRWLKNGESLDPMEDRIEVNDGVLTIRSLNLVDVGMYQCVAENKYG 396          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 78.9518 bits (193), Expect = 4.632e-14
Identity = 71/272 (26.10%), Postives = 118/272 (43.38%), Query Frame = 1
Query:  817 IYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE-----GSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKDFVELQETESQRENISIIDKR 1584
            I LP GA  L+I N    D+G Y C    +G                 P K  +   +L +  +ERK E +++        GS++ L C     P   + W   +    ES+ +      G+L I ++  DDA  +SC+A   N   T   +L V   P+F   P      +YA ++++I  +C+V +  P PT+KW  +G  +   +     +++ LQ+  L K   G YQC  EN+  N+ +S   +I D      +  +    S++  R
Sbjct:  182 IQLPSGA--LVISNASEADAGLYRCVVENVG-----------------PAKASE-EAQLQTVPDERKLEFLVQPAPVTKVMGSSVLLPCAAAGYPVPHIHWMVGDKPLEESEGRIKVVGGGSLQIADLVEDDAGVYSCVAENSNSTATSQAELTVQVPPKFIKRPA----NTYAHESMDIVFECDV-SGSPAPTVKWVKNGDAVIPSDYFKIIKEHNLQVLGLVKSDEGFYQCLAENDAGNIQSSAQLIILDHASPTPSAPRDVVASLVSTR 428          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 78.9518 bits (193), Expect = 5.300e-14
Identity = 68/254 (26.77%), Postives = 114/254 (44.88%), Query Frame = 1
Query:  817 IYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE-----GSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKDF 1527
            I LP GA  L+I N    D+G Y C    +G  K+ + + ++T                +    +ERK E +++        GS++ L C     P   + W   +    ES+ +      G+L I ++  DDA  +SC+A   N   T   +L V   P+F   P      +YA ++++I  +C+V +  P PT+KW  +G  +   +     +++ LQ+  L K   G YQC  EN+  N+ +S   +I D 
Sbjct:  188 IQLPSGA--LVISNASEADAGLYRCVVENVGPAKASEEAQLQT----------------VPETGDERKLEFLVQPAPVTKVMGSSVLLPCAAAGYPVPHIHWMVGDKPLEESEGRIKVVGGGSLQIADLVEDDAGVYSCVAENSNSTATSQAELTVQVPPKFIKRPA----NTYAHESMDIVFECDV-SGSPAPTVKWVKNGDAVIPSDYFKIIKEHNLQVLGLVKSDEGFYQCLAENDAGNIQSSAQLIILDH 418          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 78.9518 bits (193), Expect = 5.312e-14
Identity = 68/254 (26.77%), Postives = 114/254 (44.88%), Query Frame = 1
Query:  817 IYLPPGAMILLIKNLEPKDSGSYTCTASFLG-TKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATE-----GSNITLYCLYESTPAAEVTWYYPNSKRYESDTQF-----GTLSINNVQLDDASDFSCLA---NEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEI--KCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENE-WNLWASGVTVIKDF 1527
            I LP GA  L+I N    D+G Y C    +G  K+ + + ++T                +    +ERK E +++        GS++ L C     P   + W   +    ES+ +      G+L I ++  DDA  +SC+A   N   T   +L V   P+F   P      +YA ++++I  +C+V +  P PT+KW  +G  +   +     +++ LQ+  L K   G YQC  EN+  N+ +S   +I D 
Sbjct:  188 IQLPSGA--LVISNASEADAGLYRCVVENVGPAKASEEAQLQT----------------VPETGDERKLEFLVQPAPVTKVMGSSVLLPCAAAGYPVPHIHWMVGDKPLEESEGRIKVVGGGSLQIADLVEDDAGVYSCVAENSNSTATSQAELTVQVPPKFIKRPA----NTYAHESMDIVFECDV-SGSPAPTVKWVKNGDAVIPSDYFKIIKEHNLQVLGLVKSDEGFYQCLAENDAGNIQSSAQLIILDH 418          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 2300.78 bits (5961), Expect = 0.000e+0
Identity = 1162/1168 (99.49%), Postives = 1167/1168 (99.91%), Query Frame = 1
Query:  214 MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYXXXXXXXXXXXLKPNESSQPTFLFHYXXXXXXXXXCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFXXXXXXXXXXXCNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSISYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMHSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLVRM 3717
            MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTK+VSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEP+DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIV+VIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYS SYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSM+SLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLVR+
Sbjct:    1 MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTKDVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSNSYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMNSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLVRI 1168          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 2296.55 bits (5950), Expect = 0.000e+0
Identity = 1161/1168 (99.40%), Postives = 1165/1168 (99.74%), Query Frame = 1
Query:  214 MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYXXXXXXXXXXXLKPNESSQPTFLFHYXXXXXXXXXCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFXXXXXXXXXXXCNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSISYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMHSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLVRM 3717
            MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTK+VSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEP+DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIV+VIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYS SYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSM+SLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQL  M
Sbjct:    1 MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTKDVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSNSYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMNSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLKSM 1168          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Match: SMESG000063656.1 (SMESG000063656.1)

HSP 1 Score: 2274.97 bits (5894), Expect = 0.000e+0
Identity = 1150/1157 (99.39%), Postives = 1154/1157 (99.74%), Query Frame = 1
Query:  247 MNIALLVRLNQEIPQFLQLPDPEIYEDENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVSVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYXXXXXXXXXXXLKPNESSQPTFLFHYXXXXXXXXXCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFXXXXXXXXXXXCNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSISYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMHSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLVRM 3717
            MNIALLVRLNQEIPQFLQLPDPEIYEDENTK+VSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEP+DSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIV+VIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYS SYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSM+SLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQL  M
Sbjct:    1 MNIALLVRLNQEIPQFLQLPDPEIYEDENTKDVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPPGAMILLIKNLEPRDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYPNSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWNVLPDNKIVNVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILYVSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEMSSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHLKPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPNQTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSICNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNNFQNMTIPRQSVVPIVFPEPPSEPQPDKYSNSYQRTLCPTDIRNQLIVDSLDENSASVPFLDKSSSWHNNSMNSLMKTNFVELPNDKIPADNPWAMDTYYDPYSSNSSVGNETNQLKSM 1157          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Match: SMESG000022938.1 (SMESG000022938.1)

