DNA-directed RNA polymerase subunit beta

Overview
NameDNA-directed RNA polymerase subunit beta
Smed IDSMED30014584
Length (bp)4577
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase subunit beta (SMED30014584) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit beta (SMED30014584) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase subunit beta (SMED30014584) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit beta (SMED30014584) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014584

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30014584SMESG000028508.1 SMESG000000385.1 SmedASXL_018625SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000000385.1 Contig34259newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000028508.1 Contig21172uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000028508.1 Contig21172newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000028508.1 Contig14574uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000028508.1 Contig14574newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014584SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30014584SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014584SMESG000054821.1 SMESG000054819.1 SMESG000028508.1 Contig15693newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A151IM57 (Uncharacterized protein (Fragment) OS=Cyphomyrmex costatus OX=456900 GN=ALC62_03109 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.930e-77
Identity = 50/104 (48.08%), Postives = 74/104 (71.15%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAIK 3086
            +M++SQF L P E+ GLRD+C F V L++K WF      TAP++DL FL++LI +E ++   ++AA  K   HLWY++EELVGLA FD  +S+ TK ++V+A+K
Sbjct:  299 YMYKSQFQLTPQELSGLRDVCIFIVQLFVKAWF------TAPNHDLQFLKSLIRFENINKKAAQAAVKKFTGHLWYLNEELVGLAFFDSTVSSDTKEKMVAALK 396          

HSP 2 Score: 93.9745 bits (232), Expect = 5.930e-77
Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 2
Query: 2582 GSRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
             S++ ++ F   QL+  QPR+DYREFLEL IIFLG +P+RGI F A GA+H ARWMSK LYSLK+Y+
Sbjct:  234 NSKDDIIAFCIDQLKKTQPREDYREFLELVIIFLGGIPSRGILFRAPGAVHDARWMSKALYSLKIYM 300          

HSP 3 Score: 88.9669 bits (219), Expect = 5.930e-77
Identity = 48/112 (42.86%), Postives = 73/112 (65.18%), Query Frame = 2
Query: 1937 RTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGKET-IDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            R  +SDRK  ++++  AK+LG  + D++++RSTI+RQR+  R   S  +++ F+   D  LVVHWDGK+L + +G    +D+L I VSG    KLL    L+ STG+AQA+A
Sbjct:   17 RCNISDRKGAFIISACAKALGCTLDDISISRSTIKRQREKARTESSVLIKQNFKP--DEWLVVHWDGKILPETSGTSIHVDKLAITVSGANSDKLLGIISLERSTGEAQADA 126          

HSP 4 Score: 80.1073 bits (196), Expect = 5.930e-77
Identity = 40/98 (40.82%), Postives = 61/98 (62.24%), Query Frame = 3
Query: 2310 ESHVI*HEFQHRSAN-----GACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMG-PSSAPEVLMFKRFQSCWQFIDQASYSTGMDAKDVAAVLMD 2585
            ES +I   F   +AN     GACVL+E  L  +LL LACRHH++ELV+ ++F+  +  P + P V ++KRFQ  W  ID  ++ TG+   ++A+VL +
Sbjct:  137 ESRIIAMSFDTTAANTGPYNGACVLIESQLKSDLLYLACRHHMYELVLRSIFEASIKTPVNGPNVGLYKRFQQSWSNIDTMAFETGISEINIASVLSN 234          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: J9M593 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 5.073e-75
Identity = 49/111 (44.14%), Postives = 71/111 (63.96%), Query Frame = 2
Query: 1937 RTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            R K+SDR AV+++  TA+S G ++ +L +NR+++   RQ  R+     LR  F      P VVHWDGK+L  L+ K+ +DRLPI++S KGI +LL   +L S TG+ QA A
Sbjct:  216 RCKISDRDAVHILLATAESFGININELIINRTSVNSIRQRFRKNRIEALRVNFNPSQIGPCVVHWDGKLLPSLSEKKLVDRLPIIISYKGIEQLLGVPELISGTGENQATA 326          

HSP 2 Score: 89.3521 bits (220), Expect = 5.073e-75
Identity = 36/65 (55.38%), Postives = 50/65 (76.92%), Query Frame = 2
Query: 2588 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
            +++LL F  +QL+  QPRDDY+E LEL+IIFLG+ P  GI F   G +HHARWMSK +YS+K+++
Sbjct:  435 KDELLIFCINQLKQYQPRDDYKELLELTIIFLGQTPPNGIFFKVPGPIHHARWMSKAIYSIKIFL 499          

HSP 3 Score: 87.4261 bits (215), Expect = 5.073e-75
Identity = 49/107 (45.79%), Postives = 69/107 (64.49%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAIKVID 3095
            F+FR++F L   E   LRD+C F V +Y+K WF A  AA AP+ DL F++ +I YEV+   ISK+A  KM  HLWY++ E   LA FD  +S+ TK ++V A++  D
Sbjct:  498 FLFRNEFKLTLKENNALRDLCIFIVRIYIKQWFCARAAALAPNMDLQFIKDIILYEVIDEQISKSALKKMCGHLWYLTPEATSLAFFDDKVSSQTKIKMVKAMQSRD 604          

