Synaptotagmin-like 5

Overview
NameSynaptotagmin-like 5
Smed IDSMED30014567
Length (bp)1761
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-like 5 (SMED30014567) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-like 5 (SMED30014567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-like 5 (SMED30014567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-like 5 (SMED30014567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014567SMESG000010162.1 SmedASXL_013207SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30014567SMESG000010162.1 dd_Smed_v4_21069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014567SMESG000010162.1 dd_Smed_v6_21069_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
non-ciliated epidermisSMED30014567SMESG000010162.1 dd_Smed_v4_21069_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 124.405 bits (311), Expect = 3.924e-29
Identity = 85/242 (35.12%), Postives = 118/242 (48.76%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI-------------QNTKRRNSETISE---YETGKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL I + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  IP  +    N  + W  L+ K E  P I    QYKGE+ + L++I             Q  K        E      G L +FI+  K++   K+    +SFV+  +     +  K +T V+  + NP W+  ++
Sbjct:  428 VSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDI--GLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 666          

HSP 2 Score: 50.447 bits (119), Expect = 8.485e-6
Identity = 32/110 (29.09%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHS 1365
             +L++ I + +NL  A +   T++ ++K YLLPD S   K KT V K   +P +N    +  I    +    L +++W +E+   N+FLG        +RLN+     H 
Sbjct:  609 GILEVFIKEAKNLT-AVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLG-------GVRLNSGSGVSHG 710          
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 124.405 bits (311), Expect = 4.126e-29
Identity = 85/242 (35.12%), Postives = 118/242 (48.76%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI-------------QNTKRRNSETISE---YETGKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL I + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  IP  +    N  + W  L+ K E  P I    QYKGE+ + L++I             Q  K        E      G L +FI+  K++   K+    +SFV+  +     +  K +T V+  + NP W+  ++
Sbjct:  406 VSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDI--GLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 644          

HSP 2 Score: 50.447 bits (119), Expect = 8.327e-6
Identity = 32/110 (29.09%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHS 1365
             +L++ I + +NL  A +   T++ ++K YLLPD S   K KT V K   +P +N    +  I    +    L +++W +E+   N+FLG        +RLN+     H 
Sbjct:  587 GILEVFIKEAKNLT-AVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLG-------GVRLNSGSGVSHG 688          
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 123.635 bits (309), Expect = 6.099e-29
Identity = 74/237 (31.22%), Postives = 127/237 (53.59%), Query Frame = 1
Query:  976 FTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK------RRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            F N F+  G I   +++ Q    L + + +C  L  A+  +  +NPY+K YLLPDKS  GKRKTS+K++  +P+++E L Y+I  + L  RTL  SVWH      N FLGE  I + + +L+   +    L  K +      L  +KGE+++ L++I  +K      R+ S+     E G+L ++I+  K++   K     +SFV+  +  +  +  K++T V+  T NP ++  ++
Sbjct:  351 FGNIFVT-GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKG---GEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFV 583          

HSP 2 Score: 51.9878 bits (123), Expect = 2.727e-6
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDR-NSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L++ I + +NL  A +   T++ ++K YLLP ++   KRKT V K   +P +N    Y   R   L    L ++VW +E L  N FLG   + +     N     W    T E V     + QY G    G
Sbjct:  528 LQVWIKEAKNLTAA-KAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMD-STGEEVSLWQKMRQYPGSWAEG 656          
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 123.635 bits (309), Expect = 6.099e-29
Identity = 74/237 (31.22%), Postives = 127/237 (53.59%), Query Frame = 1
Query:  976 FTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK------RRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            F N F+  G I   +++ Q    L + + +C  L  A+  +  +NPY+K YLLPDKS  GKRKTS+K++  +P+++E L Y+I  + L  RTL  SVWH      N FLGE  I + + +L+   +    L  K +      L  +KGE+++ L++I  +K      R+ S+     E G+L ++I+  K++   K     +SFV+  +  +  +  K++T V+  T NP ++  ++
Sbjct:  351 FGNIFVT-GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKG---GEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFV 583          

HSP 2 Score: 51.9878 bits (123), Expect = 2.727e-6
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDR-NSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L++ I + +NL  A +   T++ ++K YLLP ++   KRKT V K   +P +N    Y   R   L    L ++VW +E L  N FLG   + +     N     W    T E V     + QY G    G
Sbjct:  528 LQVWIKEAKNLTAA-KAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMD-STGEEVSLWQKMRQYPGSWAEG 656          
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 123.635 bits (309), Expect = 6.099e-29
Identity = 74/237 (31.22%), Postives = 127/237 (53.59%), Query Frame = 1
Query:  976 FTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK------RRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            F N F+  G I   +++ Q    L + + +C  L  A+  +  +NPY+K YLLPDKS  GKRKTS+K++  +P+++E L Y+I  + L  RTL  SVWH      N FLGE  I + + +L+   +    L  K +      L  +KGE+++ L++I  +K      R+ S+     E G+L ++I+  K++   K     +SFV+  +  +  +  K++T V+  T NP ++  ++
Sbjct:  351 FGNIFVT-GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKG---GEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFV 583          

HSP 2 Score: 51.9878 bits (123), Expect = 2.727e-6
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDR-NSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L++ I + +NL  A +   T++ ++K YLLP ++   KRKT V K   +P +N    Y   R   L    L ++VW +E L  N FLG   + +     N     W    T E V     + QY G    G
Sbjct:  528 LQVWIKEAKNLTAA-KAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMD-STGEEVSLWQKMRQYPGSWAEG 656          
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 57.3806 bits (137), Expect = 8.784e-9
Identity = 41/151 (27.15%), Postives = 82/151 (54.30%), Query Frame = 1
Query: 1000 GEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQN 1452
            G +  K+++  + + L ++I++   L  A     T++PY+KL+LLPDK    K +T V++   +P+FNE  ++KI  N + G+TL ++V+  +    +  +G+ +IP+  + L    E    +   E+ P+        GE+ + L+++ N
Sbjct:   17 GRLQYKLDYDFDKNSLTVVIIQAEELP-AMDLGGTSDPYVKLFLLPDK--KKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLI---ESPPE-----NRLGEVCLALRYVPN 156          
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 57.3806 bits (137), Expect = 8.784e-9
Identity = 41/151 (27.15%), Postives = 82/151 (54.30%), Query Frame = 1
Query: 1000 GEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQN 1452
            G +  K+++  + + L ++I++   L  A     T++PY+KL+LLPDK    K +T V++   +P+FNE  ++KI  N + G+TL ++V+  +    +  +G+ +IP+  + L    E    +   E+ P+        GE+ + L+++ N
Sbjct:   17 GRLQYKLDYDFDKNSLTVVIIQAEELP-AMDLGGTSDPYVKLFLLPDK--KKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKVDLAATLERTDLI---ESPPE-----NRLGEVCLALRYVPN 156          
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 58.5362 bits (140), Expect = 1.216e-8
Identity = 37/127 (29.13%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1000 GEILLKIE--HIQNISLLKIMILKCRNLIIANRKENTT-NPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSL 1368
            G I  +IE   + +    ++ +   R   +  R + T  NPY+K++LLPD+S   +R+++V      P+++E   Y  +    L+ R L ++VW  +    N FLGET I + ++ L+      HSL
Sbjct:  838 GHIFGRIEVSFVYSHHDRQLSVALVRGFDLPPRSDGTPRNPYVKIFLLPDRSEKSRRQSAVIAETLMPVWDEVFYYNGLTEPMLLQRVLELTVWDYDKFGTNSFLGETLIDLASVPLDGE----HSL 960          
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Match: unc-10 (Rab-3-interacting molecule unc-10 [Source:UniProtKB/Swiss-Prot;Acc:Q22366])

HSP 1 Score: 58.151 bits (139), Expect = 1.807e-8
Identity = 37/127 (29.13%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1000 GEILLKIE--HIQNISLLKIMILKCRNLIIANRKENTT-NPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSL 1368
            G I  +IE   + +    ++ +   R   +  R + T  NPY+K++LLPD+S   +R+++V      P+++E   Y  +    L+ R L ++VW  +    N FLGET I + ++ L+      HSL
Sbjct:  838 GHIFGRIEVSFVYSHHDRQLSVALVRGFDLPPRSDGTPRNPYVKIFLLPDRSEKSRRQSAVIAETLMPVWDEVFYYNGLTEPMLLQRVLELTVWDYDKFGTNSFLGETLIDLASVPLDGE----HSL 960          
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Match: snt-4 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:P91493])

HSP 1 Score: 56.9954 bits (136), Expect = 1.943e-8
Identity = 52/231 (22.51%), Postives = 108/231 (46.75%), Query Frame = 1
Query:  997 QGEILLKIEHIQNISLLKIMILKCRNL---IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELS-YKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKE--AVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIG--DEKNIPNSFVRCTI-KHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +G I   + +  +   L + I+ CRNL   +++   +   +PY+KL LLP++    + KT + ++ TSP++ E+ + Y +    +   TL+  V   +    +  +GE    +Y  RL +A+   H+    E   +P+       +GE+L+ L +             +     L + +   + +G  ++    + FV+  + K  G ++ KK T V  +T NP+++E ++
Sbjct:  112 RGNISFTLSYDSHTLTLLVSIINCRNLCEMVVSRDGQCLLDPYVKLQLLPER--EHRVKTRIVRSTTSPVYEEQFAMYGVTHEQVNFATLHFQVVAFDRYSRDTVVGEC---VY--RLADAELQVHNEMRVELPLLPRATDTVAARGELLLSLTY-------------QAAFNNLTVVVLKARGLGGRNDAGTADPFVKLYLRKESGERIVKKRTHVRRSTLNPVYNESFV 322          
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334289)

HSP 1 Score: 122.865 bits (307), Expect = 3.978e-29
Identity = 73/254 (28.74%), Postives = 138/254 (54.33%), Query Frame = 1
Query:  991 IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI--QNTK-----RRNSETISE--------------------YETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +V+G++   +++   +S L++ +++C++L   + K N ++PY+K+YLLPDKS  GKRKT VKK+  +PIF+E + +    +SL  RTL ++VWH +    N FLGE ++ +     +N Q  W+ L+ + E   ++ +   Y+G+I++GL++I  +N K     R +S T S                      + G+L++ ++  KH+   K     ++F +  +     +  K++T VV  T +P W+  ++
Sbjct:  261 VVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVAT---YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFV 511          

HSP 2 Score: 51.6026 bits (122), Expect = 1.802e-6
Identity = 40/138 (28.99%), Postives = 62/138 (44.93%), Query Frame = 1
Query: 1006 ILLKIEHIQNISLLKIMILKCRNL--IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQ 1410
            +  K E       L +++ + ++L  I AN    T + + K YLLPD++ + K+KT V K    P +N    Y+ +    L  R L ++VW  + L  N F+G     +   R    Q  W     KE     LSL+Q
Sbjct:  443 VASKSERTSKGGQLHVLVKEAKHLSPIKAN---GTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKE-----LSLWQ 572          
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334288)

