SMED30014569

Overview
NameSMED30014569
Smed IDSMED30014569
Length (bp)728
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014569 (SMED30014569) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014569 (SMED30014569) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014569 (SMED30014569) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014569 (SMED30014569) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014569

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014569SMESG000021079.1 SmedASXL_011123SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014569SMESG000021079.1 SmedASXL_011123SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30014569SMESG000021079.1 dd_Smed_v4_5027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30014569SMESG000021079.1 dd_Smed_v4_5027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014569 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000842:40933..41836 -3484
Homology
BLAST of SMED30014569 vs. Ensembl Human
Match: EXOSC4 (exosome component 4 [Source:HGNC Symbol;Acc:HGNC:18189])

HSP 1 Score: 67.0106 bits (162), Expect = 1.132e-12
Identity = 39/134 (29.10%), Postives = 67/134 (50.00%), Query Frame = -1
Query:  249 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRF--------APFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDIL 620
            K+     +F+ ADGS+++E G TK +  VY P E+R     ++  R         A FS   R +  + +     +   ++ +  +AI    H  S+I+IY+ VL  DG   +A +  A+LA++DA + M D +
Sbjct:   24 KIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFV 157          
BLAST of SMED30014569 vs. Ensembl Human
Match: EXOSC6 (exosome component 6 [Source:HGNC Symbol;Acc:HGNC:19055])

HSP 1 Score: 56.9954 bits (136), Expect = 4.538e-9
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = -1
Query:  243 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIE--------------------LRSEEQLSVTVRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG 617
            ++  + + S A GS+++E G TKV+C V  P +                    LR   +L    R APF+   R       + R +A  +Q +L  A+    +  +++E+  ++L D G A +A +T A+LAL DA V+MYD+++G
Sbjct:   39 VYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRG--RLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVG 182          
BLAST of SMED30014569 vs. Ensembl Celegans
Match: exos-4.1 (Putative exosome complex component RRP41 [Source:UniProtKB/Swiss-Prot;Acc:Q17533])

HSP 1 Score: 62.003 bits (149), Expect = 2.408e-11
Identity = 38/122 (31.15%), Postives = 67/122 (54.92%), Query Frame = -1
Query:  252 NADGSSFVEYGETKVVCTVYSPIELRS----EEQLSVTVRFAPFSQPSRLKYVNDT-----DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDI 590
            NA+GS ++E+G TKV+C VY P E +S    E++ ++  +++  ++ S L+  N T      T I++ ++ +  S I       S+++I+  V+  DG   +A +   SLAL DA + M  I
Sbjct:   31 NAEGSCYLEHGNTKVLCAVYGPYEGKSSKRIEDKCAIVCQYSA-TKFSGLERKNRTRGDRKSTEISRLLEKAFESVILTEAFPRSQLDIFCEVIQGDGSNLAACVNATSLALADAGIPMKGI 151          
BLAST of SMED30014569 vs. Ensembl Fly
Match: Ski6 (gene:FBgn0032487 transcript:FBtr0334755)

HSP 1 Score: 62.3882 bits (150), Expect = 2.014e-11
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = -1
Query:  246 SIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSV---TVRFAPFSQPSRLKYVNDTDTRIAKF---VQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILI 602
             +F   DGS+++E G TKV+  VY P + +  +  SV       A FS   R K     D +  +F   +Q +L +AI    +  S+I+IY+ VL DDG   +  +  A+LALIDA + + + ++
Sbjct:   31 GVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESVINCQYSQATFSTAER-KNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDAGICLNEFIV 154          
BLAST of SMED30014569 vs. Ensembl Fly
Match: Ski6 (gene:FBgn0032487 transcript:FBtr0080483)

HSP 1 Score: 62.3882 bits (150), Expect = 2.014e-11
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = -1
Query:  246 SIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSV---TVRFAPFSQPSRLKYVNDTDTRIAKF---VQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILI 602
             +F   DGS+++E G TKV+  VY P + +  +  SV       A FS   R K     D +  +F   +Q +L +AI    +  S+I+IY+ VL DDG   +  +  A+LALIDA + + + ++
Sbjct:   31 GVFEQPDGSAYMEQGNTKVLAAVYGPHQAKGNQTESVINCQYSQATFSTAER-KNRPRGDRKSLEFKLYLQQALSAAIKSELYPRSQIDIYVEVLQDDGANYAVALNAATLALIDAGICLNEFIV 154          
BLAST of SMED30014569 vs. Ensembl Fly
Match: Mtr3 (gene:FBgn0036916 transcript:FBtr0074918)