HSP 1 Score: 271.552 bits (693), Expect = 4.656e-74
Identity = 235/770 (30.52%), Postives = 372/770 (48.31%), Query Frame = 1
Query:  697 MGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKIYLPP--GAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKI-IEATEGSNITLYCLYESTPAAEVTWYYPNSK-RYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISF-KSYARQTVEIKCEV-LNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLE--NEWNLWASGVTVIKDFVELQETESQRENISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGNKYVMFKKKSE---GTVILSIVNPTKNLDEGIYICQL-YDQNAE-LLHTVKYQLTIDDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWN----VLPDNKIVSVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCPTTNQITIVDQHILRPNSAIRFRVILF--LKVLSPILSSNNLNQTVFDSLRSTWSNVIEFNNILNCKLSISNKAV-TPASVEVMWTHNCVRESDWHP---ITFDILY------------VSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANITDLRSKCEYVIAVYG--KVITTMQDIFYIPLSN--IIKVSTSEDK----DENRISLEMS-SDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWY 2874
            MGNV QI+C +P SKPSPP IEF H++  IN +  S+YK +  PP    + LLI+NL  +DSG Y C  S   TK  Q S   T L V  P  ++  +F  SS+ N    + I I+  EG+ + +YC++ES P  EV+WY+P S  +YE + QFGTL+I+N  L D SD SC+ NE   + F++ V    R  ++P  +   KS   + + I C +  N   N  I W H+G ++   +   + +   L I+ L  K+ GIYQCW E  NEW   +  V +      ++E  S R  I  ID    P   + L C +  +   +  N T +W R     E+   + +    F KK +      IL++ NP    +   ++C++ Y +N + LL  ++++L      FN+ N+           +   F   +S+P  VR   +   V + WN    ++ D     +I+H+++E++ + V K++ T         EW    +ID   T     I +  ILRP     FR +     +++        L++  F  +RS WS+ + F+N +  +  ISN  +    S  V W ++    SD H    I F +LY             S+ + +   +  PD +  +     I    K L     ER ++      IT+L++  +Y++A+Y   + +T M  + Y  LS+  II  S +  K    D N  S   + S+S+  RN+++FL+LGSLAG+LFV+A  MF MC WY
Sbjct:    1 MGNVAQILCRLPISKPSPPKIEFFHNSSVINISNSSRYKIVEFPPFYQTVALLIRNLMEEDSGKYKCRVSLPNTKLQQESIKTTTLIVKKPFANVPIKFLTSSHSNADDSKIIDIKIPEGTLLVIYCIFESAPVEEVSWYWPKSDMKYELNQQFGTLTIHNASLQDNSDISCMNNE--NKIFRIHVYQKLRLIANPARVELKKSNFNKLLTIMCNLNQNEDENYMINWLHNG-VIIYNDKQYEIKNYSLTIKKLTTKNQGIYQCWTEIKNEW--LSDEVYIYFPKKNVKEIHSMR--ILYID----PDRPVDLRCEVPINY--NVYNATSRWFRKFTGKEITNFSSD----FTKKYDYESNIFILTVKNPLSLKNNQSFVCKIFYKENKKFLLRKLEFRLL-----FNKVNRQNQSPDPRETVKDSLFSFILSKPTVVRPISFLLAVNVSWNMQTSIITDKNQSKIINHYQIEYR-QGVLKLKPTEGKLLDPLIEWGNSTIIDKSFTKTSCIIYNSQILRPKYLYSFRAVGIPNFEIVKFHEKKKFLSKNFFQEIRSPWSDPVNFDNFMQSRPKISNITILNSESAVVSWIYSS-EMSDNHAKSNIEFKVLYREFMLKYSIKGFGSINEQVTDLRIDPDFYYNDLTDNKIVTATK-LSSFHDERVELI-----ITNLKANTQYLVAIYAILRPLTGMS-MMYTALSDARIIDTSLAGKKAILTDSNNNSKNQTVSNSNYFRNKILFLVLGSLAGILFVIALFMFIMCLWY 739          
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 121.324 bits (303), Expect = 4.728e-27
Identity = 111/443 (25.06%), Postives = 194/443 (43.79%), Query Frame = 1