HSP 4 Score: 73.1738 bits (178), Expect = 5.073e-75
Identity = 31/67 (46.27%), Postives = 46/67 (68.66%), Query Frame = 3
Query: 2355 GACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMD 2555
            GAC+LLEQ L   +L L CRHHI E+V+ + F+  +  +SAP+V +FKRFQ CW  I+  ++  G++
Sbjct:  357 GACILLEQKLEREILYLPCRHHILEVVLRSAFEIKIDIASAPDVPIFKRFQKCWPNINVNNFHIGLE 423          

HSP 5 Score: 30.0314 bits (66), Expect = 5.073e-75
Identity = 13/24 (54.17%), Postives = 17/24 (70.83%), Query Frame = 1
Query: 2278 ALNEWGIADRVRAMSFDTS-SNTG 2346
            AL  WG+ D V+A+  DT+ SNTG
Sbjct:  330 ALENWGLTDNVQALCCDTTASNTG 353          

HSP 6 Score: 93.2041 bits (230), Expect = 1.079e-18
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query: 1234 STRSKTKVYLLESYTEVLTGGKLPSLRQVLGLLLHEHKENGKTIREASTIAIESTAKFWQKGRIPTRAVQHCQAKVESEFVVWRLRLLKKNASRKAETQKAKKAAFCSRLDDLFDIAHADALKNIKIEEDR 1626
            + R   K++L+   +  + G KLPS++QVL +L    ++    +R+++ + I     FW+K RIP R   H   KVES +  W  R L+K+++RK+   +  +  F ++L+D+FDIAHA AL  +KIE D+
Sbjct:    8 NLRDSNKIFLVGHISNQIIGSKLPSIKQVLSVLFFNMRKVNLNLRDSAKLVIREVIIFWEKARIPVREEYHLLKKVESLYNEW--RNLQKHSTRKSAKDRKNEEIFVNKLNDIFDIAHARALDIMKIECDK 136          

HSP 7 Score: 32.3426 bits (72), Expect = 1.079e-18
Identity = 12/19 (63.16%), Postives = 16/19 (84.21%), Query Frame = 2
Query: 1625 EFLLAQREKGRRGSMLGLD 1681
            +FL+AQR KGR G +LG+D
Sbjct:  137 QFLIAQRTKGRPGCLLGID 155          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A151ICQ4 (Uncharacterized protein OS=Cyphomyrmex costatus OX=456900 GN=ALC62_11109 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.715e-70
Identity = 37/65 (56.92%), Postives = 52/65 (80.00%), Query Frame = 2
Query: 2588 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
            ++++L F  + LQI QPRDDY+E LEL+IIFLG++P  GI+F   GA+HHARW+SK +Y LK+Y+
Sbjct:  442 KDEILNFTLNFLQIRQPRDDYKELLELTIIFLGKLPPNGIKFKIPGAVHHARWLSKAIYGLKMYL 506          

HSP 2 Score: 89.7373 bits (221), Expect = 5.715e-70
Identity = 52/120 (43.33%), Postives = 74/120 (61.67%), Query Frame = 2
Query: 1913 PWVSCNAGRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGK-ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            P V     R KVSDR A++++    K+L  ++ D+ L+RSTI R+R   RE I+  L+E  +  V   LVVHWDGK+L D   K + +DRLP+++SG    +LL   KL S TGK Q+E+
Sbjct:  216 PEVVAALDRGKVSDRNAMHIICALTKALNVNINDVNLSRSTIYRRRIKIREQIANDLKENLQ--VAAFLVVHWDGKLLPDDIFKFKKVDRLPVVISGLDTEQLLGVPKLDSGTGKKQSES 333          

HSP 3 Score: 83.5741 bits (205), Expect = 5.715e-70
Identity = 44/103 (42.72%), Postives = 64/103 (62.14%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAI 3083
            ++FR +F L   EV  L + C F V+ Y+K W+ AP A  AP+NDL  +Q  I YE ++  I KA+  K+A HLWY+SE L G+AL D  +    KR+++ A+
Sbjct:  505 YLFREEFRLTNYEVTALCEFCLFIVTFYIKWWYTAPFAIQAPYNDLMMIQDFITYEAINDKILKASQCKLANHLWYLSENLAGIALMDDRVPNELKRKMIKAM 607          