HSP 1 Score: 59.3066 bits (142), Expect = 4.428e-10
Identity = 34/131 (25.95%), Postives = 68/131 (51.91%), Query Frame = -1
Query:  243 FVNSSIFSNADGSSFVEYGETKVVCTVYSPIEL-RSEEQ------LSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG 614
            F+ + + +   GS+++EYG TKV+  V  P EL R+  +      L+  V FA FS    L  V + +  ++  +  ++   +  +   + +++I +++L+DDG   S  I C  +AL++  +  YD++  
Sbjct:   51 FIRAGVLTTVRGSAYMEYGNTKVLAIVAPPKELIRASARRMNMGVLNCYVNFAAFST-GDLDSVPERERHLSSMLTKAMEPVVCRTEFLNFQLDIRVLILDDDGCLLSTAINCCGVALVECGISTYDLITA 180          
BLAST of SMED30014569 vs. Ensembl Zebrafish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 95.5153 bits (236), Expect = 3.260e-23
Identity = 67/241 (27.80%), Postives = 121/241 (50.21%), Query Frame = -1
Query:   15 ESISNFHYVKKSDD--KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIEL-RSEE------QLSVTVRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQS--------------ISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDAL-KMYEVVKIHLKKSVEIK 662
            ++ S+   V+ + D   +F    + S A GS+++E G TK++C+VY P E  R +E      +L    R APFS   R  ++  ++ R ++  +  SL   +    +  S+I++ +MVL +DG   +  +TCAS+AL DA ++MYDI++G  +    N    + +  +               +++A+LPNL Q++ L +    G    + L +      D   K+Y VV+  L ++V+ K
Sbjct:   28 KAPSSRQGVRGNGDVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEERDLSATLMESLRPGVCLHRYPRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTLRQSGNACLVDPSYAEECGSWQEGYGDNQGCVTLALLPNLNQVSGLNAD---GEMREDTLTEAMRTCMDGCHKLYPVVQQALTRAVKKK 265          
BLAST of SMED30014569 vs. Ensembl Zebrafish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 95.5153 bits (236), Expect = 3.260e-23
Identity = 67/241 (27.80%), Postives = 121/241 (50.21%), Query Frame = -1
Query:   15 ESISNFHYVKKSDD--KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIEL-RSEE------QLSVTVRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQS--------------ISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDAL-KMYEVVKIHLKKSVEIK 662
            ++ S+   V+ + D   +F    + S A GS+++E G TK++C+VY P E  R +E      +L    R APFS   R  ++  ++ R ++  +  SL   +    +  S+I++ +MVL +DG   +  +TCAS+AL DA ++MYDI++G  +    N    + +  +               +++A+LPNL Q++ L +    G    + L +      D   K+Y VV+  L ++V+ K
Sbjct:   28 KAPSSRQGVRGNGDVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEERDLSATLMESLRPGVCLHRYPRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTLRQSGNACLVDPSYAEECGSWQEGYGDNQGCVTLALLPNLNQVSGLNAD---GEMREDTLTEAMRTCMDGCHKLYPVVQQALTRAVKKK 265          
BLAST of SMED30014569 vs. Ensembl Zebrafish
Match: exosc4 (exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1702])

HSP 1 Score: 67.0106 bits (162), Expect = 6.933e-13
Identity = 40/132 (30.30%), Postives = 69/132 (52.27%), Query Frame = -1
Query:  255 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVR--------FAPFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYD 620
            K+    S+F+ ADGS+++E G TK +  VY P E+R     S+  R         A FS   R +  + +   + ++  ++ +  +A+    +  S+I+IY+ +L  DG   SA +  A+LAL+DA + M D
Sbjct:   24 KVQARMSVFAQADGSAYLEQGNTKALAVVYGPHEIRGSRSKSLHDRAIINCQYSMATFSTAERKRRPHGDRKSSEMSLHLKQTFEAAVLTELYPRSQIDIYVKILQADGGNYSACVNAATLALVDAGIPMRD 155          
BLAST of SMED30014569 vs. Ensembl Zebrafish
Match: exosc5 (exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-060503-675])

HSP 1 Score: 49.6766 bits (117), Expect = 7.208e-7
Identity = 31/123 (25.20%), Postives = 59/123 (47.97%), Query Frame = -1
Query:  240 NSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 608
              S+ S  DGSS    G+T ++  VY P E++  +++          QP ++   +  +    + V+ +  +A+  + H  S + + L V++DDG   S  +  A +AL+DA + M  +   V
Sbjct:   20 EQSLLSRPDGSSTFVQGDTSILAGVYGPAEVKVSKEIYDRATVEVLIQP-KMGLPSVRERAREQCVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALMDAGLPMSRLFCSV 141          
BLAST of SMED30014569 vs. Ensembl Zebrafish
Match: exosc5 (exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-060503-675])

HSP 1 Score: 49.6766 bits (117), Expect = 7.208e-7
Identity = 31/123 (25.20%), Postives = 59/123 (47.97%), Query Frame = -1
Query:  240 NSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 608
              S+ S  DGSS    G+T ++  VY P E++  +++          QP ++   +  +    + V+ +  +A+  + H  S + + L V++DDG   S  +  A +AL+DA + M  +   V
Sbjct:   20 EQSLLSRPDGSSTFVQGDTSILAGVYGPAEVKVSKEIYDRATVEVLIQP-KMGLPSVRERAREQCVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALMDAGLPMSRLFCSV 141          
BLAST of SMED30014569 vs. Ensembl Xenopus
Match: ttyh1 (tweety family member 1 [Source:Xenbase;Acc:XB-GENE-940450])

HSP 1 Score: 83.5741 bits (205), Expect = 1.521e-18
Identity = 55/180 (30.56%), Postives = 95/180 (52.78%), Query Frame = -1
Query:  138 LFVNSSIFSNADGSSFVEYGE--TKVVCTVYSPIEL-----RSEEQ--LSVTVRFAPFSQ--PSRLKYVNDTDTRIAKF-VQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXX--------XXXXXXNQSISVAVLPNLRQIANLM 617
            +FV + + S A GS+++E G   TKV+C V+ P E      R+E +  L   +R+APFS+  P           R A   +Q SL  A+    +  +++ ++++VL D G A  A ++CASLAL DA ++M+D+ +G  ++     E        E       ++S+++LP L Q++ L+
Sbjct:   43 VFVRAGLLSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERAETRGRLLCDLRWAPFSRRGPWSGSCPAGPSPRQAGLQLQESLEPAVRLDRYPRAEVIVWVLVLEDRGSALPAAVSCASLALADAGIEMFDLALGCGLSRGPGGELLLDPDDDEEEAGSGGTMSLSLLPTLNQVSGLI 222          
BLAST of SMED30014569 vs. Ensembl Xenopus
Match: ENSXETT00000012729.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:63608713:63610133:1 gene:ENSXETG00000005067.1 transcript:ENSXETT00000012729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 5.051e-8
Identity = 35/132 (26.52%), Postives = 68/132 (51.52%), Query Frame = -1
Query:  135 QLSVTVRFAPFS---QPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXX------XXXXXNQSISVAVLPNLRQIANLMS 503
            +L   +R+APFS     S       +  +    +Q SL  A+   ++  +++ ++++VL D G A  A ++CASLAL DA ++M+++ +G  ++     E           R  ++S+++LP L Q++   S
Sbjct:   76 RLFCDLRWAPFSCHVPWSGSCPAGPSPHQAGLQLQESLEPAVQLDHYPRAEVIVWVLVLEDRGSALPAPVSCASLALADAGIEMFNLALGCGLSCSPGGELLLDPDDEEAGRGGTMSLSLLPTLNQVSAWAS 207          
BLAST of SMED30014569 vs. Ensembl Xenopus
Match: EXOSC5 (exosome component 5 [Source:NCBI gene;Acc:100170617])