Query:  226 LVLYTIWMNI-----ALLVRLNQEIPQFLQLPDPEIYEDENTKEVSIQVIVSPVNTSIMLAYFSIGSGGYSDEMKLLNXXXXXXXXXXDDVGIIVESRQMMDYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPFPLVHHESA-EFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYKKI-YLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTPKKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYY---PNSK--RYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFSSSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFRKNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVI 1518
             +  T+W+++      L+  +++E+P F +LP P  Y       + ++  V P N  I     S          K     + S  IS + +           YLK      +   + S I  + +H LA    G + SRPFR+    ++ F      +  EF++GN+  + C+ P S P    ++F+ ++  I   +G KY+ + +     M LLIKN+   DSG Y C A    T    +S    +L + +P++ I P   +            I A  GSN+TL+C+   +P + +  Y    P+S+  R++ D  FG L I NVQ  D   + C  N + + +   KV+     + +PL I   S+        C+  +N PN +  W  +G+ +T       +  + +QI  +  + LG+YQC ++ + + W S    +
Sbjct:    9 FIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSS---------KKQWQGEATSRSISINPLDKSFGQPIAPGYLK------ISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKAD-VKFIFNDQEIK--EGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVM-PISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAV-FKVIEPLSITETPLDIVMDSFTGHAT-FSCK--SNKPNSSPTWLFNGRPIT-----ANYNSSTIQITEVSLRTLGLYQCIIQ-DLDEWVSAAATL 422          
The following BLAST results are available for this feature:
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN22.452e-1324.86hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
HMCN12.049e-1227.38hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
NEO12.340e-1226.18neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754][more]
NEO13.720e-1226.18neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754][more]
NEO13.759e-1226.18neogenin 1 [Source:HGNC Symbol;Acc:HGNC:7754][more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
him-42.924e-1223.50High Incidence of Males (Increased X chromosome lo... [more]
him-43.100e-1223.50High Incidence of Males (Increased X chromosome lo... [more]
him-43.205e-1223.50High Incidence of Males (Increased X chromosome lo... [more]
unc-891.576e-1125.56Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.763e-1125.56Muscle M-line assembly protein unc-89 [Source:Uni... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dscam11.243e-1426.25gene:FBgn0033159 transcript:FBtr0111078[more]
Dscam11.308e-1426.93gene:FBgn0033159 transcript:FBtr0306785[more]
Dscam14.005e-1426.73gene:FBgn0033159 transcript:FBtr0306770[more]
Dscam14.275e-1426.73gene:FBgn0033159 transcript:FBtr0111092[more]
Dscam14.543e-1425.94gene:FBgn0033159 transcript:FBtr0111082[more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neo1b2.347e-1626.56neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
igdcc32.156e-1426.98immunoglobulin superfamily, DCC subclass, member 3... [more]
hmcn11.399e-1324.90hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn11.410e-1324.90hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
neo1a8.533e-1325.54neogenin 1a [Source:ZFIN;Acc:ZDB-GENE-021031-1][more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCC1.942e-1326.64DCC netrin 1 receptor [Source:NCBI gene;Acc:100486... [more]
DCC3.046e-1326.32DCC netrin 1 receptor [Source:NCBI gene;Acc:100486... [more]
DCC3.074e-1326.32DCC netrin 1 receptor [Source:NCBI gene;Acc:100486... [more]
DCC3.144e-1326.32DCC netrin 1 receptor [Source:NCBI gene;Acc:100486... [more]