HSP 1 Score: 123.25 bits (308), Expect = 4.605e-29
Identity = 71/254 (27.95%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  991 IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI--QNTK-----------------RRNSETISEYET--------GKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +V+G++   +++   +S L++ +++C++L   + K N ++PY+K+YLLPDKS  GKRKT VKK+  +PIF+E + +    +SL  RTL ++VWH +    N FLGE ++ +     +N Q  W+ L+ + E   ++ +   Y+G+I++GL++I  +N K                 R+   +I    +        G+L++ ++  KH+   K     ++F +  +     +  K++T VV  T +P W+  ++
Sbjct:  369 VVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVAT---YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFV 619          

HSP 2 Score: 51.6026 bits (122), Expect = 1.883e-6
Identity = 40/138 (28.99%), Postives = 62/138 (44.93%), Query Frame = 1
Query: 1006 ILLKIEHIQNISLLKIMILKCRNL--IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQ 1410
            +  K E       L +++ + ++L  I AN    T + + K YLLPD++ + K+KT V K    P +N    Y+ +    L  R L ++VW  + L  N F+G     +   R    Q  W     KE     LSL+Q
Sbjct:  551 VASKSERTSKGGQLHVLVKEAKHLSPIKAN---GTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKE-----LSLWQ 680          
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334291)

HSP 1 Score: 122.094 bits (305), Expect = 1.722e-28
Identity = 73/254 (28.74%), Postives = 138/254 (54.33%), Query Frame = 1
Query:  991 IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI--QNTK-----RRNSETISE--------------------YETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +V+G++   +++   +S L++ +++C++L   + K N ++PY+K+YLLPDKS  GKRKT VKK+  +PIF+E + +    +SL  RTL ++VWH +    N FLGE ++ +     +N Q  W+ L+ + E   ++ +   Y+G+I++GL++I  +N K     R +S T S                      + G+L++ ++  KH+   K     ++F +  +     +  K++T VV  T +P W+  ++
Sbjct:  798 VVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVAT---YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFV 1048          

HSP 2 Score: 50.8322 bits (120), Expect = 4.015e-6
Identity = 40/138 (28.99%), Postives = 62/138 (44.93%), Query Frame = 1
Query: 1006 ILLKIEHIQNISLLKIMILKCRNL--IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQ 1410
            +  K E       L +++ + ++L  I AN    T + + K YLLPD++ + K+KT V K    P +N    Y+ +    L  R L ++VW  + L  N F+G     +   R    Q  W     KE     LSL+Q
Sbjct:  980 VASKSERTSKGGQLHVLVKEAKHLSPIKAN---GTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKE-----LSLWQ 1109          
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334285)

HSP 1 Score: 121.709 bits (304), Expect = 1.965e-28
Identity = 73/254 (28.74%), Postives = 138/254 (54.33%), Query Frame = 1
Query:  991 IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI--QNTK-----RRNSETISE--------------------YETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +V+G++   +++   +S L++ +++C++L   + K N ++PY+K+YLLPDKS  GKRKT VKK+  +PIF+E + +    +SL  RTL ++VWH +    N FLGE ++ +     +N Q  W+ L+ + E   ++ +   Y+G+I++GL++I  +N K     R +S T S                      + G+L++ ++  KH+   K     ++F +  +     +  K++T VV  T +P W+  ++
Sbjct:  763 VVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVAT---YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFV 1013          

HSP 2 Score: 50.8322 bits (120), Expect = 3.956e-6
Identity = 40/138 (28.99%), Postives = 62/138 (44.93%), Query Frame = 1
Query: 1006 ILLKIEHIQNISLLKIMILKCRNL--IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQ 1410
            +  K E       L +++ + ++L  I AN    T + + K YLLPD++ + K+KT V K    P +N    Y+ +    L  R L ++VW  + L  N F+G     +   R    Q  W     KE     LSL+Q
Sbjct:  945 VASKSERTSKGGQLHVLVKEAKHLSPIKAN---GTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKE-----LSLWQ 1074          
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334287)

HSP 1 Score: 115.931 bits (289), Expect = 1.845e-26
Identity = 69/254 (27.17%), Postives = 135/254 (53.15%), Query Frame = 1
Query:  991 IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFIQ---------------------------NTKRRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            +V+G++   +++   +S L++ +++C++L   + K N ++PY+K+YLLPDKS  GKRKT VKK+  +PIF+E + +    +SL  RTL ++VWH +    N FLGE ++ +     +N Q  W+ L+ + E   ++ +   Y+G+I++GL++I                            + K   S++    + G+L++ ++  KH+   K     ++F +  +     +  K++T VV  T +P W+  ++
Sbjct: 1178 VVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVAT---YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFV 1428          
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 124.405 bits (311), Expect = 1.193e-30
Identity = 74/239 (30.96%), Postives = 120/239 (50.21%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK----------------RRNSETISEYETGKLNIFIQSGKHIGDEK-NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            V GEILL I +      L +++ +CR L   + +   T+ Y+K YLLPDKS   KRKTS+K N T+P+FNE L Y +  + L  RTL VSVWH +    N FLGET +   +   +   E W +L+ +     + S+  YKGE+ + L++I   +                +   +TI+  + G + + ++  K++   K    + FV+  +     +  K +T VV  + NP W+  +
Sbjct:   43 VSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYVVSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKYIPAERNVSLPLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNLTAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTF 281          

HSP 2 Score: 55.8398 bits (133), Expect = 7.868e-8
Identity = 34/134 (25.37%), Postives = 62/134 (46.27%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI-----------YNIRLNNAQECWHSLKTKEAVPQILSL 1404
             ++++++ + +NL     K  +++P++K YLLPD   + K KT+V K   +P +N   +Y  +  + L    L ++VW +E    N+FLG   +             +N      Q  W  +     VPQ  +L
Sbjct:  226 GMVELLVKEAKNLTAV--KGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDREPFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTL 357          
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 125.946 bits (315), Expect = 7.033e-30
Identity = 74/239 (30.96%), Postives = 120/239 (50.21%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK----------------RRNSETISEYETGKLNIFIQSGKHIGDEK-NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            V GEILL I +      L +++ +CR L   + +   T+ Y+K YLLPDKS   KRKTS+K N T+P+FNE L Y +  + L  RTL VSVWH +    N FLGET +   +   +   E W +L+ +     + S+  YKGE+ + L++I   +                +   +TI+  + G + + ++  K++   K    + FV+  +     +  K +T VV  + NP W+  +
Sbjct:  344 VSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYVVSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKYIPAERNVSLPLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNLTAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTF 582          

HSP 2 Score: 55.4546 bits (132), Expect = 1.318e-7
Identity = 34/134 (25.37%), Postives = 62/134 (46.27%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI-----------YNIRLNNAQECWHSLKTKEAVPQILSL 1404
             ++++++ + +NL     K  +++P++K YLLPD   + K KT+V K   +P +N   +Y  +  + L    L ++VW +E    N+FLG   +             +N      Q  W  +     VPQ  +L
Sbjct:  527 GMVELLVKEAKNLTAV--KGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDREPFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTL 658          

HSP 3 Score: 54.6842 bits (130), Expect = 2.888e-7
Identity = 30/108 (27.78%), Postives = 49/108 (45.37%), Query Frame = 1
Query:   94 NEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLE 417
            +E + ++ VL K+E + +RE KR++ L+ EL   ++  R        C+IC     +     N+C  CQ  +C  C            C +C K    +V +G W LE
Sbjct:   18 HERQMILNVLQKDEKLRKREEKRIRKLKNELLELKRAGRRSSADQRECAICLRALGLILQRGNVCSNCQRRICNFCTATPTGSSCK--CTVCAKTAELKVVTGEWFLE 123          
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Match: si:ch211-266g18.6 (si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121-599])

HSP 1 Score: 119.398 bits (298), Expect = 1.081e-27
Identity = 67/224 (29.91%), Postives = 126/224 (56.25%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEK-NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            VQG +   + +   +  L IMI +C++L IAN ++  T+PY+K YL PDKS   KRKT++KK   +P+F E L YK++R  L  ++LN+SVWH +S   N+FLG+  +        +    W++L+ K +  +     +  G + + L+++ +     S++     TG+++++++  K +   K    +SFV+C I     +  +++T+VV  T +P+++   +
Sbjct:  524 VQGSVEFAVMY-SPVGELIIMIEQCQDLAIANPRKQRTDPYVKTYLYPDKSRRSKRKTTIKKRTVNPVFVESLRYKVNREELPEKSLNLSVWHNDSRGRNVFLGQVELSFRTWDWGHEALTWYNLQPKTS--ENAETKESNGLLSVSLKYVPSASTGGSKS----STGEIHVWLREAKELRRLKPQGVDSFVKCYILPDTRKKSRQKTRVVKKTQDPVYNHAMV 740          
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Match: sytl1 (synaptotagmin-like 1 [Source:ZFIN;Acc:ZDB-GENE-060503-439])

HSP 1 Score: 117.472 bits (293), Expect = 1.839e-27
Identity = 66/232 (28.45%), Postives = 133/232 (57.33%), Query Frame = 1
Query:  982 NDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQ-ILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIG---DEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
             D +V G I   +++      L + I++C++L  A+ ++N ++PY+K+YLLPD +   K+KT+V++   +P+++E ++YK+ R  L  R L++SVWH E ++ NLFLGE  + +     +  Q  W +L+ + +  P+ I+S    +G IL  ++F+       SE      TG+L+I+++  + +G    ++  PN++V+  +      V  ++T+VV  + +P+++   +
Sbjct:  237 GDVVVSGRIQFSLQYDVRTEELYVHIIRCQDL--ASARKNRSDPYVKVYLLPDNTSRSKKKTAVRRKTLNPVYDETMTYKVRRLDLPARVLSMSVWHMERMRRNLFLGELEVRLGQWDWSQNQPTWQNLQPRVQLSPEAIIS----RGTILFSIKFVPP----GSEGRGNPATGELHIWLR--EIVGLLPTKRGAPNTYVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMV 456          
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 114.005 bits (284), Expect = 1.884e-27
Identity = 66/222 (29.73%), Postives = 119/222 (53.60%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYE--TGKLNIFIQSGKHIGDEKNIP-NSFVRCTIKHIGIQVGKKETKVVSNTTNPIWD 1650
            V+G +   I ++Q +    I +++C++L +A+ K N ++PY+K YLLPDK+  GK+KT V+K    P +NE L +KI    L  + LN+SVWH ++   N FLGE  + +     NN Q   + LK + +            EI + L+F+  T      T+S      G++ I+++  K++   + +  + FV+C I     +  +++T+V+    NP+++
Sbjct:   30 VKGTVQFAIHYVQKLGEFHIFVVQCKDLAVADVKRNRSDPYVKCYLLPDKAKYGKKKTCVRKKTLDPTYNEILRFKIPMEMLKTQKLNISVWHNDTFGRNSFLGEVEVDLAEWDFNNTQMNEYLLKGRVS-----------AEIKVALRFLPQT------TLSHKNKGNGEVQIWVKECKNLPISRGVAIDPFVKCAILPENNRKSRQKTRVLKRAPNPVFN 234          
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 137.117 bits (344), Expect = 3.042e-34
Identity = 85/241 (35.27%), Postives = 126/241 (52.28%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRN-----SETISEYETGKLNIFIQSGKHIGDEKNIPNS--FVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYLQRYRQTQPRRN 1695
            + GEILL I +      L +++  CRNL +A+ K+N T+PY+K YLLPDKS   KRKT +K N T P FNE L Y I    L  RTL ++VWH +    N FLGE +IP+ +    N ++    L+ K  +   ++L QYKGEI +GL++I   K           +     G + + I++ K++   K+  +S  FV+  +     +  K +T VV  T NP W+  +     QT    N
Sbjct:  161 ITGEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPKMDLASDVTL-QYKGEITVGLRYITPEKNLTLPLDKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSN 400          