HSP 1 Score: 47.7506 bits (112), Expect = 3.841e-6
Identity = 31/122 (25.41%), Postives = 57/122 (46.72%), Query Frame = -1
Query:  240 SIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQP-SRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 602
            S+ S  DGS+    G+T V+  VY P E++   ++          +P + L  + + +    + ++ +  S I  S H  + I I L +++D G   S  +  A + L+DA + M  +  GV
Sbjct:   16 SLLSRPDGSATFLQGDTSVMAGVYGPAEIKVSREIHNKATLEVILRPKTGLPAIQEKNQE--QLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLPMRALFCGV 135          
BLAST of SMED30014569 vs. Ensembl Xenopus
Match: kdelr2 (KDEL endoplasmic reticulum protein retention receptor 2 [Source:Xenbase;Acc:XB-GENE-943535])

HSP 1 Score: 46.595 bits (109), Expect = 8.781e-6
Identity = 24/96 (25.00%), Postives = 49/96 (51.04%), Query Frame = -1
Query:  240 SEEQLSVTVRFAPFSQPSRLKY-----VNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 512
            +   L   + +APFS+  R  +        +  +    +Q SL  A+    +   ++ ++++VL D G    A ++CASL L DA ++M+++++G 
Sbjct:   37 TRGHLLCDLHWAPFSR--RGPWSGSCPAGPSPHQAGLQLQESLELAMRLDRYPRGEVIVWVLVLEDRGSVLPATVSCASLPLADAGIEMFNLVLGC 130          
BLAST of SMED30014569 vs. Ensembl Mouse
Match: Exosc4 (exosome component 4 [Source:MGI Symbol;Acc:MGI:1923576])

HSP 1 Score: 66.6254 bits (161), Expect = 9.110e-13
Identity = 39/134 (29.10%), Postives = 67/134 (50.00%), Query Frame = -1
Query:  249 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRF--------APFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDIL 620
            K+     +F+ ADGS+++E G TK +  VY P E+R     ++  R         A FS   R +  + +     +   ++ +  +AI    H  S+I+IY+ VL  DG   +A +  A+LA++DA + M D +
Sbjct:   24 KIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFV 157          
BLAST of SMED30014569 vs. Ensembl Mouse
Match: Exosc6 (exosome component 6 [Source:MGI Symbol;Acc:MGI:1919794])

HSP 1 Score: 60.8474 bits (146), Expect = 1.306e-10
Identity = 51/198 (25.76%), Postives = 90/198 (45.45%), Query Frame = -1
Query:  111 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ------------------LSVTVRFAPFSQPSRL--KYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXX---------XXXXNQSISVAVLPNLRQIANLMSTYRCGLAE 617
            ++  + + S A GS+++E G TKV+C V  P +    E+                  L    R APFS   R   +     D  +   +Q +L  A+    +  +++E+  ++L D G A +A +T A+LAL DA V+MYD+++G  ++                   +    ++VA++P L Q+A L+ +   G  E
Sbjct:   39 VYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGSGPAGAGGEAPAALRGRLLCDFRRAPFSGRRRRAPQGGGGEDRELGLALQEALEPAVRLGRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDLVVGCGLSLTPGPSPTWLLDPTRLEEEHSAAGLTVALMPVLNQVAGLLGSGEGGQTE 236          
BLAST of SMED30014569 vs. Ensembl Mouse
Match: Exosc5 (exosome component 5 [Source:MGI Symbol;Acc:MGI:107889])

HSP 1 Score: 47.3654 bits (111), Expect = 5.420e-6
Identity = 35/130 (26.92%), Postives = 61/130 (46.92%), Query Frame = -1
Query:  240 IFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ------LSVTVR----FAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 599
            + S  DGS+    G+T V+  VY P E++  ++      L V +R        ++ SR + V +T        ++ +L A+    H  + I + L V++D G   +  +  A +AL+DA V M  +  GV
Sbjct:   37 LLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLVRNT-------CEAVVLGAL----HPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGV 155          
BLAST of SMED30014569 vs. Ensembl Mouse
Match: Exosc5 (exosome component 5 [Source:MGI Symbol;Acc:MGI:107889])