DCC3.217e-1326.32DCC netrin 1 receptor [Source:NCBI gene;Acc:100486... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Igdcc41.265e-1226.11immunoglobulin superfamily, DCC subclass, member 4... [more]
Igdcc41.309e-1226.11immunoglobulin superfamily, DCC subclass, member 4... [more]
Chl13.684e-1224.00cell adhesion molecule L1-like [Source:MGI Symbol;... [more]
Chl13.684e-1224.00cell adhesion molecule L1-like [Source:MGI Symbol;... [more]
Igdcc35.438e-1225.74immunoglobulin superfamily, DCC subclass, member 3... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQS9|IGDC4_MOUSE8.848e-1226.11Immunoglobulin superfamily DCC subclass member 4 O... [more]
sp|Q2VWP9|PRTG_RAT9.548e-1224.51Protogenin OS=Rattus norvegicus OX=10116 GN=Prtg P... [more]
sp|Q96RW7|HMCN1_HUMAN9.841e-1227.38Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|Q92859|NEO1_HUMAN1.805e-1126.18Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2[more]
sp|P70232|NCHL1_MOUSE2.577e-1124.00Neural cell adhesion molecule L1-like protein OS=M... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419PC545.734e-4124.34Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4Z2DKQ61.094e-3824.91Immunoglobulin domain-containing-like protein isof... [more]
A0A5K4EQR88.318e-3821.78Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A3Q0KNN11.336e-3721.78Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A504YZV42.713e-3722.22Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neo1a6.091e-1526.40neogenin-like [Source:NCBI gene;Acc:103031419][more]
neo1a2.418e-1426.83neogenin-like [Source:NCBI gene;Acc:103031419][more]
neo1a2.446e-1427.13neogenin-like [Source:NCBI gene;Acc:103031419][more]
neo1a2.506e-1427.13neogenin-like [Source:NCBI gene;Acc:103031419][more]
neo1a2.930e-1427.13neogenin-like [Source:NCBI gene;Acc:103031419][more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igdcc31.561e-1427.80immunoglobulin superfamily, DCC subclass, member 3... [more]
neo1b4.260e-1327.15neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
pxdn1.761e-1128.70peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
ENSPMAT00000001736.12.154e-1124.82pep scaffold:Pmarinus_7.0:GL477265:10898:44695:-1 ... [more]
ENSPMAT00000005303.18.539e-927.12pep scaffold:Pmarinus_7.0:GL476820:290278:328887:1... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO262942.453e-1026.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495566.644e-1021.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495502.416e-923.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287962.494e-922.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415001.283e-821.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn21.106e-1525.79hemicentin-1 [Source:NCBI gene;Acc:101165068][more]
cntn3a.12.104e-1423.87contactin-4 [Source:NCBI gene;Acc:101159916][more]
neo1b4.632e-1426.10neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b5.300e-1426.77neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b5.312e-1426.77neogenin 1 [Source:NCBI gene;Acc:101164964][more]
back to top
BLAST of Cell adhesion molecule-related/down-regulated by oncogenes isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063656.10.000e+099.49SMESG000063656.1[more]
SMESG000063656.10.000e+099.40SMESG000063656.1[more]