HSP 4 Score: 74.3294 bits (181), Expect = 5.715e-70
Identity = 35/77 (45.45%), Postives = 45/77 (58.44%), Query Frame = 3
Query: 2355 GACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDAKDVAAVLMD 2585
            G CVL+E+ L   L  L CRHHI ELV+  VFQ Y   +SAP V +F RFQ  W  ID   +  G++   ++ VL D
Sbjct:  364 GTCVLIEKSLKRKLFYLGCRHHILELVLKNVFQIYWPATSAPTVSIFIRFQENWDRIDVTKFKPGINDPKISQVLSD 440          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A151IND4 (Uncharacterized protein OS=Cyphomyrmex costatus OX=456900 GN=ALC62_02431 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.174e-68
Identity = 51/111 (45.95%), Postives = 72/111 (64.86%), Query Frame = 2
Query: 1937 RTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            R+KVS+R AVY++A T K+L  D++D+ L+  T+RR RQ++R      ++          LVVHWD KML+ L  K+ +DRL +LVSGKG  KLL    ++S TG AQA+A
Sbjct:  238 RSKVSNRSAVYILAATCKALQCDIRDINLSAETVRRSRQNYRHHTMQDVKNSLPTAAS--LVVHWDSKMLKSLKSKDLVDRLAVLVSGKGNIKLLGIPIIESGTGAAQAQA 346          

HSP 2 Score: 80.8777 bits (198), Expect = 2.174e-68
Identity = 33/75 (44.00%), Postives = 49/75 (65.33%), Query Frame = 3
Query: 2355 GACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDAKDVAAVL 2579
            G C LLE  LG +LL+L CRHHI EL + AVF    G S+ PE+ +F+RFQ  W  ID++ Y +G+   +++ ++
Sbjct:  377 GTCTLLENKLGKSLLALPCRHHILELPLSAVFNFLFGASNGPEIKLFQRFQKAWSTIDKSQYESGLQDSNLSYLI 451          

HSP 3 Score: 80.1073 bits (196), Expect = 2.174e-68
Identity = 39/103 (37.86%), Postives = 65/103 (63.11%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAI 3083
            ++FR QF +  +E+  LR    F+V +Y+K W+    A  AP NDL  ++ L++Y+ V+  +S+ A A M++H WY+SE+L+ LA FD  +    KR +VS++
Sbjct:  518 YLFRKQFPITKSELAALRQFNIFTVGIYLKNWYTCQNATLAPVNDLQLMKDLLEYKTVNTKVSEIAFATMSRHTWYLSEKLIALAFFDSSVPVEIKRAMVSSL 620          

HSP 4 Score: 74.7146 bits (182), Expect = 2.174e-68
Identity = 28/65 (43.08%), Postives = 47/65 (72.31%), Query Frame = 2
Query: 2588 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
            R  L+ F ++Q+++ QPRDDY+E L+L+++F+G    + +   A GA+H ARWM+K +Y LK+Y+
Sbjct:  455 REDLVIFIQNQMKMFQPRDDYKELLQLALLFMGENSIKPVNIRAPGAVHRARWMAKTIYCLKIYL 519          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: J9M4P2 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.779e-67
Identity = 43/111 (38.74%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 1937 RTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            + KVSDR AV+L+   A+    +V D A+NRS+++R R+  R  IS  ++  F        VVHWD K+L +L G E +DRLP++++   + +LL    L S TGK  + A
Sbjct:  332 KCKVSDRDAVHLLIACAEVFNVNVNDYAINRSSVKRSREGFRYQISSEIKTAFHQLNLNFAVVHWDSKILPNLIGTENVDRLPVIITAPNVEQLLGVPHLSSGTGKEISSA 442          

HSP 2 Score: 81.6481 bits (200), Expect = 2.779e-67
Identity = 37/77 (48.05%), Postives = 53/77 (68.83%), Query Frame = 3
Query: 2352 NGACVLLEQMLGINLLSLACRHHIFELVIGAVFQ-TYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDAKDVAAVL 2579
            NG+CVLLEQML   +L LACRHHIFE+++ +VF  + +   S PE+ +FKRF++ W  IDQ  Y+T +   +V  +L
Sbjct:  472 NGSCVLLEQMLNRPILFLACRHHIFEIILQSVFSYSKLTTMSGPEIPIFKRFKNNWNQIDQTKYNTWVSDNEVKKIL 548          

HSP 3 Score: 77.411 bits (189), Expect = 2.779e-67
Identity = 41/118 (34.75%), Postives = 64/118 (54.24%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAIKVID*LLDVYLTYVI 3128
            ++F+ QF L   E+  L+ IC F V  Y++ WF +P A  AP+ND+ FL+ L DY+     +++ A  K   HLWY+ EE    +LFD  +    K+++   +   D L +  LT  I
Sbjct:  615 YIFQEQFKLTKAEITSLKTICCFIVKCYIEFWFRSPNAIEAPYNDVLFLRKLEDYKSDDKKVAELAIKKFINHLWYLGEETACFSLFDDRIENHVKKQMAQQLLENDDLQEDELTTEI 732          