HSP 1 Score: 47.3654 bits (111), Expect = 5.420e-6
Identity = 35/130 (26.92%), Postives = 61/130 (46.92%), Query Frame = -1
Query:  240 IFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ------LSVTVR----FAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 599
            + S  DGS+    G+T V+  VY P E++  ++      L V +R        ++ SR + V +T        ++ +L A+    H  + I + L V++D G   +  +  A +AL+DA V M  +  GV
Sbjct:   37 LLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLVRNT-------CEAVVLGAL----HPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGV 155          
BLAST of SMED30014569 vs. UniProt/SwissProt
Match: sp|Q6P0I8|EXOS6_DANRE (Exosome complex component MTR3 OS=Danio rerio OX=7955 GN=exosc6 PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.461e-22
Identity = 67/241 (27.80%), Postives = 121/241 (50.21%), Query Frame = -1
Query:   15 ESISNFHYVKKSDD--KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIEL-RSEE------QLSVTVRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQS--------------ISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDAL-KMYEVVKIHLKKSVEIK 662
            ++ S+   V+ + D   +F    + S A GS+++E G TK++C+VY P E  R +E      +L    R APFS   R  ++  ++ R ++  +  SL   +    +  S+I++ +MVL +DG   +  +TCAS+AL DA ++MYDI++G  +    N    + +  +               +++A+LPNL Q++ L +    G    + L +      D   K+Y VV+  L ++V+ K
Sbjct:   28 KAPSSRQGVRGNGDVRPVFARCGLVSQAKGSAYIEAGNTKIICSVYGPKETERRDETDMKTGRLVCDFRLAPFSCVKRGAWIQGSEERDLSATLMESLRPGVCLHRYPRSQIDVNVMVLENDGSVLAHAVTCASMALADAGIEMYDIVLGCTLRQSGNACLVDPSYAEECGSWQEGYGDNQGCVTLALLPNLNQVSGLNAD---GEMREDTLTEAMRTCMDGCHKLYPVVQQALTRAVKKK 265          
BLAST of SMED30014569 vs. UniProt/SwissProt
Match: sp|Q28F19|EXOS6_XENTR (Exosome complex component MTR3 OS=Xenopus tropicalis OX=8364 GN=exosc6 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.059e-18
Identity = 55/180 (30.56%), Postives = 95/180 (52.78%), Query Frame = -1
Query:  138 LFVNSSIFSNADGSSFVEYGE--TKVVCTVYSPIEL-----RSEEQ--LSVTVRFAPFSQ--PSRLKYVNDTDTRIAKF-VQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXX--------XXXXXXNQSISVAVLPNLRQIANLM 617
            +FV + + S A GS+++E G   TKV+C V+ P E      R+E +  L   +R+APFS+  P           R A   +Q SL  A+    +  +++ ++++VL D G A  A ++CASLAL DA ++M+D+ +G  ++     E        E       ++S+++LP L Q++ L+
Sbjct:   43 VFVRAGLLSQAKGSAYLEAGSGGTKVLCAVHGPRERGMGGERAETRGRLLCDLRWAPFSRRGPWSGSCPAGPSPRQAGLQLQESLEPAVRLDRYPRAEVIVWVLVLEDRGSALPAAVSCASLALADAGIEMFDLALGCGLSRGPGGELLLDPDDDEEEAGSGGTMSLSLLPTLNQVSGLI 222          
BLAST of SMED30014569 vs. UniProt/SwissProt
Match: sp|O26779|RRP41_METTH (Exosome complex component Rrp41 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=rrp41 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.417e-17
Identity = 60/210 (28.57%), Postives = 102/210 (48.57%), Query Frame = -1
Query:   30 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIE-----LRSEEQLSVTVRF--APFSQPSRLKYVNDTDT-RIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQ------SISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKK 617
            L + + I   ADGSS++E+G  K++  VY P E     L+  ++  +  R+  APFS   R +   D  +  I+K    +L  A+       S I++++ VL  +G    A IT AS+AL DA + M D+++        ++   + +  +       + VA+LP  R+I  L S       E+E  L  D  ++  L+++EV K  L+K
Sbjct:   29 LKIEAGILERADGSSYLEFGGNKILVAVYGPREAQIRKLQRPDRAVIRCRYNMAPFSVEERKRPGPDRRSVEISKITAEALRPALILEKFPRSVIDVFIEVLEAEGGTRCAGITAASVALADAGIPMRDMVVACAAGKVGDQVVLDLSEEEDKEGQADVPVAILPRTREITLLQSDGNLTPEEFERAL--DLAVEGCLRIHEVQKEALRK 236          
BLAST of SMED30014569 vs. UniProt/SwissProt
Match: sp|A1RST0|RRP41_PYRIL (Exosome complex component Rrp41 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) OX=384616 GN=rrp41 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.370e-17
Identity = 48/133 (36.09%), Postives = 71/133 (53.38%), Query Frame = -1
Query:  240 VNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSE-----EQLSVTVRF--APFSQPSRLKYVNDT--DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 611
            +   I SNADGS+ V YG T  V  VY P E+        ++  + VR+  APFS     K    T  +  I+K ++ +L  A+    +  S+I++++ +L  DG    A +T ASLAL DA V M D++IGV
Sbjct:   28 ITVGIVSNADGSAMVSYGATTAVAAVYGPREMHPRHLSLPDRGVMRVRYHMAPFSTKDERKSPTPTRREIEISKILREALEPAVVLEQYPRSRIDVFIEILQADGSTRVASLTAASLALADAGVYMRDLVIGV 160          
BLAST of SMED30014569 vs. UniProt/SwissProt
Match: sp|B1Y978|RRP41_PYRNV (Exosome complex component Rrp41 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) OX=444157 GN=rrp41 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.778e-16
Identity = 45/133 (33.83%), Postives = 72/133 (54.14%), Query Frame = -1
Query:  240 VNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSE-----EQLSVTVRF--APFSQPSRLKYVNDT--DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 611