SMESG000063656.10.000e+099.39SMESG000063656.1[more]
SMESG000022938.14.656e-7430.52SMESG000022938.1[more]
SMESG000048961.14.728e-2725.06SMESG000048961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014599 ID=SMED30014599|Name=Cell adhesion molecule-related/down-regulated by oncogenes isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5849bp
ATAGGTTTGGTGCTCAACCTTTAAAGTACATCCAATGAATATTCGATAAG
TTTGTTCTTACAATGGAAAATTATCTTTTTTTTCTAAATCGAATATTATA
AGCAAAAAATGTCAATGGAGAATTTGTTTTTAATTGTTTTTCGACGAGTA
TTTGAAAGAAACTGAAATTTTCAAGTAGAATTTTTTCCCATTCATTACTA
ATATAGCTGGAAAATGAAAGACCTTTTAGTTCTGTACACAATTTGGATGA
ATATTGCTTTGCTTGTCAGATTGAATCAAGAAATACCCCAATTTCTCCAG
TTGCCTGATCCGGAGATTTATGAAGACGAAAACACGAAAGAGGTCAGCAT
TCAAGTGATTGTCTCGCCAGTCAACACGTCAATTATGCTCGCGTATTTTT
CAATTGGATCTGGAGGATATTCTGACGAGATGAAATTGCTGAATTTTAGT
AGCCCGTCCTCATTCATTTCGTCGGATGATGTCGGAATTATTGTCGAATC
GAGACAGATGATGGATTATTTGAAAAACGAGGAATTTTGGAAATTAAAAA
TTGTTCGATGTTCCTTGATATTTGAAAAATCGTTGCATATTTTGGCGAGA
AATTCCCTTGGAACGGTCACGAGCAGACCGTTTAGAATTATTAGAAAAGT
TTTAAATCCATTCCCTCTGGTGCATCACGAATCCGCAGAATTCATCATGG
GAAATGTTGGGCAAATTGTCTGTATGATCCCTCACTCGAAACCGTCACCC
CCGTATATTGAATTTCTACATGATAATGTTCCAATTAATACCACTAAAGG
TAGTAAATATAAGAAAATATATTTACCGCCAGGAGCAATGATCTTGTTGA
TAAAGAATCTTGAACCGAAGGATTCGGGGTCTTACACTTGCACTGCGTCT
TTTCTTGGAACTAAGAGCTTCCAAAGATCTGACATGAAAACAAGATTAAC
AGTTACAACACCTAAAAAAGATATCAAGCCTAGATTTCGATTATCATCGT
ATGACAATGAGAGGAAAGAAGAAAAGATCATAGAAGCAACTGAGGGTTCA
AATATTACCCTATATTGTCTTTATGAATCCACTCCGGCAGCAGAGGTGAC
CTGGTATTATCCAAATAGCAAGAGATATGAATCTGACACTCAATTTGGAA
CTCTATCAATCAACAATGTTCAGTTGGATGATGCGTCCGACTTTTCCTGC
CTGGCTAATGAGGTCCAGACTCGGTCTTTCAAGTTAAAGGTTTTAGCACT
TCCTCGGTTTTCATCTAGTCCATTGGGAATATCTTTTAAATCGTACGCCA
GACAAACAGTGGAAATCAAATGTGAAGTCCTAAACAATGTACCAAACCCT
ACTATAAAATGGTTTCATGATGGGAAAATGCTAACAGAAAAAGAGGATTC
ACTAAAATTCAGGAAAAATATTCTTCAAATAAGATCGCTGGAGAAAAAGC
ATCTTGGAATATATCAATGTTGGCTGGAGAACGAATGGAATTTATGGGCT
TCGGGAGTGACAGTTATAAAAGATTTTGTTGAACTCCAGGAGACAGAATC
TCAGAGGGAAAATATATCAATAATAGATAAAAGAACTGCTCCTGGTCTCA
CCATTCATTTGGAATGTAGCTTACTCCAATCTCAGAAGGATTCAAAAACG
AATTTCACTGTCAAATGGCTTAGGCTCAAAGATTCCCTAGAGCTTATTGA
ATTGACCGGCAACAAATACGTCATGTTCAAGAAGAAATCAGAAGGAACAG
TCATTCTCAGCATTGTTAATCCAACTAAGAATCTAGATGAAGGAATCTAT
ATATGCCAACTGTATGACCAGAACGCCGAACTGCTGCACACTGTGAAATA
CCAGCTGACAATAGATGATCAGAAGTTCAATGAGCCAAATCAACTTCAAT
TAAAATCGACGGATATTCCAGCAAAGAGAACTGAGCATTTTGAACCGTCA
GTGTCTCGACCCGAAGCTGTGAGAATAAACGAATACGCATTCGGTGTCAC
CATCAAATGGAATGTGCTTCCTGACAATAAAATCGTCAGTGTCATCGATC
ATTTTCGGCTAGAATTTCAAAACAAAACCGTTGACAAGATCCAACAAACA
AATTTAATGGAAGAAAGAAAACCTGATGAATGGTCAGAGATATTCATGAT
TGATGACTGCCCGACCACAAACCAGATTACGATCGTGGATCAACACATTC
TGAGACCAAATAGCGCGATTCGGTTCAGAGTTATCCTTTTCTTAAAAGTG
CTTTCACCAATTCTTTCATCAAATAATCTCAACCAAACTGTTTTTGATTC
TCTCAGGAGCACTTGGTCAAATGTCATCGAGTTTAACAATATCCTGAATT
GTAAATTATCCATATCTAACAAAGCAGTGACTCCTGCATCAGTGGAAGTG
ATGTGGACACATAATTGTGTTCGGGAATCAGATTGGCATCCGATAACGTT
CGACATTCTCTATGTGTCAATGAAGGATTGTTTGATATCAAAGAAATGTC
AACCTGACAAGCATCTAAAGAATTTTGAGTCAATATTGATATTTCCTGAA
TTCAAAGATCTCATTCAAATCAAAACCGAAAGAAGTGACGTGGATTTCTT
CAAAGCAAATATCACTGATTTGCGATCAAAATGTGAATATGTCATTGCGG
TTTATGGAAAAGTGATCACGACCATGCAAGACATTTTTTATATTCCTCTT
AGTAATATTATCAAAGTTTCGACTTCAGAAGATAAAGACGAAAACAGAAT
TTCTTTGGAAATGAGTTCAGATAGCGATGATGCGAGAAATCGAGTCATCT
TCCTTATTCTTGGTTCTTTAGCTGGAGTTTTGTTTGTTGTAGCTGCCGTC
ATGTTTGGCATGTGCACTTGGTATTATATGAAAAAGCACATGAAAATTCA