HSP 4 Score: 77.0258 bits (188), Expect = 2.779e-67
Identity = 33/59 (55.93%), Postives = 39/59 (66.10%), Query Frame = 2
Query: 2606 FAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
            F +  L    PRDDY+EFLEL IIFLG VP + I F   GA H ARWM K +Y LK+Y+
Sbjct:  558 FCKDTLNQNLPRDDYKEFLELVIIFLGGVPPKSIHFKRPGAYHLARWMCKGIYCLKIYI 616          

HSP 5 Score: 25.0238 bits (53), Expect = 2.779e-67
Identity = 10/24 (41.67%), Postives = 17/24 (70.83%), Query Frame = 1
Query: 2278 ALNEWGIADRVRAMSFDTS-SNTG 2346
             L +W + ++V+A  FDT+ SN+G
Sbjct:  446 TLKDWSMLEKVQAFVFDTTASNSG 469          

HSP 6 Score: 79.7221 bits (195), Expect = 7.550e-13
Identity = 44/116 (37.93%), Postives = 67/116 (57.76%), Query Frame = 1
Query: 1285 LTGGKLPSLRQVLGLLLHEHKENGKTIREASTIAIESTAKFWQKGRIPTRAVQHCQA--KVESEFVVWRLRLLKKNASRKAETQKAKKAAFCSRLDDLFDIAHADALKNIKIEEDR 1626
            +TG KLPS      +L +  +     + ++S +  +    FW+K RIPT+   HC    K+++ +  WR   L KN +RK+ TQ+ K+  F + L++LFDIAH DA   IKI+EDR
Sbjct:  118 ITGNKLPSNGDCFRVLFYNMRVVNLNLNDSSGLVADECLLFWKKARIPTQY--HCDIVRKIKNLYESWRS--LDKNKTRKSATQQCKENNFKNSLNNLFDIAHKDAFNIIKIDEDR 229          

HSP 7 Score: 26.1794 bits (56), Expect = 7.550e-13
Identity = 10/19 (52.63%), Postives = 14/19 (73.68%), Query Frame = 2
Query: 1625 EFLLAQREKGRRGSMLGLD 1681
            +FL  QR++GR G M G+D
Sbjct:  230 QFLTLQRQEGRVGYMAGVD 248          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 184.111 bits (466), Expect = 3.581e-119
Identity = 98/104 (94.23%), Postives = 100/104 (96.15%), Query Frame = 3
Query: 2775 FMFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQALIDYEVVHPXXXXXXXXXXXXHLWYISEELVGLALFDKDLSTVTKRELVSAIK 3086
            +MFRSQFDLRPTEVKGLRDICTFSVSLY+KVWF APCAAT P NDLTFLQALIDYEVVHPAISKAASAKMAKHLWYISEELVGLALFDKDLST TKRELVSAIK
Sbjct:  903 YMFRSQFDLRPTEVKGLRDICTFSVSLYIKVWFTAPCAATGPRNDLTFLQALIDYEVVHPAISKAASAKMAKHLWYISEELVGLALFDKDLSTTTKRELVSAIK 1006          

HSP 2 Score: 158.303 bits (399), Expect = 3.581e-119
Identity = 75/79 (94.94%), Postives = 75/79 (94.94%), Query Frame = 3
Query: 2349 ANGACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDAKDVAAVLMD 2585
            ANGACVLLEQMLGINLLSLACRHHIFELVIGAVFQT MGPSSA EVLMFKRFQSCWQFID ASYSTGMD KDVAAVLMD
Sbjct:  760 ANGACVLLEQMLGINLLSLACRHHIFELVIGAVFQTCMGPSSAQEVLMFKRFQSCWQFIDPASYSTGMDDKDVAAVLMD 838          

HSP 3 Score: 129.798 bits (325), Expect = 3.581e-119
Identity = 61/66 (92.42%), Postives = 63/66 (95.45%), Query Frame = 2
Query: 2585 SRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2782
            +RNKLLEFAESQLQIMQPRDDYREFLELSIIFLG VPARGIRFIA GAM HARWMSKVLYSLKVY+
Sbjct:  839 TRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGGVPARGIRFIAPGAMQHARWMSKVLYSLKVYM 904          

HSP 4 Score: 239.965 bits (611), Expect = 2.913e-109
Identity = 119/136 (87.50%), Postives = 124/136 (91.18%), Query Frame = 1
Query: 1219 TFRMNSTRSKTKVYLLESYTEVLTGGKLPSLRQVLGLLLHEHKENGKTIREASTIAIESTAKFWQKGRIPTRAVQHCQAKVESEFVVWRLRLLKKNASRKAETQKAKKAAFCSRLDDLFDIAHADALKNIKIEEDR 1626
            + ++NSTRSKTKVYLLESYTEVLTG KLPSL QVLGL LHEHKENGKTIR ASTIAIESTAKFWQK RIPTRAV HCQAK+ESEF  W  RLLKKNASRKAETQKAK+AAFCSRLDDLFDIAHADA KNIKIEEDR
Sbjct:  484 SLKINSTRSKTKVYLLESYTEVLTGRKLPSLLQVLGLFLHEHKENGKTIRVASTIAIESTAKFWQKARIPTRAVHHCQAKLESEFDAW--RLLKKNASRKAETQKAKEAAFCSRLDDLFDIAHADAHKNIKIEEDR 617          