            ++  + SNADGS+ V YG T  V  VY P E+        ++  + VR+  APFS     K    +  +  I+K ++ +L  A+    +  S+I++++ +L  DG    A +T ASLAL DA + M D++IGV
Sbjct:   28 ISVGVISNADGSAMVSYGATTAVAAVYGPREMHPRHLSLPDRGVMRVRYHMAPFSTKDERKSPTPSRREIEISKVLREALEPAVMLEQYPRSRIDVFIEILQADGSTRVASLTAASLALADAGIYMRDLVIGV 160          
BLAST of SMED30014569 vs. TrEMBL
Match: V9L4C5 (Exosome complex component MTR3 (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.063e-25
Identity = 65/225 (28.89%), Postives = 121/225 (53.78%), Query Frame = -1
Query:   15 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVT-------VRFAPFSQPSRLKYVNDT-DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQ-------------SISVAVLPNLRQIANLMSTYRCGLAEYEELLQWD---GPLKDALKMYEVVKIHLKKSVEIK 617
            +F  + + S ADGS + E G +K++C VY P E   +E+ S++       +RFAPFS   R  ++  + +   +  ++ SL  A+    +  S+IE+Y+MVL +DG    A +TCAS+AL +A ++M+D+++G ++    +    +    +             S++VA+LP L QI+ L+S+      E++E +  +     ++   K+Y VV+  L +SV+ +
Sbjct:   16 VFARAGLLSQADGSVYAECGRSKLLCAVYGPRESERKEERSMSRANLLCELRFAPFSCKKRSAWIQGSLEKEYSSILEQSLRPAVCLHKYPRSQIEVYVMVLENDGSTLGAALTCASMALAEAGIEMFDVVVGCSLRQAGDVSLLDPTALEEYNAADCKGINNGSLTVALLPTLNQISGLVSS-----GEWKEQISVEAIKACIEGCQKLYSVVQQCLTRSVKKR 235          
BLAST of SMED30014569 vs. TrEMBL
Match: H3CEF3 (Exosome component 6 OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.177e-25
Identity = 66/214 (30.84%), Postives = 110/214 (51.40%), Query Frame = -1
Query:   21 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMS-------TYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVE 617
            +FV   + S A GS+++E G TK++C VY P E   +++       L+  VRFAPFS P R  ++  +  R  +  +  SL  A+    +  S+IE++L+VL + G   +  +TCAS+AL DA + MYD+++G ++         +    + ++VA LP+L QI+ L S       T R G+            ++   K+Y VV+  L + V 
Sbjct:   36 VFVRCGLGSQAKGSAYMEAGATKLLCCVYGPRETERKDETDMRCGRLTADVRFAPFSCPERGSWIQGSQDRDFSSMLLESLQPAVCLHRYPRSQIEVHLVVLENGGSVLAHAVTCASVALADAGIQMYDLVLGCSLRQDGASFVADPTYAEELTVAFLPSLNQISGLRSDGEMAEDTLRAGVRTC---------IEGCYKLYPVVRQVLSRCVR 240          
BLAST of SMED30014569 vs. TrEMBL
Match: A0A3P9J1Y9 (Exosome component 6 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.140e-24
Identity = 68/217 (31.34%), Postives = 112/217 (51.61%), Query Frame = -1
Query:   24 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDT-DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG-----------VXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSV 617
            +FV   + S A GS+++E G+TK++C+VY P E   +++       L+  +RFAPFS P R  ++  + D   +  +Q SL  A+    +  S+IE+ +MVL + G   +  ITCASLAL DA ++MYD+++G           V+          +      ++VA LP+L Q++ L S     +AE          ++   K+Y VV+  L K+V
Sbjct:   48 VFVRCGLVSQAKGSAYIEAGDTKLLCSVYGPRETERKDETDMKCGRLTTDMRFAPFSCPERGSWIQGSQDKNFSLMLQESLQPALCLHKYPRSQIEVNVMVLENSGSVQAHAITCASLALADAGIEMYDLVLGCSIRQDGSSYVVDPTYSEESNWSSCEHQGGLTVAFLPSLNQVSGLQSDGE--MAEETLTAGIRTCIEGCYKLYPVVQQALVKAV 262          
BLAST of SMED30014569 vs. TrEMBL
Match: A0A3P9L787 (RNase_PH domain-containing protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.971e-24
Identity = 67/217 (30.88%), Postives = 113/217 (52.07%), Query Frame = -1
Query:   24 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDT-DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG-----------VXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSV 617
            +FV   + S A GS+++E G+TK++C+VY P E   +++       L+  +RFAPFS P R  ++  + D   +  +Q SL  A+    +  S+IE+ +MVL + G   +  ITCASLAL DA ++MYD+++G           V+          ++     ++VA LP+L Q++ L S     +AE          ++   K+Y V++  L K+V
Sbjct:   48 VFVRCGLVSQAKGSAYIEAGDTKLLCSVYGPRETERKDETDMKCGRLTTDMRFAPFSCPERGSWIQGSQDKNFSLMLQESLQPALCLHKYPRSQIEVNVMVLENSGSVQAHAITCASLALADAGIEMYDLVLGCSIRQDGSSYVVDPTYSEESNWSSSEHQGGLTVAFLPSLNQVSGLQSDGE--MAEETLTAGIRTCIEGCYKLYPVIQQALVKAV 262          
BLAST of SMED30014569 vs. TrEMBL
Match: H2MDQ1 (Exosome component 6 OS=Oryzias latipes OX=8090 GN=exosc6 PE=4 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 3.971e-24
Identity = 67/217 (30.88%), Postives = 113/217 (52.07%), Query Frame = -1
Query:   24 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDT-DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG-----------VXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSV 617
            +FV   + S A GS+++E G+TK++C+VY P E   +++       L+  +RFAPFS P R  ++  + D   +  +Q SL  A+    +  S+IE+ +MVL + G   +  ITCASLAL DA ++MYD+++G           V+          ++     ++VA LP+L Q++ L S     +AE          ++   K+Y V++  L K+V
Sbjct:   48 VFVRCGLVSQAKGSAYIEAGDTKLLCSVYGPRETERKDETDMKCGRLTTDMRFAPFSCPERGSWIQGSQDKNFSLMLQESLQPALCLHKYPRSQIEVNVMVLENSGSVQAHAITCASLALADAGIEMYDLVLGCSIRQDGSSYVVDPTYSEESNWSSSEHQGGLTVAFLPSLNQVSGLQSDGE--MAEETLTAGIRTCIEGCYKLYPVIQQALVKAV 262          
BLAST of SMED30014569 vs. Ensembl Cavefish
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:326786])