HSP 2 Score: 51.6026 bits (122), Expect = 2.707e-6
Identity = 28/90 (31.11%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
             L++++I   +NL  A +   +++ ++K YLLPD + + K KT V K   +P +N   ++  +  + L    + ++VW +ESL  N+FLG
Sbjct:  332 GLVEVLIKNAKNLT-AMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKESLTSNVFLG 420          
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 138.272 bits (347), Expect = 1.092e-33
Identity = 88/247 (35.63%), Postives = 130/247 (52.63%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKR------RNSETISEYETGKLNIFIQSGK----HIGDEKNI--------PNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYLQRYRQT 1680
            + GEILL I +      L +++  CRNL +A+ K+N T+PY+K YLLPDKS   KRKT +K N T P FNE L Y I    L  RTL ++VWH +    N FLGE +IP+ +    N ++    L+ K  +   ++L QYKGEI +GL++I   K       + +E  S  ++ K N+ + SG      I + KN+         ++FV+  +     +  K +T VV  T NP W+  +     QT
Sbjct:  462 ITGEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPKMDLASDVTL-QYKGEITVGLRYITPEKNLTLPLDKVAEKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQT 707          

HSP 2 Score: 51.6026 bits (122), Expect = 3.835e-6
Identity = 28/90 (31.11%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
             L++++I   +NL  A +   +++ ++K YLLPD + + K KT V K   +P +N   ++  +  + L    + ++VW +ESL  N+FLG
Sbjct:  644 GLVEVLIKNAKNLT-AMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKESLTSNVFLG 732          
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Match: SYTL4 (synaptotagmin like 4 [Source:NCBI gene;Acc:100495134])

HSP 1 Score: 137.117 bits (344), Expect = 1.229e-33
Identity = 79/231 (34.20%), Postives = 132/231 (57.14%), Query Frame = 1
Query:  982 NDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEY--ETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
             + I+ GEI+  I +   + LL I++ +CRNL   +  +  +NPYIK YLLPDKS  GKRKT++K+N T+P++NE L Y +  + L  R+L +SVWH +    N FLG+ +IP+ +   ++  E    L  K  +      Y  KGE+++ L+++  TK   SE   +   E G+L+++I+  K++   K   I +SFV+  +     +  K++T VV  T NP ++  ++
Sbjct:  310 GNVIITGEIIFSINYDAKVQLLNILVKECRNLAYGDELKMRSNPYIKSYLLPDKSRQGKRKTTIKRNTTNPMYNEVLKYIVPESMLHLRSLELSVWHYDRFGRNTFLGQVDIPLDSWNFDSLIEECLPLHGKGNMDSGAGFYNSKGELVVSLKYVPPTKPSGSERRKKKADEGGELHVWIKEAKNLTAVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFV 540          

HSP 2 Score: 52.373 bits (124), Expect = 1.983e-6
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L + I + +NL  A +    ++ ++K YL P K+ N KRKT V K   +P +N    Y  I    L    L ++VW +E L  N FLG   + I N   N     W    T E +     + QY G    G
Sbjct:  485 LHVWIKEAKNLT-AVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFVYNGIKPEDLQNVCLELTVWDREPLSSNDFLGGVRLGIGNGMSNGELVDWMD-STGEELSLWQKMRQYPGSWAEG 613          
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Match: SYTL4 (synaptotagmin like 4 [Source:NCBI gene;Acc:100495134])

HSP 1 Score: 136.732 bits (343), Expect = 1.697e-33
Identity = 79/231 (34.20%), Postives = 132/231 (57.14%), Query Frame = 1
Query:  982 NDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEY--ETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
             + I+ GEI+  I +   + LL I++ +CRNL   +  +  +NPYIK YLLPDKS  GKRKT++K+N T+P++NE L Y +  + L  R+L +SVWH +    N FLG+ +IP+ +   ++  E    L  K  +      Y  KGE+++ L+++  TK   SE   +   E G+L+++I+  K++   K   I +SFV+  +     +  K++T VV  T NP ++  ++
Sbjct:  287 GNVIITGEIIFSINYDAKVQLLNILVKECRNLAYGDELKMRSNPYIKSYLLPDKSRQGKRKTTIKRNTTNPMYNEVLKYIVPESMLHLRSLELSVWHYDRFGRNTFLGQVDIPLDSWNFDSLIEECLPLHGKGNMDSGAGFYNSKGELVVSLKYVPPTKPSGSERRKKKADEGGELHVWIKEAKNLTAVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFV 517          

HSP 2 Score: 51.2174 bits (121), Expect = 3.755e-6
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L + I + +NL  A +    ++ ++K YL P K+ N KRKT V K   +P +N    Y  I    L    L ++VW +E L  N FLG   + I N   N     W    T E +     + QY G    G
Sbjct:  462 LHVWIKEAKNLT-AVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFVYNGIKPEDLQNVCLELTVWDREPLSSNDFLGGVRLGIGNGMSNGELVDWMD-STGEELSLWQKMRQYPGSWAEG 590          
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Match: SYTL4 (synaptotagmin like 4 [Source:NCBI gene;Acc:100495134])

HSP 1 Score: 137.117 bits (344), Expect = 2.072e-33
Identity = 79/231 (34.20%), Postives = 132/231 (57.14%), Query Frame = 1
Query:  982 NDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEY--ETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
             + I+ GEI+  I +   + LL I++ +CRNL   +  +  +NPYIK YLLPDKS  GKRKT++K+N T+P++NE L Y +  + L  R+L +SVWH +    N FLG+ +IP+ +   ++  E    L  K  +      Y  KGE+++ L+++  TK   SE   +   E G+L+++I+  K++   K   I +SFV+  +     +  K++T VV  T NP ++  ++
Sbjct:  377 GNVIITGEIIFSINYDAKVQLLNILVKECRNLAYGDELKMRSNPYIKSYLLPDKSRQGKRKTTIKRNTTNPMYNEVLKYIVPESMLHLRSLELSVWHYDRFGRNTFLGQVDIPLDSWNFDSLIEECLPLHGKGNMDSGAGFYNSKGELVVSLKYVPPTKPSGSERRKKKADEGGELHVWIKEAKNLTAVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFV 607          

HSP 2 Score: 51.6026 bits (122), Expect = 3.916e-6
Identity = 41/131 (31.30%), Postives = 58/131 (44.27%), Query Frame = 1
Query: 1045 LKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIG 1434
            L + I + +NL  A +    ++ ++K YL P K+ N KRKT V K   +P +N    Y  I    L    L ++VW +E L  N FLG   + I N   N     W    T E +     + QY G    G
Sbjct:  552 LHVWIKEAKNLT-AVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFVYNGIKPEDLQNVCLELTVWDREPLSSNDFLGGVRLGIGNGMSNGELVDWMD-STGEELSLWQKMRQYPGSWAEG 680          
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 141.354 bits (355), Expect = 3.379e-35
Identity = 143/567 (25.22%), Postives = 237/567 (41.80%), Query Frame = 1
Query:   88 SFNEIKK--LMVVLNKNEDIERRESKRVKMLERELNFFR---KIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKE---IERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQSLPNSERLRKKQKELVIN------------------EENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI--YNIRLNNAQEC-WHSLKTK-----EAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIP-------NSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            SF E+++  ++ VL +++ ++  E +RV+ L+  L   R         E K   C+ C     +  N   +CQ C + VC  C VF++  +  + C +C+++   ++K+G W  E            ER +K P   +      +LLQ     SK +            + +  +   E     G+   F K    SV+NL  S +     ++ L  S+ND      +     R      Q + ++ER  + Q +  +N                  +  H  D +  Q  P    P+ +  F    R  +    +   +E    D   V GEI   I +      L+I I  C+NL     K+   NPY+K YLLPD+S  GKRKT V+KN   P F E L Y++D   L+ R L VSVWH  +L   +FLGE  +P+  ++ + + AQ   W+ L+ K     E +P      Q  GE+ +  + +     R  +   E + G+L +  Q    +   KN+P       NSFV+  +     Q  + ++ V+     P W   ++
Sbjct:    9 SFKELERDIILRVLYRDQTVQSTEEERVRKLKSHLQHLRWKGAKSSSQEYKEKCCARCQRALGLLLNRGAVCQGCSHRVCSECRVFLRRTRAWK-CTVCFEDRNVKIKTGEWFFE------------ERARKFPTAGRRETAGAKLLQSYQRLSKISVVPPTPPPFSESQCSSSSRLQE----LGHFRGFNK----SVENLFLSVTTQ---MRKLSKSQNDMTSEKHLLAMDPR------QCVGHTER--RSQSDTAVNVTSRKASTPDILKAFHQEDPKHPPDPVLKQDTPPSS-PTHSAVFSGGLRHGSLISINSTCTEMGNFDNANVTGEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARRVFLGEVILPLAMWDFKDSTAQNARWYPLRAKAEKYEENIP------QNNGELAVRAKLVLPAGPRKPQ---EAQEGQLALNGQLCLVVLGAKNLPVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQWKHSFV 533          
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 120.939 bits (302), Expect = 3.245e-28
Identity = 83/241 (34.44%), Postives = 122/241 (50.62%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFI-----------QNTKRRNSETISEYET-----GKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL   + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  I   +    N  + W  L+ K  +   +SL QYKGE+ I L++I           Q  +++  +   + E+     G L +FI+  K++   K+    +SFV+  +     +  K +T VV  + NP W+  ++
Sbjct:  407 VTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDISL-QYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFI 645          
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 120.939 bits (302), Expect = 3.246e-28
Identity = 84/241 (34.85%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFI----------------QNTKRRNSETISEYETGKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL   + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  I   +    N  + W  L+ K  +   +SL QYKGE+ I L++I                +  KR   +  S    G L +FI+  K++   K+    +SFV+  +     +  K +T VV  + NP W+  ++
Sbjct:  429 VTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDISL-QYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFI 667          
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Match: Sytl2 (synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:1933366])