HSP 5 Score: 114.005 bits (284), Expect = 2.913e-109
Identity = 80/83 (96.39%), Postives = 80/83 (96.39%), Query Frame = 3
Query: 1686 EQRASEARDKLAARRHRAVCDQQQLDAKAXXXXXXXXXXXXXXXXXXXXXXMQGATGGVHTPVRSQRKRGRLEVVSPGLAAML 1934
            EQRASEARDKLAARRHRAVCDQQQLDAKAELSELDSHSNSSTSES ESGDEMQG TG VHTPVRSQRKRGRLEVVSPGLAAML
Sbjct:  643 EQRASEARDKLAARRHRAVCDQQQLDAKAELSELDSHSNSSTSESYESGDEMQGTTGRVHTPVRSQRKRGRLEVVSPGLAAML 725          

HSP 6 Score: 64.3142 bits (155), Expect = 2.913e-109
Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 2
Query: 1913 PWVSCNAGRTKVSDRKAVYLVAETAKSLGQDVKDLALNRS 2032
            P ++    RTKVSDRKAVYLVAETAKSLGQD+KDLALNRS
Sbjct:  719 PGLAAMLDRTKVSDRKAVYLVAETAKSLGQDMKDLALNRS 758          

HSP 7 Score: 41.9726 bits (97), Expect = 2.913e-109
Identity = 18/20 (90.00%), Postives = 20/20 (100.00%), Query Frame = 2
Query: 1625 EFLLAQREKGRRGSMLGLDV 1684
            +FL+AQREKGRRGSMLGLDV
Sbjct:  618 KFLIAQREKGRRGSMLGLDV 637          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000034492.1 (SMESG000034492.1)

HSP 1 Score: 147.902 bits (372), Expect = 3.212e-44
Identity = 86/141 (60.99%), Postives = 101/141 (71.63%), Query Frame = 3
Query: 3870 LVFHFYNQTIKVTRHAKLNQRSVLYYFGKLQSVLVGENKSQILGFRRLSSRSTSKLVFIKIKYYQRYLFFDLWKLTSVENK---RPNSA--------SNHFIRTSPSANEIKSSYINVXXXXXXXXXXXXXDNEMACGTLF 4259
            + F ++NQ+IKVTRHA LNQR+V+YYFGK+QSVL GENKSQ+L FRRLSS  TSKL+F+KIKYY+ YLF DLWKL  VE+K    PN          SN  IRT  SANE   SY NV+I + KTIS  + DNE AC TLF
Sbjct:    1 MTFDYFNQSIKVTRHANLNQRAVIYYFGKIQSVLEGENKSQMLTFRRLSSTLTSKLLFVKIKYYRGYLFSDLWKLIFVEDKLVQTPNHGIENKCLPESNQVIRTPKSANETNFSYSNVSIPNNKTISLTLNDNEFACITLF 141          

HSP 2 Score: 52.373 bits (124), Expect = 3.212e-44
Identity = 23/30 (76.67%), Postives = 26/30 (86.67%), Query Frame = 1
Query: 4264 LLYESQLISKSSTNQSRTPRPWSGYEETFV 4353
            +LYES+L+SKSS NQ RTP PW GYEETFV
Sbjct:  158 VLYESRLLSKSSVNQIRTPMPWIGYEETFV 187          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000031866.1 (SMESG000031866.1)

HSP 1 Score: 151.369 bits (381), Expect = 2.694e-41
Identity = 88/147 (59.86%), Postives = 104/147 (70.75%), Query Frame = 3
Query: 3837 QII*LINETNQLVFHFYNQTIKVTRHAKLNQRSVLYYFGKLQSVLVGENKSQILGFRRLSSRSTSKLVFIKIKYYQRYLFFDLWKLTSVENKRPN-----------SASNHFIRTSPSANEIKSSYINVXXXXXXXXXXXXXDNEMA 4244
            Q+I LINETN + F + NQ+I+VTRHA LNQ +VLYYFG++Q VL GENKSQ+L FRR SS STSKLVF+KIKYY+RYLF DLWK+  VE+K                SN  IRT PSANEI  SY NV+I + K ISS + DNE A
Sbjct:  248 QVIRLINETNLVTFGYLNQSIQVTRHANLNQSAVLYYFGRIQLVLEGENKSQLLTFRRFSSTSTSKLVFVKIKYYRRYLFSDLWKIIFVEDKLVQISHHSIENKYLPESNQVIRTPPSANEINLSYTNVSIPNNKIISSTLNDNEFA 394          