TAAAATTCATTTGAAACCAAACGAATCATCACAACCTACTTTTCTTTTCC
ATTATCCTCCTTCGTCATTATCATCACCACTGTGCTACGGAGCCAGGATC
AATCCACTTTCACCATATCAGCAAGCATTGACAACAAATAGTAACTTGAT
TTACTATCCTAATCAAACTGTTGGGAAATCTCCAATGATTTCTTGCAGTG
GAAATAATCAGAACGACCTGTGGCCTCTTAACTATTACAGCCCTTCTCCT
AATACAATGGCAGTAATGCCAGATAAATTTTCTTCGGATCGAGATTCGGA
CATAGATTCGATCTGCAACTCGGAGAAAAATATGAATAACAATACCCGAC
GACCGATTGTTATGGGGGTTGATCAAGCATCATCGACCTACTCTAGAATC
GGATCAGAAAGACGATTTTCTATTGGTGCATTAAATATTATGTCAAATGA
CTATCCAAATAACTTTCAAAATATGACAATTCCACGACAAAGCGTAGTGC
CGATCGTGTTTCCAGAACCACCCAGTGAACCTCAACCAGATAAATATTCA
ATTTCCTATCAGAGAACTCTCTGTCCTACCGATATCAGAAATCAACTTAT
AGTAGACAGTCTTGATGAAAATAGCGCTTCCGTTCCTTTTTTAGATAAAA
GTTCCAGTTGGCACAATAATTCAATGCACTCGTTAATGAAGACCAATTTT
GTTGAATTGCCCAACGACAAAATACCGGCTGACAACCCTTGGGCTATGGA
CACCTATTACGACCCGTACTCATCAAATTCGTCGGTTGGGAATGAAACCA
ACCAACTAGTGAGAATGAGAATAATATATGAACATGAAATAAATTTTATC
AACTGCTTTTTCATTTCATGGCGAGTCTAACATGTGACGAGAATTTATCC
GTTGGATTTTTGACATGAAACCCCATGGTCAAGATCATTTGAATCATATG
GATTGACTAGGAGGTCCCAGCCTGACAGCGCTCGAAATTTCGAAAATAAA
AACATTTGACCCAAGAAATAATGAGACATTGAAGTGAGCCAGCTGGTAGT
GGTGATCCGTGTTCGCACAATCGTTATTAGTGAAGATTTCCCTTGAAGAC
TTACTTGTGAAACATTCAAAGTTTTGCGACAAAATGAATTCTTAAAAGAA
CATTTTCAATAATAAATTTATTTTAAACATATAATTTCCATCCACGTTAC
TATTTTATTTTTCTACATTTTAACACATTCATACCAATAACGTATGTATC
TGAGTTTTGTTTATGTTAACTGCCCATAGATAAATAAAGTATTGCTTTTG
GCTAAATTTGACCCCCTTTACTTTTATTGACACATTTTCATGCTTTAAGG
TTTCATAAGATTTTCCATTAAAGTTTCTCTTATAGAATTCTCATCTTTCA
CATTTCAAGAAATATTATAAAAAATTCCCATAAAGTTGAGTCACCTACAT
TAACAGCAATATCCAAAAGTAGAAATAAAAGCGTGAAAATTGTTATAATT
TAAGAAAATTGTAAATTGATAATGTAACGGAGAAAGAAAATAATAAAGAT
GAGTTGTAATTCGAAACGGAAAACTATTGGTAGATAATAGAGCCGCGGTT
CTGAAACTTTTTCCCTGTGGACCGGATATTTTGATATTTCCCCGTCGTGA
CCCATTAAAGATTTATGGAATATCAGTAAAATAACAGATTTGAATGGATG
TTTTCATTATTGTTATTATAATAAAGAGGCATTTATTCGATGTTATTTAT
TCTGTTTTTTGCGTTATAAGCCAATGGCTTAGAAATATTTTTCATCTGAA
AAAAGGCTTAGTAAAGAGTAGTGATTTATTTAAAGGTAGAGGCTTAATAA
ATACTCAAATAAAATGCATTCTCTGAAAAGTGGCTTATAATGTGATAACA
GGGTAGCCTTAATCATAGAATATAAGAATGACACTTTCTCTCATATCTAA
CTGAATTGCTAATTAAATAATTTCTTTTAATAGCCCAGATTAAACGTTAT
TTACTTGTATTTTAGAGTTTCGTGAAAAAACGAAACACCTAAGTTTTTGA
GAGATTGTTTTAAGACCCGGTATTTCACCCTTAAAAAATCCAATTAGTGA
ATGCATATGAAATCAAACTCAAAATGTCGTTGAATACTCTATGTACATCA
GTGGATTGATAAGTTTTCTAAAGAGGATTTTGATAGAACAAAATATTATC
AAAATATACTGTCATATAAAATGCACATTCAATAACACAGTATATGAAAG
TAAAAAATTGAAATATGCAAAAATGTTCTAGTGCAGTAATGAAACAACAT
CATGTTTTCTGATGGCCGTTTTCTGCAGTCCTAAAAGGTAATTTTCTTGC
ACATAATTAATGTAGAGTATAATAATTTAAATACTATAAAACTTGATGAA
ATCAATGTTACATTTGAAATCTTTTACTGGAAAATTTATCCTATCTCAAA
TTTATATCTGCTCTCCAAATGAATTAGCGAAGAGATTCTTTAAAAATAAA
GAAATCCATGATTCATGCCTGTCCATGACAAACTTCATGATTTCTTTTTT
TCTCCCACATTCACGTGCTAATGCTCTTCCACAATAATATACTGTCCACT
TCGATCAAACTGTCATTTTTTTATAATTTATCAGACATTAATTGCAATTT
ACTTTCAACAGGGTGGTTACGTATGTATTTGTATTTTTTATTGTGATTCG
TAAATCTGCTTTCAAAAGAAATGCAAAAAAGTACAAGTTTTGTGTCAAAA
TTCAGATTTTTCTTCCTCTTTTTGATGTTATGAAATAGTTTTAAAAATTA
TGCTTTTGTGACATTTTATTCATGTGATGTTTTCAGTGTCAACTTCTTAG
AGTGATATATAAATTGGTTTTTAAATTTTTGATCTAATATCGAAAATGTC
TCAAATGATTTTTGCCTAGTTATTGTGCAATTATCTTCTTAGCTTCCAT
back to top

protein sequence of SMED30014599-orf-1

>SMED30014599-orf-1 ID=SMED30014599-orf-1|Name=SMED30014599-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1189bp
MKDLLVLYTIWMNIALLVRLNQEIPQFLQLPDPEIYEDENTKEVSIQVIV
SPVNTSIMLAYFSIGSGGYSDEMKLLNFSSPSSFISSDDVGIIVESRQMM