HSP 1 Score: 121.324 bits (303), Expect = 3.580e-28
Identity = 77/243 (31.69%), Postives = 135/243 (55.56%), Query Frame = 1
Query:  976 FTNDFI---VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLN---NAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQS--------GKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            ++ DF    V+G +   +++++++  L + + +C++L  A+ K+  ++PY+K YLLPDK   GK+KT V K   +P++NE L YKI+R  L  + LN+SVWH+++ K N FLGE  + +     +   N Q  W+ LK K A P  L   + +GE+ + LQ++       S       TG+++I+++         G H+       NSFV+CTI     +  +++T+ V  TTNP+++   +
Sbjct:  635 YSGDFGNLEVKGSVQFALDYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKTYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIERQFLKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDSKQNKQLKWYPLKRKTA-PVALET-ENRGEMKLALQYVPEP----SPGKKLPTTGEVHIWVKECLDLPLLRGSHL-------NSFVKCTILPDTSRKSRQKTRAVGKTTNPVFNHTMV 864          
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Match: Sytl2 (synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:1933366])

HSP 1 Score: 121.324 bits (303), Expect = 3.854e-28
Identity = 77/243 (31.69%), Postives = 135/243 (55.56%), Query Frame = 1
Query:  976 FTNDFI---VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLN---NAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQS--------GKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            ++ DF    V+G +   +++++++  L + + +C++L  A+ K+  ++PY+K YLLPDK   GK+KT V K   +P++NE L YKI+R  L  + LN+SVWH+++ K N FLGE  + +     +   N Q  W+ LK K A P  L   + +GE+ + LQ++       S       TG+++I+++         G H+       NSFV+CTI     +  +++T+ V  TTNP+++   +
Sbjct:  608 YSGDFGNLEVKGSVQFALDYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKTYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIERQFLKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDSKQNKQLKWYPLKRKTA-PVALET-ENRGEMKLALQYVPEP----SPGKKLPTTGEVHIWVKECLDLPLLRGSHL-------NSFVKCTILPDTSRKSRQKTRAVGKTTNPVFNHTMV 837          
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Match: sp|Q99N48|SYTL3_MOUSE (Synaptotagmin-like protein 3 OS=Mus musculus OX=10090 GN=Sytl3 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 2.364e-34
Identity = 143/567 (25.22%), Postives = 237/567 (41.80%), Query Frame = 1
Query:   88 SFNEIKK--LMVVLNKNEDIERRESKRVKMLERELNFFR---KIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKE---IERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQSLPNSERLRKKQKELVIN------------------EENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI--YNIRLNNAQEC-WHSLKTK-----EAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIP-------NSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            SF E+++  ++ VL +++ ++  E +RV+ L+  L   R         E K   C+ C     +  N   +CQ C + VC  C VF++  +  + C +C+++   ++K+G W  E            ER +K P   +      +LLQ     SK +            + +  +   E     G+   F K    SV+NL  S +     ++ L  S+ND      +     R      Q + ++ER  + Q +  +N                  +  H  D +  Q  P    P+ +  F    R  +    +   +E    D   V GEI   I +      L+I I  C+NL     K+   NPY+K YLLPD+S  GKRKT V+KN   P F E L Y++D   L+ R L VSVWH  +L   +FLGE  +P+  ++ + + AQ   W+ L+ K     E +P      Q  GE+ +  + +     R  +   E + G+L +  Q    +   KN+P       NSFV+  +     Q  + ++ V+     P W   ++
Sbjct:    9 SFKELERDIILRVLYRDQTVQSTEEERVRKLKSHLQHLRWKGAKSSSQEYKEKCCARCQRALGLLLNRGAVCQGCSHRVCSECRVFLRRTRAWK-CTVCFEDRNVKIKTGEWFFE------------ERARKFPTAGRRETAGAKLLQSYQRLSKISVVPPTPPPFSESQCSSSSRLQE----LGHFRGFNK----SVENLFLSVTTQ---MRKLSKSQNDMTSEKHLLAMDPR------QCVGHTER--RSQSDTAVNVTSRKASTPDILKAFHQEDPKHPPDPVLKQDTPPSS-PTHSAVFSGGLRHGSLISINSTCTEMGNFDNANVTGEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARRVFLGEVILPLAMWDFKDSTAQNARWYPLRAKAEKYEENIP------QNNGELAVRAKLVLPAGPRKPQ---EAQEGQLALNGQLCLVVLGAKNLPVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQWKHSFV 533          
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Match: sp|Q8TDW5|SYTL5_HUMAN (Synaptotagmin-like protein 5 OS=Homo sapiens OX=9606 GN=SYTL5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.982e-28
Identity = 85/242 (35.12%), Postives = 118/242 (48.76%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK-EAVPQILSLYQYKGEILIGLQFI-------------QNTKRRNSETISE---YETGKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL I + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  IP  +    N  + W  L+ K E  P I    QYKGE+ + L++I             Q  K        E      G L +FI+  K++   K+    +SFV+  +     +  K +T V+  + NP W+  ++
Sbjct:  406 VSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDI--GLQYKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFM 644          
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Match: sp|Q96C24|SYTL4_HUMAN (Synaptotagmin-like protein 4 OS=Homo sapiens OX=9606 GN=SYTL4 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 2.929e-28
Identity = 74/237 (31.22%), Postives = 127/237 (53.59%), Query Frame = 1
Query:  976 FTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTK------RRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            F N F+  G I   +++ Q    L + + +C  L  A+  +  +NPY+K YLLPDKS  GKRKTS+K++  +P+++E L Y+I  + L  RTL  SVWH      N FLGE  I + + +L+   +    L  K +      L  +KGE+++ L++I  +K      R+ S+     E G+L ++I+  K++   K     +SFV+  +  +  +  K++T V+  T NP ++  ++
Sbjct:  351 FGNIFVT-GRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKG---GEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFV 583          
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Match: sp|Q812E4|SYTL5_RAT (Synaptotagmin-like protein 5 OS=Rattus norvegicus OX=10116 GN=Sytl5 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.307e-28
Identity = 85/241 (35.27%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFI-------------QNTKRRNSETISEYET---GKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL I + K+  T+ Y+K YLLPDK+ N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  I   +    N  + W  L+ K  +   +SL QYKGE+ I L++I             Q  K        E      G L +FI+  K++   K     +SFV+  +     +  K +T VV  + NP W+ V++
Sbjct:  429 VTGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKTRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDISL-QYKGELTIVLRYIPPEENLIFPVEQPQGKKIFKKGKKKESPAISGGILEVFIKEAKNLTAVKAGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPQWNHVFI 667          
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Match: sp|Q80T23|SYTL5_MOUSE (Synaptotagmin-like protein 5 OS=Mus musculus OX=10090 GN=Sytl5 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.314e-27
Identity = 83/241 (34.44%), Postives = 122/241 (50.62%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFI-----------QNTKRRNSETISEYET-----GKLNIFIQSGKHIGDEKN--IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V GEILL I +      L I +  CRNL   + K+  T+ Y+K YLLPDKS N KRKT ++   T+P FNE L Y I    L  RTL +SVWH +    N FLGE  I   +    N  + W  L+ K  +   +SL QYKGE+ I L++I           Q  +++  +   + E+     G L +FI+  K++   K+    +SFV+  +     +  K +T VV  + NP W+  ++
Sbjct:  429 VTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTG-TNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDISL-QYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFI 667          
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Match: W6V7E2 (Synaptotagmin-like protein 4 OS=Echinococcus granulosus OX=6210 GN=EGR_02832 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 4.288e-45
Identity = 138/545 (25.32%), Postives = 257/545 (47.16%), Query Frame = 1
Query:   97 EIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIE-IKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMV-FIKSPKVMQLCKLCYKEWLKQVKSGNWL---LEIAKETDRQISVLERNQ-KLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVD-----NLSKSYSASSGPLKALINSKNDSEILSDI--GCCQERPLSRNSQSLPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPS-DNERFLKLARXXXXXXXXXXXXEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHI---------GDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            E++ L  V  + + ++R+E +R+K +  +     K  R +      HC++C + F+  FNP ++C  C+  VC NC+   + S  V  LC+ C+ E   + ++G W    L++AK+  R I V   +  +  +I+K  E+     V                     +   +  P   +G++ D VK  +  +      + S S + S  P + L  +    ++  ++      E P     ++LP   R++ +Q       ++ +     + +    DV + DN   L      + +       E FT+  ++ GE+   I++      L+I + + R++  A++K N+++ Y+K YLLPDK+   KRK+ VKKN T+P+FNE L Y I ++ L  RTL +S+WH   +K NLFLGE  +P+ + R ++ Q  W +L+ + ++         KG I +GL+F+  T         + + G+L +++++   +          D+KN  N  V+  +     +  +++TKVV  T NP W+E  +