HSP 2 Score: 39.2762 bits (90), Expect = 2.694e-41
Identity = 18/24 (75.00%), Postives = 21/24 (87.50%), Query Frame = 1
Query: 3772 EKSVYENRTDSDNKGVKIHSNHKL 3843
            EKSVYEN TDSDN+ VKIHSN ++
Sbjct:  226 EKSVYENGTDSDNQWVKIHSNQQV 249          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000011497.1 (SMESG000011497.1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.461e-21
Identity = 42/86 (48.84%), Postives = 64/86 (74.42%), Query Frame = 3
Query: 3849 LINETNQLVFHFYNQTIKVTRHAKLNQRSVLYYFGKLQSVLVGENKSQILGFRRLSSRSTSKLVFIKIKYYQRYLFFDLWKLTSVE 4106
            LINETN+++FH+ NQTI VTR    NQ++V+YY GK Q+ L  +N ++++ F +L S+STSK + IKI++Y+R    +LW+LT V+
Sbjct:    3 LINETNRVIFHYDNQTITVTRKTDSNQKAVIYYCGKTQATLSDKNDTKVIKFYQLRSKSTSKRILIKIQHYRRKTISNLWRLTLVD 88          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000014243.1 (SMESG000014243.1)

HSP 1 Score: 71.633 bits (174), Expect = 1.859e-18
Identity = 41/104 (39.42%), Postives = 62/104 (59.62%), Query Frame = 2
Query: 1964 VYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVDVPLVVHWDGKMLRDLTGK--ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEA 2269
            +++VA   K++G D+  L+L  S+I R R+  R+ ++   +E F      PL+ H+DGK+L D  G+  E +DR+PI+VSG  I KLL   KL  STG+    A
Sbjct:    1 MHIVAPALKAVGVDIDTLSLPTSSIYRARKPVRKSLAQTQKELFVPTT--PLITHFDGKLLPDNDGRTEELVDRMPIVVSGLSIEKLLAIPKLPVSTGELMGNA 102          