HSP 1 Score: 94.7449 bits (234), Expect = 7.084e-23
Identity = 46/133 (34.59%), Postives = 76/133 (57.14%), Query Frame = -1
Query:  243 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVT-------VRFAPFSQPSRLKYVNDTDTR-IAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG 617
            LF    + S A GSS++E G TK++C+VY P E    ++  V        +R APFS   R  ++  +  R ++  +  SL  A+    +  ++IE+ +MVL +DG   +  +TCAS+AL DA ++MYD+++G
Sbjct:   45 LFARCGLVSQAKGSSYLEAGNTKILCSVYGPREPERRDEAGVRSGRLLCDLRLAPFSCGKRGAWIQGSGERDLSLALSESLHPAVCLHRYPRAQIEVNVMVLENDGSVLAHAVTCASMALADAGIEMYDVVLG 177          
BLAST of SMED30014569 vs. Ensembl Cavefish
Match: exosc4 (exosome component 4 [Source:NCBI gene;Acc:103035194])

HSP 1 Score: 66.6254 bits (161), Expect = 7.667e-13
Identity = 39/132 (29.55%), Postives = 68/132 (51.52%), Query Frame = -1
Query:  255 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVR--------FAPFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYD 620
            KL     +F+ ADGS+++E G TK +  VY P E+R     ++  R         A FS   R +  + +   + ++  ++ +  +A+    +  S+I+IY+ +L  DG   SA +  A+LAL+DA + M D
Sbjct:   24 KLQARMGVFAQADGSAYLEQGNTKALAVVYGPHEVRGSRSRTLHDRAVINCQYSMATFSTAERKRRPHGDRKSSEMSLHLKQTFEAAVLTQLYPRSQIDIYVKILQSDGGNYSACVNAATLALVDAGIPMRD 155          
BLAST of SMED30014569 vs. Ensembl Cavefish
Match: exosc5 (exosome component 5 [Source:NCBI gene;Acc:103039313])

HSP 1 Score: 46.9802 bits (110), Expect = 5.056e-6
Identity = 35/130 (26.92%), Postives = 59/130 (45.38%), Query Frame = -1
Query:  240 IFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQP----------SRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 599
            + S  DGS+    G+T V+  VY P E++  +++          QP          +R + V +T        ++ LLS +    H  S + + L V++DDG   S  +  A +AL+DA + M  +  GV
Sbjct:   21 LLSKPDGSATFLQGDTSVLAGVYGPAEVKVNKEIYDRATLEVVVQPKVGMSSVRERAREQCVRET-------CEAVLLSTL----HPRSSLTLILQVVHDDGSLLSCCLNAACMALMDAGLPMGRLFCGV 139          
BLAST of SMED30014569 vs. Ensembl Sea Lamprey
Match: exosc4 (exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1702])

HSP 1 Score: 66.2402 bits (160), Expect = 2.012e-13
Identity = 38/132 (28.79%), Postives = 66/132 (50.00%), Query Frame = -1
Query:  255 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVR--------FAPFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYD 620
            K+     +F+ ADGS++VE G TK +  VY P E+R     ++  R         A FS   R +  + +     ++  ++ +  +AI    +  S+I+IY+ +L  DG    A +  A+LAL+DA + + D
Sbjct:   24 KIACRMGVFAQADGSAYVEQGNTKALAVVYGPHEMRGNRGKAMHDRALVNCQYSMATFSTGERKRRPHGDRKSIEMSMHLRQTFEAAIMTQQYPRSQIDIYVQILQSDGGNYCACVNAATLALVDAGIPLKD 155          
BLAST of SMED30014569 vs. Ensembl Yeast
Match: SKI6 (Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp41p (EXOSC4) [Source:SGD;Acc:S000003427])

HSP 1 Score: 62.003 bits (149), Expect = 4.384e-12
Identity = 40/127 (31.50%), Postives = 68/127 (53.54%), Query Frame = -1
Query:  240 ADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSA----INFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 587
            ADGSS++E G  K++  V  P E R + Q       L+V+V    FS+  R K  +  + R+ + +Q+SL+      +  + +  + I+I + VL  DG    ++I   +LALIDA + M+D + G+
Sbjct:   36 ADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLE-IQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGI 161          
BLAST of SMED30014569 vs. Ensembl Nematostella
Match: EDO46254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ94])

HSP 1 Score: 85.1149 bits (209), Expect = 7.388e-20
Identity = 44/130 (33.85%), Postives = 74/130 (56.92%), Query Frame = -1
Query:  249 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVR------FAPFSQPSRLKYVNDTDTRIAKF-VQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDIL 617
            +F+ + + S A GS+++E   TKV+C +Y P E    ++ S+  R      FAPFS   R K++ D + +   + V  +L  A+       ++++IY+ VL +DG A SA I CAS+AL  A ++M D++
Sbjct:   48 MFLRAGVVSQAKGSAYIEMKNTKVICAIYGPREAPRRQEFSMKGRLTCEFKFAPFSCIYRRKHIQDAEEKENSYLVVQALEPAVCLEKFPKAQVDIYITVLENDGSALSAGIICASVALAMAGIEMLDLV 177          
BLAST of SMED30014569 vs. Ensembl Nematostella
Match: EDO42491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1D9])

HSP 1 Score: 67.3958 bits (163), Expect = 1.782e-13
Identity = 42/131 (32.06%), Postives = 69/131 (52.67%), Query Frame = -1
Query:  255 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYV--NDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYD 620
            K+     + S ADGS+++E G TK + TVY P E++++ +       L+V    A FS   R K    +   T ++  V+ +  +AI  + +  S+I+IY+ VL  DG    A I   +LALI+A + + D
Sbjct:   24 KMVCKVGVLSQADGSAYIEMGNTKALATVYGPHEVQNKAKALHDRVLLNVQFGMATFSTGERKKKPRGDRKATELSMMVRRTFEAAILINLYPRSQIDIYVQVLQADGGNHVACINAVTLALINAGIPLKD 154          
BLAST of SMED30014569 vs. Ensembl Nematostella
Match: EDO43013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV7])

HSP 1 Score: 48.521 bits (114), Expect = 5.897e-7
Identity = 29/130 (22.31%), Postives = 62/130 (47.69%), Query Frame = -1
Query:  240 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQL----SVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 617
            +F    +   ADGSS    G+T+V+   Y P+E++  ++L    ++ V F P     ++     ++  +   +++S    +  + H  + + I + V+ + G   S  +  A LA++DA   M  ++ G+
Sbjct:   18 MFCEHGLLDKADGSSKFAQGDTQVMAAAYGPVEVKLNKELIDRATLEVIFRP-----KIGIPGCSEKLVEGIIRNSCEPIVLTALHPRASLTIVVQVVQNSGSLLSCAVNAACLAMMDAGFPMRCMMCGI 142          
BLAST of SMED30014569 vs. Ensembl Medaka
Match: exosc6 (exosome component 6 [Source:NCBI gene;Acc:101155271])