Sbjct:   71 ELEHLADVCRRYDMLQRQEDERIKNIREKAISKEKARRGVSRYDEAHCALCGAAFMALFNPKSLCHHCELYVCRNCVQKRLDSESV--LCRACFSECTNKARTGLWFTEKLQVAKKDGRVIGVAPTSALRASLIRKRREKSAASSV---------------------VGMLQPTPQRQNGSITDPVKEAARRLARENDKDHSLSSNTSQRPPRPLSPATGAEQLAFNVIFSGVDELP-----KTLP---RMKSRQ-------QSSSGYNTPNTLTGYSDVNNWDNRSMLSGVSVGSVTSVYSEREESFTHGIVITGELSFSIDYDDKSGSLRIFVKQARDVAKADKKTNSSSTYVKTYLLPDKTKQSKRKSKVKKNSTNPVFNEALVYTIAKSDLAYRTLQLSLWHHRHMKANLFLGEVLVPLADYRFSSTQ-IWRALQNRGSLEGNSDYNFTKGRIRLGLKFLPAT---------QGDLGELQVYVKNATDLNVPVGASGESDQKNSLNPVVKTHLLPERTKDSRRKTKVVKKTNNPTWEETLV 567          
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Match: A0A068WEL2 (Synaptotagmin protein 4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000631500 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.685e-39
Identity = 135/572 (23.60%), Postives = 265/572 (46.33%), Query Frame = 1
Query:   97 EIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIE-IKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMV-FIKSPKVMQLCKLC-------------YKEWLKQVKSGNWLLEIAKETDRQISVLERNQK-------LPMIQKEIER--------LLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKH--ISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQS--------LPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPS-DNERFLKLARXXXXXXXXXXXXEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHI---------GDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            E++ L  V  + + ++R+E +R+K +  +     K  R +      HC++C + F+  FNP ++C  C+  VC NC+   + S  V  LC+ C             + E L+  K    ++ +A  +  + S++ + ++       + M+Q   +R        + +     ++ ND    + +   ++     +  + Y D+  L+   +    +  V +L +  S++S    ++   +N S+ L      + RPLS  + +            + L K    +   +++ +     + +    DV + DN   L      + +       E FT+  ++ GE+   I++      L+I + + R++  A++K N+++ Y+K YLLPDK+   KRK+ VKKN T+P+FNE L Y I ++ L  RTL +S+WH   +K NLFLGE  +P+ + R ++ Q  W +L+ + ++         KG I +GL+F+  T         + + G+L +++++   +          D+KN  N  V+  +     +  +++TKVV  T NP W+E  +
Sbjct:   71 ELEHLADVCRRYDMLQRQEDERIKNIREKAISKEKARRGVSRYDEAHCALCGAAFMALFNPKSLCHHCELYVCRNCVQKRLDSESV--LCRACFSECTNKARTGLWFTEKLQVAKKDGRVIGVAPTSALRASLIRKRREKSAASSVVGMLQPTPQRQNGSITDPVKEAARRLARENDKDHSLSSNTSQRPPSEESNSQVYPDTSGLSSMRRRNGTAPQVTDLRRRLSSASSTTASI---QNRSQTL------RPRPLSPATGAEQLAFNVIFSGVDELPKTLPRMKSRQQSSSGYNTPNTLTGYSDVNNWDNRSMLSGVSVGSVTSVYSEREESFTHGIVITGELSFSIDYDDKSGSLRIFVKQARDVAKADKKTNSSSTYVKTYLLPDKTKQSKRKSKVKKNSTNPVFNEALVYTIAKSDLAYRTLQLSLWHHRHMKANLFLGEVLVPLADYRFSSTQ-IWRALQNRGSLEGNSDYNFTKGRIRLGLKFLPAT---------QGDLGELQVYVKNATDLNVPVGASGESDQKNSLNPVVKTHLLPERTKDSRRKTKVVKKTNNPTWEETLV 621          
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Match: A0A4Z2CYR3 (Synaptotagmin-like protein isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_006308 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.124e-39
Identity = 151/566 (26.68%), Postives = 254/566 (44.88%), Query Frame = 1
Query:   58 SYLEEIKTKCSFN----EIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKI-IREIE-IKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFK-TQIDNLICKKDNLHTNR------YEPYDDSGNLNDFVKHIS----ASVDNLSKSYSASSGPLKALINSKNDSE-----ILSDIGCCQERPLSRNSQSLPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGK-------HIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYLQR 1668
            SY  +  T  S N    E K L  VL + +   + E  RVK L +E+   +K+ I++ E I   HC+ CN+ F+    P   C  C  + C  C   + + K++ +CK C  E L + K G W  E  K+  R    +        ++  I R+ +E    +K    +   +  L  K  +LH ++      Y P       +D +   S    +S   L K+ S+    L       + SE     + S+I    ++ L+  S  L ++  L  +QK L              ++  N  V S   +   L+               +T+   + GE+L+ I +    + L++ I + R+L IA+RK N TNPY+K YLLPD++   KRKTS KK+  +P+F+EE  Y I +  L  RTL V+VWH   L  NLFLGE  +P+   + + A   W++L     VP    L   +GEI++ ++ +      N         G+++++I+S K        +  +++  + +V+  +     +  K++TKVV    NP W++  + R
Sbjct:   56 SYPRKGTTLASANLTTEERKHLEEVLARFDQFRQIEDSRVKQLRQEMIDKQKVRIKKSEAISEGHCNNCNALFVPLLQPAIRCVNCHGDFCRICTEKLPNTKIV-MCKFCRFETLHKCKLGVWFTEQLKQA-RACGRVRGVSGPEALRSSILRIQREAKSNNKTPRSQGASMQELNKKSKSLHNSQSLVDSGYVPQRTHSWTDDEIDPTSEKHHSSTPQLHKTSSSKEADLHKQNTGFSSSECYSPSLTSEITSVTDKKLTPTSNELVSARILTTQQKRLD------------SEVGSNLSVASGASQGSSLS-------IYSERESSYTHGIQISGELLMSIIYDSTFNALRVGIKQARDLAIADRKRNVTNPYVKCYLLPDRTKGSKRKTSHKKSTCNPVFDEEFKYYILKQDLASRTLQVTVWHYNVLGLNLFLGEIFLPLTFHQFDEASH-WYTLGEHRLVPAASHLQINRGEIVLAIKLVPGETGGNR--------GEIHVWIKSAKGLSASTDGVASQRDNVDPYVKIYMLPGKEKHTKQKTKVVKRNNNPEWNQAIIYR 591          
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Match: K7GI35 (Synaptotagmin like 3 OS=Pelodiscus sinensis OX=13735 GN=SYTL3 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.051e-35
Identity = 151/568 (26.58%), Postives = 249/568 (43.84%), Query Frame = 1
Query:   97 EIKKLMVVLNKNEDIERRESKRVKMLERELNFFR-KIIREI--EIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISAS------VDNLSKSYSASSGPLKALINSKND-----SEILSDIGCCQERPLSRNSQS------------LPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI--YNIRLNNAQEC-WHSLKTKEAVPQILSLYQYKGEILIGLQFI--------QNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIP--------NSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            E + ++ VL +++ + + + +R++ L+ +L   R K  + +  E     C+ C     +  N   +C  C + VC  C V +     +  C +CY     +VK+G W  E            ER +K P          Q++ E + A   K+     + K   +          +G     ++ IS S      V+NL  S + +   +K +  S+ND     S + +D G   ER   R SQS             P+ +RL    ++   + E +T+ + C Q   + D P  +  F    +  +    +   +E    D   V GEI   + +I    +L++ I  C+NL     K+   NPY K YLLPDKS   KRKT+VKKN   P F+E   YKI+ + L  R L +SVWH  +LK  +FLGE  IP+  +N   N+ Q   W+ LK K   P+  SL QY GE+L+  + I        Q  ++RN E  +    G+L++ +         KN+P        NSFV+  +        ++++ V+    +P W  +++
Sbjct:   14 EQETILQVLYRDQMVRKVDEERIRKLKMQLQQLRWKGAKSVNHEYHERSCARCQKSLGLVMNRGAVCNGCSHRVCSECRVCLNH---LWKCTICYAHGDMKVKTGEWFFE------------ERAKKFPA---------QDRHETTGAKLLKSY--QKLSKISVVPPTPPPFTVSTGGNTTMLQEISQSRSFNKSVENLFLSLATN---MKKISKSQNDMRSDKSLLTTDYGQDVERRKERRSQSDTAINITSRIRNAPSLQRLINGARD---DNEVYTK-RNCKQGEDSPDSPMSDTVFCGGKKHDSLYSINSTCTEAGNFDMAHVTGEIEFAMRYIFKTYILEVCIKACKNLAYGEEKKKKCNPYAKTYLLPDKSSRSKRKTAVKKNTVDPAFHETFKYKIEYSQLETRKLQISVWHSGALKRRVFLGEVIIPLASWNFEDNSTQSFNWYQLKAKPEKPED-SLVQYNGELLLCAKLILPSQSKKCQYEEQRNGEEQAA-AAGQLHLVVLGA------KNLPVVRCGGTLNSFVKGCLTLPDQSKIRQKSPVLKKEASPEWKHLFV 540          
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Match: K7GI29 (Synaptotagmin like 3 OS=Pelodiscus sinensis OX=13735 GN=SYTL3 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.106e-34
Identity = 151/566 (26.68%), Postives = 247/566 (43.64%), Query Frame = 1
Query:   97 EIKKLMVVLNKNEDIERRESKRVKMLERELNFFR-KIIREI--EIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISAS------VDNLSKSYSASSGPLKALINSKND-----SEILSDIGCCQERPLSRNSQS------------LPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI--YNIRLNNAQEC-WHSLKTKEAVPQILSLYQYKGEILIGLQFI--------QNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIP--------NSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEV 1656
            E + ++ VL +++ + + + +R++ L+ +L   R K  + +  E     C+ C     +  N   +C  C + VC  C V +     +  C +CY     +VK+G W  E            ER +K P          Q++ E + A   K+     + K   +          +G     ++ IS S      V+NL  S + +   +K +  S+ND     S + +D G   ER   R SQS             P+ +RL    ++   + E +T+ + C Q   + D P  +  F    +  +    +   +E    D   V GEI   + +I    +L++ I  C+NL     K+   NPY K YLLPDKS   KRKT+VKKN   P F+E   YKI+ + L  R L +SVWH  +LK  +FLGE  IP+  +N   N+ Q   W+ LK K   P+  SL QY GE+L+  + I        Q  ++RN E  +    G+L++ +         KN+P        NSFV+  +        ++++ V+    +P W  +
Sbjct:   14 EQETILQVLYRDQMVRKVDEERIRKLKMQLQQLRWKGAKSVNHEYHERSCARCQKSLGLVMNRGAVCNGCSHRVCSECRVCLNH---LWKCTICYAHGDMKVKTGEWFFE------------ERAKKFPA---------QDRHETTGAKLLKSY--QKLSKISVVPPTPPPFTVSTGGNTTMLQEISQSRSFNKSVENLFLSLATN---MKKISKSQNDMRSDKSLLTTDYGQDVERRKERRSQSDTAINITSRIRNAPSLQRLINGARD---DNEVYTK-RNCKQGEDSPDSPMSDTVFCGGKKHDSLYSINSTCTEAGNFDMAHVTGEIEFAMRYIFKTYILEVCIKACKNLAYGEEKKKKCNPYAKTYLLPDKSSRSKRKTAVKKNTVDPAFHETFKYKIEYSQLETRKLQISVWHSGALKRRVFLGEVIIPLASWNFEDNSTQSFNWYQLKAKPEKPED-SLVQYNGELLLCAKLILPSQSKKCQYEEQRNGEEQAA-AAGQLHLVVLGA------KNLPVVRCGGTLNSFVKGCLTLPDQSKIRQKSPVLKKEASPEWKHL 538          
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Match: ENSAMXT00000011595.2 (synaptotagmin like 2 [Source:NCBI gene;Acc:103029017])