HSP 2 Score: 41.9726 bits (97), Expect = 1.859e-18
Identity = 21/53 (39.62%), Postives = 31/53 (58.49%), Query Frame = 3
Query: 2355 GACVLLEQMLGINLLSLACRHHIFELVIGAVFQTYMGPSSAPEVLMFKRFQSC 2513
            GA  ++++     LL LACRHHI E+V  AVF  +   SS P++ +F   +S 
Sbjct:  134 GAINVIQRAFDKRLLFLACRHHILEIVSAAVFDKFFK-SSGPQIALFAASKSS 185          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A151IM575.930e-7748.08Uncharacterized protein (Fragment) OS=Cyphomyrmex ... [more]
J9M5935.073e-7544.14Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A151ICQ45.715e-7056.92Uncharacterized protein OS=Cyphomyrmex costatus OX... [more]
A0A151IND42.174e-6845.95Uncharacterized protein OS=Cyphomyrmex costatus OX... [more]
J9M4P22.779e-6738.74Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028508.13.581e-11994.23SMESG000028508.1[more]
SMESG000034492.13.212e-4460.99SMESG000034492.1[more]
SMESG000031866.12.694e-4159.86SMESG000031866.1[more]
SMESG000011497.13.461e-2148.84SMESG000011497.1[more]
SMESG000014243.11.859e-1839.42SMESG000014243.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014584 ID=SMED30014584|Name=DNA-directed RNA polymerase subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=4577bp
CCTATTCAAGACTAAATGTTTCTATTTATTTATGTTATTTATTCGAATTA
TTTATTCTCGTGATTTTATTTACGGCTGATTTCATCTTCTTTATTTTAGC
AATTTTTCTGATTCTGCATTTAACTAAAAAGTTTTACTTCTGAATTCTTT
CAACATATTTCAAAGTTTAAATTGTTGAAGTTTTGATTAACAACGCAATG
ATAGCTATGAGCAATTTCTTTTTCCCGGAACAAAGTTGAGAACCTATTTA
TTTGAATGGGCATTTTATACAGTCAAAATTCAAAAACTAATTTTTATAAA
AACTACGCTTCTAGTTTAAATATAGAAAAGAGCGTATGCGTATTTTATTG
ACAAGTTACGATTTATGACAAATCAAGGGTGTGAAACATTAAAAATTATA
ATTTTGAATTCAATTTTACATTTTTTAAATCAATAGTGGATTGCAAATAA
TACTAATAAAATAAAGTATGGCTATGTACTTATGTCACGCTTCATTGTAT
AATTATTATTTATTATATTACTTATAAATATCAGTAGTATGTATATATAG
GTAAGGATTACGGGAATTGCCATAAATTACCAGTAACTCAATACAAAACA
GGTCGTGTGGAATTTGTCGATTTTATGGCGGATTACTTTATTTACGCCAA
TACCTATGGATTATGGTGGTCCTTATTTTTCAACTTTCAAAAAGTGCTTG
TCTCACCCTTTCATTTTGTTCCTATATATAAGAAAAAAATTTAGGCCAAA
TATGAGCTCAATTGAACATTTAGAGGTAGCTCAATGAAGTCAAAGTTTTA
TAATAGACCGCATTATCAAAAGTAGTGAAATACATAACCCCCACTACTGC
TGAGTTTAAAATTTAGCAATAGATTATCATTTAAATCCTGATTTTGTTAC
TTACTACTAAGTGTGTGGGAACCAGCCTATGGTGTTCTTGTTCTTCTTCT
TCAATATTTTGTGCAACTAACTGTCTGGTGAAGTTATAGGGAATTGTTAT
TTACGTTTAAGAAAAGCTCTGAATAGTATTTATTACTGTAATTATTTAAA
GCTTCTGGTTGAAAATATTGTAATAGTTTTTCTGTTACTGCAATAGTGGC
AACCTGACTGTGAATTGTAGTTGCAGTTTTACTGGACTTAGTGGATTGCT
AGCAGTAATTAATAAATAATTTCTCACTGTAAATCAAATCATGACATACA
TTGTATTGTACTTCACTTACTTTTAGAATGAACAGTACCAGGTCTAAGAC
AAAGGTGTATCTGCTGGAGAGTTATACAGAGGTTTTGACTGGTGGGAAGT
TGCCTTCATTACGGCAGGTACTCGGTCTTTTACTTCATGAACACAAAGAG
AATGGCAAAACAATACGAGAGGCATCAACGATTGCCATTGAAAGTACTGC
TAAGTTTTGGCAAAAGGGAAGAATACCAACAAGGGCAGTTCAGCATTGCC
AAGCTAAGGTAGAGAGTGAATTCGTTGTATGGCGTCTGCGTCTACTAAAG
AAAAATGCATCAAGGAAAGCTGAGACACAAAAGGCTAAGAAAGCGGCATT
TTGTTCTAGGCTGGATGATTTATTTGACATCGCCCATGCCGATGCACTCA
AGAATATAAAGATAGAAGAAGACAGAATTTCTTTTAGCTCAGAGGGAAAA
GGGACGGAGAGGAAGTATGCTGGGGCTTGATGTAAGAGCAAAGAGCATCT
GAAGCTAGGGACAAGCTTGCGGCTAGACGGCATCGAGCAGTGTGTGACCA
GCAGCAGTTGGATGCGAAGGCTGAACTCAGTGAACTGGACAGCCACAGCA
ACAGCTCCACATCTGAATCTGACGAATCAGGTGATGAAATGCAGGGTGCT
ACTGGCGGAGTTCACACGCCTGTTCGATCTCAACGCAAGAGAGGGAGGTT
GGAAGTGGTTAGCCCTGGGTTAGCTGCAATGCTGGCAGAACGAAGGTGTC
TGACCGTAAGGCTGTGTACCTAGTGGCAGAAACGGCAAAAAGTCTTGGTC
AAGATGTAAAAGATCTTGCCTTGAACAGGAGTACAATACGTCGACAGCGA
CAAGATCATCGGGAGATGATATCAGGCCGTCTAAGAGAGGAGTTCCGAGC