HSP 1 Score: 107.071 bits (266), Expect = 1.495e-27
Identity = 67/217 (30.88%), Postives = 113/217 (52.07%), Query Frame = -1
Query:   24 LFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQ-------LSVTVRFAPFSQPSRLKYVNDT-DTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIG-----------VXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSV 617
            +FV   + S A GS+++E G+TK++C+VY P E   +++       L+  +RFAPFS P R  ++  + D   +  +Q SL  A+    +  S+IE+ +MVL + G   +  ITCASLAL DA ++MYD+++G           V+          ++     ++VA LP+L Q++ L S     +AE          ++   K+Y V++  L K+V
Sbjct:   48 VFVRCGLVSQAKGSAYIEAGDTKLLCSVYGPRETERKDETDMKCGRLTTDMRFAPFSCPERGSWIQGSQDKNFSLMLQESLQPALCLHKYPRSQIEVNVMVLENSGSVQAHAITCASLALADAGIEMYDLVLGCSIRQDGSSYVVDPTYSEESNWSSSEHQGGLTVAFLPSLNQVSGLQSDGE--MAEETLTAGIRTCIEGCYKLYPVIQQALVKAV 262          
BLAST of SMED30014569 vs. Ensembl Medaka
Match: exosc4 (exosome component 4 [Source:NCBI gene;Acc:101170622])

HSP 1 Score: 64.3142 bits (155), Expect = 5.011e-12
Identity = 38/132 (28.79%), Postives = 67/132 (50.76%), Query Frame = -1
Query:  255 KLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVR--------FAPFSQPSRLK--YVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYD 620
            K+     +F+ ADGS+++E G TK +  VY P E+R     ++  R         A FS   R +  + +   T ++  ++ +  +A+    +  S+I+IY+ +L  DG   S  +  A+LA+IDA + M D
Sbjct:   24 KVQARMGVFAQADGSAYLEQGNTKALAVVYGPHEIRGARSRALHDRAIINCQYSMATFSTAERKRRPHGDRKSTEMSLHLKQTFEAAVLTQLYPRSQIDIYVKILQSDGGNYSVCVNAATLAVIDAGIPMRD 155          
BLAST of SMED30014569 vs. Ensembl Medaka
Match: exosc5 (exosome component 5 [Source:NCBI gene;Acc:101161262])

HSP 1 Score: 51.9878 bits (123), Expect = 7.461e-8
Identity = 33/124 (26.61%), Postives = 59/124 (47.58%), Query Frame = -1
Query:  240 VNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGV 611
               S+ S  DGS+    G+T V+  VY P E++  +++          QP ++   +  +    + V+ +   A+  + H  S + + L VL+DDG   S  +  A +AL+DA + M  +  GV
Sbjct:   16 CEQSLLSRPDGSASFVQGDTSVMAGVYGPAEVKVSKEIYDRATLEVLVQP-KVGLPSVRERSQEQCVRETCEEALLLTLHPRSSLTLVLQVLHDDGSLLSCCLNAACMALMDAGLPMSCLFCGV 138          
BLAST of SMED30014569 vs. Planmine SMEST
Match: SMESG000021079.1 (SMESG000021079.1)

HSP 1 Score: 430.254 bits (1105), Expect = 4.566e-155
Identity = 228/229 (99.56%), Postives = 228/229 (99.56%), Query Frame = -1
Query:   15 MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK 701
            MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVNINPRVNREE NNNRNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK
Sbjct:    1 MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVNINPRVNREEQNNNRNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK 229          
BLAST of SMED30014569 vs. Planmine SMEST
Match: SMESG000021079.1 (SMESG000021079.1)