HSP 1 Score: 139.428 bits (350), Expect = 3.235e-34
Identity = 72/227 (31.72%), Postives = 133/227 (58.59%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAV---PQILS-LYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V+G I   I ++Q ++   I I++CR+L +A  + N ++PY+K YLLPDK   GKRKTSVKK   +P +NE L +KI  ++L   TLN+SVWH ++   N FLGE ++ +     +N+    ++LK +  V   P+ +S   +  GE+ + L+F+  T    +++    + G++ I+++  K++   +   + F++C +     + G+++T+VV  T NP+++   +
Sbjct:  634 VKGTIQFAINYVQKLAEFHIFIVQCRDLAVAEPRRNRSDPYVKCYLLPDKEKLGKRKTSVKKKTLNPTYNEILRFKITLDNLKSHTLNLSVWHNDTFGKNSFLGEVDVDLSEWDFSNSHMMDYALKGRVPVQSSPKHVSQTLELSGEMRVALRFLTQT----TQSKKTPQNGEVQIWVKECKNLPARRGTIDPFIKCAVLPDTARKGRQKTRVVKRTANPVFNHTMV 856          
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Match: ENSAMXT00000050988.1 (synaptotagmin like 2 [Source:NCBI gene;Acc:103029017])

HSP 1 Score: 139.043 bits (349), Expect = 4.033e-34
Identity = 72/227 (31.72%), Postives = 133/227 (58.59%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAV---PQILS-LYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V+G I   I ++Q ++   I I++CR+L +A  + N ++PY+K YLLPDK   GKRKTSVKK   +P +NE L +KI  ++L   TLN+SVWH ++   N FLGE ++ +     +N+    ++LK +  V   P+ +S   +  GE+ + L+F+  T    +++    + G++ I+++  K++   +   + F++C +     + G+++T+VV  T NP+++   +
Sbjct:  596 VKGTIQFAINYVQKLAEFHIFIVQCRDLAVAEPRRNRSDPYVKCYLLPDKEKLGKRKTSVKKKTLNPTYNEILRFKITLDNLKSHTLNLSVWHNDTFGKNSFLGEVDVDLSEWDFSNSHMMDYALKGRVPVQSSPKHVSQTLELSGEMRVALRFLTQT----TQSKKTPQNGEVQIWVKECKNLPARRGTIDPFIKCAVLPDTARKGRQKTRVVKRTANPVFNHTMV 818          
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 131.339 bits (329), Expect = 8.759e-32
Identity = 75/238 (31.51%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKR---------------RNSETISEYETGKLNIFIQSGKHIGDEKN-IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            V GEILL I +      L +++ +CR L   + ++  T+PY+K YLLPDKS   KRKTS+K N T+P+FN+ L Y +  + L  RTL VSVWH +    N FLGET +   +   +   E W +L+ + A   + S+ QYKGE+ + L++I   +                +  ++I+  + G + + ++  K++   K+   + FV+  +     +  K +T VV  + NP W+  +
Sbjct:  370 VSGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQPR-AEGSVDSMIQYKGELTVVLKYIPAERNLSLPLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNLTAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTF 606          

HSP 2 Score: 56.9954 bits (136), Expect = 3.794e-8
Identity = 35/134 (26.12%), Postives = 62/134 (46.27%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI-----------YNIRLNNAQECWHSLKTKEAVPQILSL 1404
             ++++++ + +NL     K  +++P++K YLLPD   + K KT+V K   +P +N   +Y  +    L    L ++VW +E L  N+FLG   +             +N      Q  W  +     VPQ  +L
Sbjct:  551 GMVELLVKEAKNLTAV--KSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKEPLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTL 682          

HSP 3 Score: 54.299 bits (129), Expect = 3.244e-7
Identity = 33/116 (28.45%), Postives = 55/116 (47.41%), Query Frame = 1
Query:   94 NEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLL-EIAKETDR 438
            +E + ++ VL K+E + +RE KR++ L+ EL   ++  R    +   C +C     +     ++C  C+  VC  C V +        C +C K    +V +G W L E AK  DR
Sbjct:   16 HEREMILSVLQKDEKLRKREEKRIRKLKNELLELKRGSRRSNSEQRECGVCLRALGLILQRGSVCDDCKRRVCSFC-VAVSPNSSHSKCTVCAKTAELKVVTGEWFLEERAKRFDR 130          
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 131.339 bits (329), Expect = 8.874e-32
Identity = 75/238 (31.51%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKR---------------RNSETISEYETGKLNIFIQSGKHIGDEKN-IPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            V GEILL I +      L +++ +CR L   + ++  T+PY+K YLLPDKS   KRKTS+K N T+P+FN+ L Y +  + L  RTL VSVWH +    N FLGET +   +   +   E W +L+ + A   + S+ QYKGE+ + L++I   +                +  ++I+  + G + + ++  K++   K+   + FV+  +     +  K +T VV  + NP W+  +
Sbjct:  348 VSGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQPR-AEGSVDSMIQYKGELTVVLKYIPAERNLSLPLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNLTAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTF 584          

HSP 2 Score: 56.9954 bits (136), Expect = 3.769e-8
Identity = 35/134 (26.12%), Postives = 62/134 (46.27%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPI-----------YNIRLNNAQECWHSLKTKEAVPQILSL 1404
             ++++++ + +NL     K  +++P++K YLLPD   + K KT+V K   +P +N   +Y  +    L    L ++VW +E L  N+FLG   +             +N      Q  W  +     VPQ  +L
Sbjct:  529 GMVELLVKEAKNLTAV--KSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKEPLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTL 660          

HSP 3 Score: 54.299 bits (129), Expect = 3.312e-7
Identity = 33/116 (28.45%), Postives = 55/116 (47.41%), Query Frame = 1
Query:   94 NEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLL-EIAKETDR 438
            +E + ++ VL K+E + +RE KR++ L+ EL   ++  R    +   C +C     +     ++C  C+  VC  C V +        C +C K    +V +G W L E AK  DR
Sbjct:   16 HEREMILSVLQKDEKLRKREEKRIRKLKNELLELKRGSRRSNSEQRECGVCLRALGLILQRGSVCDDCKRRVCSFC-VAVSPNSSHSKCTVCAKTAELKVVTGEWFLEERAKRFDR 130          
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Match: sytl1 (synaptotagmin-like protein 1 [Source:NCBI gene;Acc:103029374])

HSP 1 Score: 115.546 bits (288), Expect = 6.149e-27
Identity = 73/238 (30.67%), Postives = 129/238 (54.20%), Query Frame = 1
Query:  973 YFTNDF---IVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAV--PQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIG---DEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            Y   DF    V G I L + +      L + +  C++L  A  + N ++PY+K+YLLPD +   K+KT+VK+   +P+++E L YK+ ++ L  R L+VSVWH E ++ NLFLGE  + +       +Q  W+SL+ +  +    I+S    +G IL  ++FI       SE      TG+L+I+++  + IG    ++ IPN+ V+  +      V  ++T+VV  + +P+++   +
Sbjct:  230 YSVGDFGGVTVTGRIQLSLHYDPKKEELHVRVCCCQDL--APARNNRSDPYVKVYLLPDNTSRSKKKTAVKRKTLNPVYDETLKYKVRKSELQARVLSVSVWHMERVRRNLFLGEVEVGLDQWDWGRSQPTWYSLQPRVQMNPDAIIS----RGTILFSMKFIPP----GSEGGGFPLTGELHIWLR--EVIGLLPPKRGIPNTHVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMV 455          
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.313e-31
Identity = 56/162 (34.57%), Postives = 95/162 (58.64%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSL-YQYKGEILIGLQFIQNTKRRNSET 1476
            V G+I   + +   + +L + + +CRNL     +    +PY+K+YLLPDKS  GKRKT +KKN  +P+FNE L Y I    L  R +++SVWH +S + N FLG+ ++P+    L    + W +L+ +       ++  +YKGE+++ L++I  T++   E+
Sbjct:    1 VSGDINFSVSYDYRVGVLSLTLRQCRNLAYGEERTKRCDPYVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYAISHTQLEVRCVHLSVWHHDSFRHNSFLGQASLPLDCCDLERGDDRWCALQPRVTRNPFAAINNKYKGELILALKYIAPTEQPQPES 162          
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 91.2781 bits (225), Expect = 6.895e-21
Identity = 57/178 (32.02%), Postives = 97/178 (54.49%), Query Frame = 1
Query: 1114 YIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEK-NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPI 1644
            Y+K YLLPDKS   K+KT+V+KN  +P++NE L YKI    L  R LN+SVWH +    N FLGE  + +      N    W  L+ +  + Q       +G + + L+FI      NS   ++  +G+++I+++  K++   K +  ++FV+C I     +  +++T+ V  + NP+
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRVHISQ--EDLTSRGYLNLALKFIP----ANSVGKTKNASGEIHIWVKEAKNLLPLKPHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPV 172          
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 90.1225 bits (222), Expect = 1.856e-20
Identity = 56/180 (31.11%), Postives = 97/180 (53.89%), Query Frame = 1
Query: 1114 YIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEY--ETGKLNIFIQSGKHIGDEK-NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPI 1644
            Y+K YLLPDKS   K+KT+V+KN  +P++NE L YKI    L  R LN+SVWH +    N FLGE  + +      N    W  L+ + + P +  L   +G + + L+FI            ++   +G+++I+++  K++   K +  ++FV+C I     +  +++T+ V  + NP+
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRTS-PALKDLTS-RGYLNLALKFIPANSVAPPTPEGQFTPASGEIHIWVKEAKNLLPLKPHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPV 178          
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Match: pik3c2a (phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha [Source:ZFIN;Acc:ZDB-GENE-030328-39])

HSP 1 Score: 71.2478 bits (173), Expect = 3.671e-13
Identity = 40/127 (31.50%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLK 1371
            V G++ L + + +N +L  IM++  ++L+  +  +   +PY+K YLLPD +   KRKT + +   +P +NE L Y    + +L  R L +SVW  E+L+ N+FLG  ++ +  + L++    W  L+
Sbjct:  820 VGGKVKLSVSY-RNAALF-IMVMHIKDLVFTDGAD--PDPYVKTYLLPDPNRVTKRKTKIARKTLNPTYNEMLVYNCFSKEALKQRRLQLSVWSAEALRENIFLGGLSLSLRELDLDHETVGWFPLQ 942          
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 65.4698 bits (158), Expect = 1.990e-12
Identity = 31/94 (32.98%), Postives = 54/94 (57.45%), Query Frame = 1
Query: 1099 NTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKE 1380
             T++PY+KL+L+PDK    K +T V +   +P+FNE   +K+  + L G+TL ++V+  +    +  +GE  +P+  I L +  E W  L + E
Sbjct:  113 GTSDPYVKLFLMPDKKK--KYETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTIDLGHVIEEWRDLVSAE 204          
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 69.3218 bits (168), Expect = 4.650e-13
Identity = 60/225 (26.67%), Postives = 110/225 (48.89%), Query Frame = 1
Query: 1000 GEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVP---QILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            G+I   + +  + S+L + +LK + L  A     T++P++K+ LLPDK    K +T VK+   +P++NE  +++    N L+G+TL + V   +    N  +GE  IP+ NI L      +    TK+ +P     + L    G++L+ L + Q T   N   +   +  KL     +G          + +V+  I H   ++ KK+T +   T +P+W+E ++
Sbjct:    4 GKIFFSLTYYSSDSVLTLKVLKAQGLP-AKDFSGTSDPFVKIMLLPDKK--HKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTF----TKDLLPCKKDRVPL----GDLLVSLMY-QPTN--NRIIVVVMKANKLKAMDLTGSS--------DPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFI 206          
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Match: EDO49802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY4])