TGATGTTGACGTCCCACTGGTTGTGCATTGGGACGGCAAAATGCTTCGTG
ACCTAACAGGCAAGGAGACCATAGATCGACTACCCATCCTCGTCTCTGGA
AAAGGTATTTCTAAGTTGTTGGTAGCAGCCAAGCTTCAATCGTCAACTGG
AAAAGCACAAGCTGAAGCCGATAAGTTGCTCTAAATGAATGGGGGATTGC
CGACCGGGTGAGAGCCATGTCATTTGACACGAGTTCCAACACAGGTCTGC
CAATGGGGCTTGTGTCCTTCTCGAGCAGATGCTTGGCATCAATTTGTTGT
CCCTTGCGTGCCGCCATCACATATTTGAACTTGTTATTGGAGCCGTGTTT
CAGACATACATGGGACCATCATCAGCACCAGAGGTCCTAATGTTCAAGCG
GTTCCAGTCATGCTGGCAGTTCATCGACCAGGCATCATACTCGACTGGAA
TGGATGCCAAAGATGTTGCAGCTGTCCTGATGGATCACGGAATAAACTAC
TGGAGTTTGCAGAGAGCCAGCTGCAGATAATGCAGCCAAGGGATGATTAT
CGGGAATTTCTGGAACTGTCGATAATTTTCCTCGGAAGAGTCCCAGCAAG
AGGCATTCGTTTCATCGCTTCAGGTGCCATGCACCATGCTCGATGGATGA
GCAAAGTACTGTACAGTTTGAAGGTTTATGTTTCGATCGCAGTTTGATCT
CAGACCAACAGAAGTAAAAGGGCTGCGAGACATCTGCACTTTCTCGGTCA
GCCTTTACATGAAAGTCTGGTTTATAGCTCCTTGTGCTGCAACAGCACCG
CATAATGATCTCACGTTCCTTCAGGCCCTCATTGATTATGAAGTAGTGCA
CCCAGCCATCTCCAAGGCAGCTTCTGCTAAAATGGCCAAACATCTTTGGT
ATATCTCGGAGGAACTCGTTGGACTGGCTCTGTTTGACAAGGATCTATCA
ACTGTAACGAAGCGCGAACTCGTCAGTGCTATCAAGGTGATTGACTGATT
GCTTGATGTTTACTTGACTTATGTCATTTATCATTAATTTCTTGTTTTTG
AGTGTTTGATAGAACTGTTAGCTATGGTACTAAAAGTAATTTATAATGTT
TTACCATACAGGAAAATGACGGAGCGGACAAACCGCCAAAACGAATCAAC
ATCGACATTCAGTCTGTTCGCGGTAAATCACTTGCTTACTTCATGACCAA
GCATTCGCATGTTCTGTTCGAACGATTGGAACTTCCAGATATTCATGAAT
CGGACGCGAATGTGTAAGACAAGTGACAGTGGGGTGCCCGGTGCTGGCTG
CCGAATGCCGATGCTGCATCCTAGCAACAGTGTGATGCTAAAACTTCTCC
ATTTGTCTTTGGTTTATCTTATATACCAACTCCAATGTCAGTGATATTTG
TTGATGGCATTAAAAGCGTGACAATTTGCTTCTTTCATTTTTATATAAGA
GTTGCGAAAAACGCACCATTCGTAAAAACTTTGATGCTCTTGAGCTGCCT
CTAAAATTTAGAGTCTAAATGTCAATATTTTCCCCCCAAAATTTTTCTCC
AGTGTTTTTTGTCTAAAAGGAACAACTGTGGAGGGTAAGACAATGAAAAA
CACCAAAAAAAATTTTTGGCCCTGTATAAGAACCACCCTACTATGGACGG
AGACGATCGATAATCTGTTACGAAAAATCCGTATATGAAAACAGAACGGA
TAGTGACAATAAAGGGGTCAAGATTCATTCTAATCACAAATTATATGATT
AATAAATGAAACAAATCAACTCGTTTTCCATTTCTACAATCAAACCATAA
AGGTTACCAGACACGCGAAACTAAATCAGAGATCTGTTCTATATTACTTT
GGAAAACTTCAATCTGTATTAGTAGGCGAAAATAAATCTCAAATATTAGG
TTTTCGACGACTTTCATCAAGATCAACCTCAAAACTAGTGTTTATAAAAA
TCAAATATTATCAACGTTATCTATTTTTCGACCTGTGGAAACTAACTTCG
GTTGAAAACAAACGTCCAAATTCCGCATCAAACCATTTTATTCGAACCTC
ACCCTCAGCTAATGAAATCAAATCTTCATATATCAATGTAACTATTTCGA
GCATTAAAACTATATCATCAATAATTACTGATAATGAAATGGCATGTGGA
ACATTATTCGTCACTGCTATATGAATCTCAATTAATATCCAAATCTTCTA
CAAATCAATCCAGGACTCCAAGACCTTGGAGTGGCTATGAAGAAACATTT
GTGTAGTAAGACAACTATTTTGCATGCAAATTGATAAAATAGCAATTGTG
AAACATTTTTTTATGAATATTGTTAATATTTTGTGTAAATCGGAACATTT
TCATATGATACAAGAAAAATCAATTTGATTAGCTGACGCTGAATTACGAA
GTAAGAGAAAATAAAATGCTGAAAATTTAATAAAAGCATATAAGGCAGGG
GAAAACAAAAAACAAAACCCACTAAGT
back to top

protein sequence of SMED30014584-orf-1

>SMED30014584-orf-1 ID=SMED30014584-orf-1|Name=SMED30014584-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MFRSQFDLRPTEVKGLRDICTFSVSLYMKVWFIAPCAATAPHNDLTFLQA
LIDYEVVHPAISKAASAKMAKHLWYISEELVGLALFDKDLSTVTKRELVS
AIKVID*
back to top

protein sequence of SMED30014584-orf-2

>SMED30014584-orf-2 ID=SMED30014584-orf-2|Name=SMED30014584-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
MNSTRSKTKVYLLESYTEVLTGGKLPSLRQVLGLLLHEHKENGKTIREAS
TIAIESTAKFWQKGRIPTRAVQHCQAKVESEFVVWRLRLLKKNASRKAET
QKAKKAAFCSRLDDLFDIAHADALKNIKIEEDRISFSSEGKGTERKYAGA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: molecular function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
Vocabulary: biological process
TermDefinition
GO:0032774RNA biosynthetic process