HSP 1 Score: 414.075 bits (1063), Expect = 6.346e-149
Identity = 211/229 (92.14%), Postives = 212/229 (92.58%), Query Frame = -1
Query:   15 MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDILIGVXXXXXXXXXXXXXXXNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK 701
            MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDM +                NNNRNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK
Sbjct:    1 MHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADGSSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMEE---------------QNNNRNQSISVAVLPNLRQIANLMSTYRCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK 214          
BLAST of SMED30014569 vs. Planmine SMEST
Match: SMESG000040844.1 (SMESG000040844.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.342e-7
Identity = 35/125 (28.00%), Postives = 60/125 (48.00%), Query Frame = -1
Query:  249 SNADGSSFVEYGETKVVCTVYSPIELRSEEQLS-----VTVRF-----APFSQPSRLKYVNDTDTRIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALIDANVDMYDIL 593
            S  DG   +E G TKV+ ++Y P E R+  +       ++ ++     A F+   R    ++     A  V+S +   I    +  S+I+I ++VL  DG   + +I   SLAL+DA + M D +
Sbjct:   32 SGDDGYVCLEQGNTKVIASIYGPHECRNHSEAKHDVAIISCKYSKCPTANFNAGRRYGKRDNISDLNADCVKSIMEKVIELHWYGESQIDINILVLQSDGSELAVVINAVSLALMDAGIRMKDFV 156          
The following BLAST results are available for this feature:
BLAST of SMED30014569 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EXOSC41.132e-1229.10exosome component 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
EXOSC64.538e-929.45exosome component 6 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exos-4.12.408e-1131.15Putative exosome complex component RRP41 [Source:... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ski62.014e-1132.80gene:FBgn0032487 transcript:FBtr0334755[more]
Ski62.014e-1132.80gene:FBgn0032487 transcript:FBtr0080483[more]
Mtr34.428e-1025.95gene:FBgn0036916 transcript:FBtr0074918[more]
back to top
BLAST of SMED30014569 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exosc63.260e-2327.80exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc63.260e-2327.80exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc46.933e-1330.30exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
exosc57.208e-725.20exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
exosc57.208e-725.20exosome component 5 [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ttyh11.521e-1830.56tweety family member 1 [Source:Xenbase;Acc:XB-GENE... [more]
ENSXETT00000012729.15.051e-826.52pep primary_assembly:Xenopus_tropicalis_v9.1:1:636... [more]
EXOSC53.841e-625.41exosome component 5 [Source:NCBI gene;Acc:10017061... [more]
kdelr28.781e-625.00KDEL endoplasmic reticulum protein retention recep... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Exosc49.110e-1329.10exosome component 4 [Source:MGI Symbol;Acc:MGI:192... [more]
Exosc61.306e-1025.76exosome component 6 [Source:MGI Symbol;Acc:MGI:191... [more]
Exosc55.420e-626.92exosome component 5 [Source:MGI Symbol;Acc:MGI:107... [more]
Exosc55.420e-626.92exosome component 5 [Source:MGI Symbol;Acc:MGI:107... [more]
back to top
BLAST of SMED30014569 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0I8|EXOS6_DANRE2.461e-2227.80Exosome complex component MTR3 OS=Danio rerio OX=7... [more]
sp|Q28F19|EXOS6_XENTR8.059e-1830.56Exosome complex component MTR3 OS=Xenopus tropical... [more]
sp|O26779|RRP41_METTH2.417e-1728.57Exosome complex component Rrp41 OS=Methanothermoba... [more]
sp|A1RST0|RRP41_PYRIL9.370e-1736.09Exosome complex component Rrp41 OS=Pyrobaculum isl... [more]
sp|B1Y978|RRP41_PYRNV3.778e-1633.83Exosome complex component Rrp41 OS=Pyrobaculum neu... [more]
back to top
BLAST of SMED30014569 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9L4C51.063e-2528.89Exosome complex component MTR3 (Fragment) OS=Callo... [more]
H3CEF31.177e-2530.84Exosome component 6 OS=Tetraodon nigroviridis OX=9... [more]
A0A3P9J1Y92.140e-2431.34Exosome component 6 OS=Oryzias latipes OX=8090 PE=... [more]
A0A3P9L7873.971e-2430.88RNase_PH domain-containing protein OS=Oryzias lati... [more]
H2MDQ13.971e-2430.88Exosome component 6 OS=Oryzias latipes OX=8090 GN=... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc67.084e-2334.59exosome component 6 [Source:NCBI gene;Acc:326786][more]
exosc47.667e-1329.55exosome component 4 [Source:NCBI gene;Acc:10303519... [more]
exosc55.056e-626.92exosome component 5 [Source:NCBI gene;Acc:10303931... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
exosc42.012e-1328.79exosome component 4 [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SKI64.384e-1231.50Exosome non-catalytic core component; involved in ... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO462547.388e-2033.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424911.782e-1332.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430135.897e-722.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30014569 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exosc61.495e-2730.88exosome component 6 [Source:NCBI gene;Acc:10115527... [more]
exosc45.011e-1228.79exosome component 4 [Source:NCBI gene;Acc:10117062... [more]
exosc57.461e-826.61exosome component 5 [Source:NCBI gene;Acc:10116126... [more]
back to top
BLAST of SMED30014569 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000021079.14.566e-15599.56SMESG000021079.1[more]
SMESG000021079.16.346e-14992.14SMESG000021079.1[more]
SMESG000040844.11.342e-728.00SMESG000040844.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014569 ID=SMED30014569|Name=SMED30014569|organism=Schmidtea mediterranea sexual|type=transcript|length=728bp
TGAGAAAAATATTATTTTATTTCAACAGATTTCTTTAAATGGATTTTGAC
GACCTCGTACATTTTCAGCGCGTCCTTTAACGGGCCGTCCCACTGGAGTA
ATTCCTCATATTCCGCGAGGCCGCATCGATATGTCGACATGAGATTTGCA
ATTTGTCGTAAATTCGGCAAAACTGCAACTGATATCGATTGGTTTCTGTT
ATTATTTGGTTCTTCCCTATTAACACGTGGATTGATATTGACACCGATCA
ATATGTCATACATGTCAACATTAGCATCAATCAAGGCCAATGATGCACAT
GTAATCATCGCACTTGTTGCGTGACCGTCATCATTTAAAACCATTAAATA
AATTTCGATTTTTGAATGGGCATGATTAGAAAAATTAATAGCCGATAGCA
AAGAACTTTGAACAAATTTAGCGATTCGAGTATCTGTATCATTTACATAT
TTTAGACGAGATGGTTGAGAGAATGGTGCAAATCTAACAGTTACAGACAA
CTGCTCTTCTGATCGCAGCTCTATGGGACTATAAACAGTGCAAACAACTT
TAGTTTCACCATATTCAACAAAACTTGACCCATCAGCATTGGAAAATATT
GATGAATTAACAAATAATTTATCATCAGATTTCTTCACGTAGTGAAAATT
AGAAATAGATTCCAAATCTAATGTGTCTGAAGGTCCAAAATTTCTGTGCA
TTTTTAAAAATATTAACCAGACGCCCAT
back to top

protein sequence of SMED30014569-orf-1

>SMED30014569-orf-1 ID=SMED30014569-orf-1|Name=SMED30014569-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MGVWLIFLKMHRNFGPSDTLDLESISNFHYVKKSDDKLFVNSSIFSNADG
SSFVEYGETKVVCTVYSPIELRSEEQLSVTVRFAPFSQPSRLKYVNDTDT
RIAKFVQSSLLSAINFSNHAHSKIEIYLMVLNDDGHATSAMITCASLALI
DANVDMYDILIGVNINPRVNREEPNNNRNQSISVAVLPNLRQIANLMSTY
RCGLAEYEELLQWDGPLKDALKMYEVVKIHLKKSVEIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR027408PNPase/RNase_PH_dom_sf
IPR001247ExoRNase_PH_dom1
IPR020568Ribosomal_S5_D2-typ_fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001247Exoribonuclease, phosphorolytic domain 1PFAMPF01138RNase_PHcoord: 36..152
e-value: 3.4E-25
score: 89.1
IPR027408PNPase/RNase PH domain superfamilyGENE3DG3DSA:3.30.230.70coord: 10..231
e-value: 1.5E-37
score: 131.1
NoneNo IPR availablePANTHERPTHR11953:SF2EXOSOME COMPLEX COMPONENT MTR3coord: 35..210
NoneNo IPR availablePANTHERPTHR11953EXOSOME COMPLEX COMPONENTcoord: 35..210
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 36..162