HSP 1 Score: 67.781 bits (164), Expect = 2.454e-12
Identity = 47/226 (20.80%), Postives = 101/226 (44.69%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQEC-WHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPN---SFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            ++G+I + +++     LL + +++ R+L+  +     ++PY+ L L+PD+   G +KT  K+   +P+FNE   +K+  N+L    L  ++W  +    + F GE  + +  +  NN     W  L       Q+ + +   GE+ + ++++              E   L + I    ++    ++ N   ++VRC+              V+  T NP + E++
Sbjct:   29 IKGDIEMSLKYNHREQLLLVKVIRARDLVPRDLN-GKSDPYVVLELVPDRLEEGTKKTRFKQKTLNPVFNEIFQFKVPHNNLTDTKLCATIWDHDFFGEDDFNGEAVVDLSRVNFNNGTHTDWFML-------QLQTDFSITGELDVTVEYL--------------EPDTLAVTIHKATNLKSSNSMANTSDAYVRCS--------------VIPGTLNPEFAEIF 218          
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 66.2402 bits (160), Expect = 6.665e-12
Identity = 33/102 (32.35%), Postives = 56/102 (54.90%), Query Frame = 1
Query: 1000 GEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
            G I L +++     +L + +++C  L   +     ++PY+K YL PD     KR+T+++K   +P FNEE  Y I  + L  ++L V+VW  +  K N F+G
Sbjct:  155 GRIQLALKYNTQRGMLFVTVMRCSGLASMD-ANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIG 255          

HSP 2 Score: 65.4698 bits (158), Expect = 1.007e-11
Identity = 54/192 (28.12%), Postives = 96/192 (50.00%), Query Frame = 1
Query: 1099 NTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELS-YKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQIL-SLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQ--SGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
             T++PY+KL+LLP  S + K ++  K    +P+FNE L+ Y I    +  +TL + V+ ++++  N F+GET+I +  +  N  Q    SL     +P+ L S +   G I + L++  NT+R           G L + +   SG    D     + +V+C +K    +  K+ T +   T NP ++E ++
Sbjct:   52 GTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLNSNPTQTFKRSL-----IPKALDSPHSPLGRIQLALKY--NTQR-----------GMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFV 225          
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Match: EDO32931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM9])

HSP 1 Score: 67.3958 bits (163), Expect = 8.974e-12
Identity = 39/128 (30.47%), Postives = 69/128 (53.91%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESL--KGNLFLGETNIPIYNIRLNNAQECWHSLK 1371
            V G++ L I +    S L +  +K R+L+  +  +   +PY++ Y+LPDKS + +R+T + KN  SP F+E+  + I    L  RTL+V+V +  S   K    +G+  I +  + L+     W+ L+
Sbjct:  630 VTGDVYLTIRYDSQGSKLIVTDMKARDLMPCD-SDGLADPYMRSYVLPDKSKSNRRRTDIAKNTLSPSFDEKFEWMIPEAQLKDRTLDVTVKNDVSFFSKSKTSMGQVLIDLGKLDLSKPISAWYMLR 756          
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Match: EDO46351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQE8])

HSP 1 Score: 65.4698 bits (158), Expect = 3.347e-11
Identity = 57/210 (27.14%), Postives = 97/210 (46.19%), Query Frame = 1
Query:  736 LSDIGCCQERPLSRNSQSLPNSERLRKKQKELVIN--EENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFIVQG----EILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNA 1347
            + D+      P  R +    +     +KQ++  +   E+ H    I   ++ NG  P D     +   S   S    ++ E  T DF ++     E+ LK +H++N  ++K+  +  RNL   +  EN TNP+++LYLLPD+S   +R T   +   S +FNE   Y I  + L  R L  +V     L+ N  +GET + +  + L + 
Sbjct:  555 VPDVDAKDAGPRDRKASRKSSKRSFHQKQEDTAVQAIEKTHVPVPI---LVVNGVQPVDETHHAETG-SDQGSVYDDSTLELRTQDFDLKSRGELELNLKYDHVRNTLVVKV--ISARNLRSGD-AENKTNPFVRLYLLPDRSKKTRRVTKTVRGAYSGMFNEVFEYAIGLDLLGDRQLACAVKSDRGLR-NRLIGETTVDLGELELTDG 756          
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 129.413 bits (324), Expect = 3.965e-31
Identity = 69/231 (29.87%), Postives = 130/231 (56.28%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNA-QECWHSL-KTKEAVPQILSLYQYKGEILIGLQFI----QNTKRRNSETISEYETGKLNIFIQSGKHI--GDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            V G+++  + + ++   L++ I +C+ L   +     +NPY+K YLL  K+   K+KTS+KKN  +P+F+E L Y + R+ L+G+++++SVWH   L  N+FLGE  IP+ +  L+   +EC H + K    VP   +  +  GE++I L+++      T++   +  ++ + G+L++ I+  K++  G   +  +SFVR  +     +  K +T VV    NP +D  ++
Sbjct:  388 VSGQVVFALRYDEHTQSLQVFIKECQGLAHGDASRKLSNPYVKCYLLHGKTRQNKKKTSIKKNTINPVFSETLKYSMSRSELLGQSVSISVWHHGRLSRNVFLGEVTIPLDSANLDTPHEECLHLMGKMSSDVPDA-AFERCSGELVISLKYVPPNKTTTEKVKGKKAAQVQRGELHVLIKEAKNLKSGKSGSTSDSFVRGHLFPSKAKTAKMKTPVVKKNLNPHYDSTFV 617          
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Match: ENSORLT00000041991.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 118.242 bits (295), Expect = 2.913e-27
Identity = 66/232 (28.45%), Postives = 132/232 (56.90%), Query Frame = 1
Query:  976 FTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISE--YETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            ++ D + VQG I   I ++Q +    I + +CR+L   + K   ++PY+K YL+PDK+  GKRKTSVKK   +P FNE L Y++  + L  + L +SVWH ++   N FLGE ++ +     ++ Q  + +LK K  +P +      +GE+ + ++F+      +SE +++    +G+++I+++  K +   +   + +V+C +     + G+++T+V+  T +P+++   +
Sbjct:  917 YSGDLVEVQGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYRVRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAK-TMPTV-EPTNGRGEMRLAIRFLPQIS--HSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMV 1144          

HSP 2 Score: 53.1434 bits (126), Expect = 8.103e-7
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1027 IQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
            I N   + I +  C+ L +      T +PY+K ++LPD S  G++KT V +    P+FN  + Y  I    L    + ++VW ++ L  NL  G
Sbjct: 1085 ISNSGEIHIWVKDCKGLPLI---RATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDRDRLASNLLGG 1175          
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Match: ENSORLT00000043719.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 118.242 bits (295), Expect = 2.913e-27
Identity = 66/232 (28.45%), Postives = 132/232 (56.90%), Query Frame = 1
Query:  976 FTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISE--YETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            ++ D + VQG I   I ++Q +    I + +CR+L   + K   ++PY+K YL+PDK+  GKRKTSVKK   +P FNE L Y++  + L  + L +SVWH ++   N FLGE ++ +     ++ Q  + +LK K  +P +      +GE+ + ++F+      +SE +++    +G+++I+++  K +   +   + +V+C +     + G+++T+V+  T +P+++   +
Sbjct:  917 YSGDLVEVQGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYRVRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAK-TMPTV-EPTNGRGEMRLAIRFLPQIS--HSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMV 1144          

HSP 2 Score: 53.1434 bits (126), Expect = 8.103e-7
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1027 IQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
            I N   + I +  C+ L +      T +PY+K ++LPD S  G++KT V +    P+FN  + Y  I    L    + ++VW ++ L  NL  G
Sbjct: 1085 ISNSGEIHIWVKDCKGLPLI---RATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDRDRLASNLLGG 1175          
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 117.857 bits (294), Expect = 3.062e-27
Identity = 73/241 (30.29%), Postives = 119/241 (49.38%), Query Frame = 1
Query:  994 VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQ---NT--------------KRRNSETISEYETGKLNIFIQSGKHIGDEK--NIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            V GEIL+ I +      L +++ +C NL   + ++  T+ Y+K YLLPDKS   KRKTS+K N  +P+FNE L Y I  + L  RTL VSVWH +    N FLGE  +   +   ++  E W++L+ +       S   YKGE+ + L++I    NT              K + + + +  + G + + ++  K++   K     + FV+  +     +  K +T V   T NP W+  +
Sbjct:  415 VSGEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYVISHSQLELRTLQVSVWHHDRFGYNSFLGEVELSFDSWEFDSQIEEWYALQPR-VDGSTDSTMHYKGELTVVLKYIPAEINTTPPPDQVQVKKGFLKGKKTSSFTLPKGGMVELLVKGAKNLTAVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTF 654          

HSP 2 Score: 53.9138 bits (128), Expect = 4.107e-7
Identity = 27/90 (30.00%), Postives = 53/90 (58.89%), Query Frame = 1
Query: 1039 SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSY-KIDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
             ++++++   +NL  A +    ++P++K YLLPD + + K KT+V++   +P +N   +Y  +    L    L ++VW +E+L  N+FLG
Sbjct:  598 GMVELLVKGAKNLT-AVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVWDKEALASNVFLG 686          

HSP 3 Score: 50.0618 bits (118), Expect = 6.952e-6
Identity = 30/110 (27.27%), Postives = 53/110 (48.18%), Query Frame = 1
Query:   94 NEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRK--IIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLE 417
            +E + ++ VL K+E + ++E KR++ ++ EL   +     R  E     C+ C     + F+   +C+ CQ  VC  C     + +  + C +C K    +V SG W LE
Sbjct:   16 HEREMILKVLQKDEKLRKQEEKRIRKMKNELLEIKHKGFPRPQESGDRLCARCLKTLGLIFDRGELCEECQQRVCSECRALTANSRKWR-CNVCAKVLELKVVSGEWFLE 124          
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Match: ENSORLT00000029248.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 118.242 bits (295), Expect = 3.345e-27
Identity = 66/232 (28.45%), Postives = 132/232 (56.90%), Query Frame = 1
Query:  976 FTNDFI-VQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISE--YETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYL 1662
            ++ D + VQG I   I ++Q +    I + +CR+L   + K   ++PY+K YL+PDK+  GKRKTSVKK   +P FNE L Y++  + L  + L +SVWH ++   N FLGE ++ +     ++ Q  + +LK K  +P +      +GE+ + ++F+      +SE +++    +G+++I+++  K +   +   + +V+C +     + G+++T+V+  T +P+++   +
Sbjct:  888 YSGDLVEVQGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYRVRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAK-TMPTV-EPTNGRGEMRLAIRFLPQIS--HSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMV 1115          

HSP 2 Score: 53.1434 bits (126), Expect = 8.937e-7
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1027 IQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLG 1305
            I N   + I +  C+ L +      T +PY+K ++LPD S  G++KT V +    P+FN  + Y  I    L    + ++VW ++ L  NL  G
Sbjct: 1056 ISNSGEIHIWVKDCKGLPLI---RATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDRDRLASNLLGG 1146          
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Match: SMESG000010162.1 (SMESG000010162.1)