DYLKNEEFWKLKIVRCSLIFEKSLHILARNSLGTVTSRPFRIIRKVLNPF
PLVHHESAEFIMGNVGQIVCMIPHSKPSPPYIEFLHDNVPINTTKGSKYK
KIYLPPGAMILLIKNLEPKDSGSYTCTASFLGTKSFQRSDMKTRLTVTTP
KKDIKPRFRLSSYDNERKEEKIIEATEGSNITLYCLYESTPAAEVTWYYP
NSKRYESDTQFGTLSINNVQLDDASDFSCLANEVQTRSFKLKVLALPRFS
SSPLGISFKSYARQTVEIKCEVLNNVPNPTIKWFHDGKMLTEKEDSLKFR
KNILQIRSLEKKHLGIYQCWLENEWNLWASGVTVIKDFVELQETESQREN
ISIIDKRTAPGLTIHLECSLLQSQKDSKTNFTVKWLRLKDSLELIELTGN
KYVMFKKKSEGTVILSIVNPTKNLDEGIYICQLYDQNAELLHTVKYQLTI
DDQKFNEPNQLQLKSTDIPAKRTEHFEPSVSRPEAVRINEYAFGVTIKWN
VLPDNKIVSVIDHFRLEFQNKTVDKIQQTNLMEERKPDEWSEIFMIDDCP
TTNQITIVDQHILRPNSAIRFRVILFLKVLSPILSSNNLNQTVFDSLRST
WSNVIEFNNILNCKLSISNKAVTPASVEVMWTHNCVRESDWHPITFDILY
VSMKDCLISKKCQPDKHLKNFESILIFPEFKDLIQIKTERSDVDFFKANI
TDLRSKCEYVIAVYGKVITTMQDIFYIPLSNIIKVSTSEDKDENRISLEM
SSDSDDARNRVIFLILGSLAGVLFVVAAVMFGMCTWYYMKKHMKIHKIHL
KPNESSQPTFLFHYPPSSLSSPLCYGARINPLSPYQQALTTNSNLIYYPN
QTVGKSPMISCSGNNQNDLWPLNYYSPSPNTMAVMPDKFSSDRDSDIDSI
CNSEKNMNNNTRRPIVMGVDQASSTYSRIGSERRFSIGALNIMSNDYPNN
FQNMTIPRQSVVPIVFPEPPSEPQPDKYSISYQRTLCPTDIRNQLIVDSL
DENSASVPFLDKSSSWHNNSMHSLMKTNFVELPNDKIPADNPWAMDTYYD
PYSSNSSVGNETNQLVRMRIIYEHEINFINCFFISWRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0045663positive regulation of myoblast differentiation
GO:0045664regulation of neuron differentiation
GO:0048598embryonic morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
IPR003114Phox_assoc
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 270..344
e-value: 4.3E-9
score: 46.2
coord: 453..545
e-value: 24.0
score: 8.2
coord: 155..248
e-value: 3.2E-4
score: 30.0
coord: 353..437
e-value: 0.13
score: 21.3
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 364..426
e-value: 4.0E-6
score: 36.4
coord: 276..336
e-value: 0.0016
score: 27.7
coord: 161..233
e-value: 4.9
score: 0.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 125..242
e-value: 3.8E-8
score: 35.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 441..558
e-value: 2.8E-7
score: 32.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 257..345
e-value: 6.0E-11
score: 44.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 346..437
e-value: 8.8E-12
score: 46.9
NoneNo IPR availablePFAMPF13927Ig_3coord: 348..423
e-value: 1.9E-8
score: 34.8
coord: 273..331
e-value: 3.8E-9
score: 37.0
NoneNo IPR availablePANTHERPTHR12231:SF227NEUROGLIANcoord: 126..435
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 126..435
NoneNo IPR availableCDDcd00096Igcoord: 281..338
e-value: 1.57238E-6
score: 44.9256
NoneNo IPR availableCDDcd00096Igcoord: 179..229
e-value: 6.2967E-5
score: 40.3033
NoneNo IPR availableCDDcd00096Igcoord: 366..424
e-value: 1.13702E-7
score: 48.0072
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.45
NoneNo IPR availableTMHMMTMhelixcoord: 866..888
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 149..248
score: 8.575
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 449..549
score: 7.577
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 347..419
score: 10.88
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 256..340
score: 11.842
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 272..349
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 458..549
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 149..249
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 338..434