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 542/544 (99.63%), Postives = 543/544 (99.82%), Query Frame = 1
Query:   28 MNCYQKSDEDSYLEEIKTKCSFNEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQSLPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARXXXXXXXXXXXXEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVY 1659
            MNCYQKSDEDSYLEEIKTKCSFNEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQS PNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARSSANSYSSMNSSEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEV+
Sbjct:    1 MNCYQKSDEDSYLEEIKTKCSFNEIKKLMVVLNKNEDIERRESKRVKMLERELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMVFIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPMIQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLNDFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSRNSQSPPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKLARSSANSYSSMNSSEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVF 544          

HSP 2 Score: 69.707 bits (169), Expect = 3.528e-12
Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 2
Query: 1655 FTFNDIDKLSLGETEIELCILNKKLIKTQILGKLL 1759
            FTFNDIDKLSLGETEIELCILNKKLIKTQILGKLL
Sbjct:  544 FTFNDIDKLSLGETEIELCILNKKLIKTQILGKLL 578          
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Match: SMESG000074360.1 (SMESG000074360.1)

HSP 1 Score: 122.094 bits (305), Expect = 5.381e-29
Identity = 72/227 (31.72%), Postives = 126/227 (55.51%), Query Frame = 1
Query:  976 FTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEV 1656
            + +  +V G++L  + +  +   L I + +C+NL +A+R +  TNPYIK YLLPDK+   K+K++ K++  +PIF E L Y + + SL  RTL+V VWH+  +  N FLGE ++ + ++ L+  +  W+ L+ K   P     + YKGE++I L++  +T+R           G L++ I   + +  +    N +V+  +       GKK+T V  +T+N  WD +
Sbjct:  294 YKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCQNLAVADRNKRQTNPYIKTYLLPDKTKTSKKKSTSKRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGK--------GSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSL 512          

HSP 2 Score: 53.1434 bits (126), Expect = 4.406e-7
Identity = 38/135 (28.15%), Postives = 71/135 (52.59%), Query Frame = 1
Query:  979 TNDFIVQGEILLKIEHIQNI-----SLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHS 1365
            +   I +GE+++K+++  +        L ++I++ + L    +   + N Y+K +LLPD+S  GK+KT V+K+ ++  ++  L +  +    L  R+L +S++H   LK N FLG        +RLN      HS
Sbjct:  434 SGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQ---SLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFLG-------GVRLNLGLGLHHS 558          
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Match: SMESG000004656.1 (SMESG000004656.1)

HSP 1 Score: 100.138 bits (248), Expect = 7.548e-22
Identity = 72/233 (30.90%), Postives = 121/233 (51.93%), Query Frame = 1
Query:  997 QGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITS---PIFNEELSYK-IDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILS--LYQYKGEILIGLQFIQNTKR-----RNSETISEYE--TGKLNIFIQSGKHI--GDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWD 1650
            QG+I++ + +       +I+I KCRNL IA    N++NPY+K+ L+P   P    K    K I+S   P FNE+  YK I    ++ R   V+VWH E L  ++FLG+  +     +L++A   W   K KE  P I++  L +Y G+I + +++  N K        S+  SE    TG + ++I+   ++      ++PNS+ +C +     +V  K+T ++    NPIW+
Sbjct:  373 QGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVP---PIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNW--FKLKEKGPTIITPVLSKYYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWN 600          
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.932e-13
Identity = 49/202 (24.26%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  988 FIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKG-NLFLGETNIPIYNIRLNNAQECWHSLK-------TKEAVPQILSLYQ--------YKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEK 1545
            F   GE+L++++    +S   I++ +C+NL   +   +   PY+ + LLPD+S   +R TSVKKN   PIF++   Y I+   L  R++ V + H++ L   +L LG+  IP+  +  +     W+S +       ++  + +  S  Q        Y GEI + ++ +       +        G+L+++++S +++   +
Sbjct:  304 FSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQ 505          
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.990e-13
Identity = 49/202 (24.26%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  988 FIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKG-NLFLGETNIPIYNIRLNNAQECWHSLK-------TKEAVPQILSLYQ--------YKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEK 1545
            F   GE+L++++    +S   I++ +C+NL   +   +   PY+ + LLPD+S   +R TSVKKN   PIF++   Y I+   L  R++ V + H++ L   +L LG+  IP+  +  +     W+S +       ++  + +  S  Q        Y GEI + ++ +       +        G+L+++++S +++   +
Sbjct:  282 FSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQ 483          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-like 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL53.924e-2935.12synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL54.126e-2935.12synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL46.099e-2931.22synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL46.099e-2931.22synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL46.099e-2931.22synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-38.784e-927.15SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-38.784e-927.15SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
unc-101.216e-829.13Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
unc-101.807e-829.13Rab-3-interacting molecule unc-10 [Source:UniProt... [more]
snt-41.943e-822.51SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:P91493... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btsz3.978e-2928.74gene:FBgn0266756 transcript:FBtr0334289[more]
btsz4.605e-2927.95gene:FBgn0266756 transcript:FBtr0334288[more]
btsz1.722e-2828.74gene:FBgn0266756 transcript:FBtr0334291[more]
btsz1.965e-2828.74gene:FBgn0266756 transcript:FBtr0334285[more]
btsz1.845e-2627.17gene:FBgn0266756 transcript:FBtr0334287[more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl51.193e-3030.96synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
sytl57.033e-3030.96synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
si:ch211-266g18.61.081e-2729.91si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
sytl11.839e-2728.45synaptotagmin-like 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
sytl2a1.884e-2729.73synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL53.042e-3435.27synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL51.092e-3335.63synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL41.229e-3334.20synaptotagmin like 4 [Source:NCBI gene;Acc:1004951... [more]
SYTL41.697e-3334.20synaptotagmin like 4 [Source:NCBI gene;Acc:1004951... [more]
SYTL42.072e-3334.20synaptotagmin like 4 [Source:NCBI gene;Acc:1004951... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sytl33.379e-3525.22synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl53.245e-2834.44synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl53.246e-2834.85synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl23.580e-2831.69synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl23.854e-2831.69synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99N48|SYTL3_MOUSE2.364e-3425.22Synaptotagmin-like protein 3 OS=Mus musculus OX=10... [more]
sp|Q8TDW5|SYTL5_HUMAN1.982e-2835.12Synaptotagmin-like protein 5 OS=Homo sapiens OX=96... [more]
sp|Q96C24|SYTL4_HUMAN2.929e-2831.22Synaptotagmin-like protein 4 OS=Homo sapiens OX=96... [more]
sp|Q812E4|SYTL5_RAT5.307e-2835.27Synaptotagmin-like protein 5 OS=Rattus norvegicus ... [more]
sp|Q80T23|SYTL5_MOUSE1.314e-2734.44Synaptotagmin-like protein 5 OS=Mus musculus OX=10... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6V7E24.288e-4525.32Synaptotagmin-like protein 4 OS=Echinococcus granu... [more]
A0A068WEL21.685e-3923.60Synaptotagmin protein 4 OS=Echinococcus granulosus... [more]
A0A4Z2CYR32.124e-3926.68Synaptotagmin-like protein isoform 3 OS=Schistosom... [more]
K7GI354.051e-3526.58Synaptotagmin like 3 OS=Pelodiscus sinensis OX=137... [more]
K7GI291.106e-3426.68Synaptotagmin like 3 OS=Pelodiscus sinensis OX=137... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000011595.23.235e-3431.72synaptotagmin like 2 [Source:NCBI gene;Acc:1030290... [more]
ENSAMXT00000050988.14.033e-3431.72synaptotagmin like 2 [Source:NCBI gene;Acc:1030290... [more]
sytl58.759e-3231.51synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl58.874e-3231.51synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl16.149e-2730.67synaptotagmin-like protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006493.11.313e-3134.57pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
sytl2a6.895e-2132.02synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
sytl2a1.856e-2031.11synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
pik3c2a3.671e-1331.50phosphatidylinositol-4-phosphate 3-kinase, catalyt... [more]
syt2a1.990e-1232.98synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437044.650e-1326.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498022.454e-1220.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419336.665e-1232.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329318.974e-1230.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463513.347e-1127.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl43.965e-3129.87synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
ENSORLT00000041991.12.913e-2728.45synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000043719.12.913e-2728.45synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
sytl53.062e-2730.29synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
ENSORLT00000029248.13.345e-2728.45synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Synaptotagmin-like 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010162.13.528e-1299.63SMESG000010162.1[more]
SMESG000074360.15.381e-2931.72SMESG000074360.1[more]
SMESG000004656.17.548e-2230.90SMESG000004656.1[more]
SMESG000014370.14.932e-1324.26SMESG000014370.1[more]
SMESG000014370.14.990e-1324.26SMESG000014370.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014567 ID=SMED30014567|Name=Synaptotagmin-like 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1761bp
TTTTTAATTGAAAATTAAAAGTTTCAAATGAATTGTTACCAGAAGTCCGA
TGAAGATAGCTATTTAGAAGAAATAAAAACTAAATGTAGTTTTAATGAAA
TTAAAAAATTAATGGTCGTTTTAAACAAAAATGAGGATATTGAAAGAAGA
GAGTCAAAAAGAGTTAAAATGCTGGAACGTGAATTAAACTTTTTCCGGAA
AATCATACGGGAAATTGAAATAAAAACCAATCACTGTTCAATATGCAATT
CGCAATTTATAATTTGTTTTAATCCAGTAAATATTTGCCAATTTTGCCAG
AATGAAGTTTGTGGCAATTGCATGGTGTTCATTAAATCTCCAAAAGTTAT
GCAATTGTGCAAATTGTGCTATAAAGAATGGCTGAAACAAGTCAAATCCG
GGAACTGGTTACTTGAAATAGCAAAAGAAACGGACAGACAAATATCTGTT
TTAGAAAGAAATCAGAAACTACCAATGATCCAGAAAGAGATAGAAAGATT
ATTACAAGAAAAAGTAGAATATTCTAAAGCTAATGATTTCAAGACACAAA
TTGATAATCTTATATGCAAAAAAGACAATCTACACACAAACAGATATGAA
CCTTATGACGACTCAGGAAACCTAAATGATTTTGTGAAACATATAAGCGC
GTCCGTTGATAACTTATCTAAATCCTACTCAGCTTCATCTGGTCCATTAA
AAGCTCTGATCAATTCAAAAAACGACAGCGAAATATTAAGTGATATCGGC
TGTTGTCAAGAGAGGCCACTATCTAGGAATTCGCAATCTCTACCAAATTC
TGAAAGACTTAGAAAGAAACAAAAAGAATTAGTAATTAATGAAGAAAATC
ATACACAAGACAAAATCTGTGATCAAATTATTCCAAATGGAGACGTTCCA
AGTGACAACGAGAGATTTCTAAAATTGGCGAGAAGCAGTGCAAATTCGTA
TAGCTCAATGAATTCCTCCGAATATTTCACGAATGACTTTATCGTTCAAG
GTGAAATTCTACTAAAGATCGAGCACATTCAGAATATTTCCCTCCTCAAA
ATTATGATATTAAAATGTAGAAATCTCATAATTGCAAATCGTAAGGAAAA
TACTACAAATCCATACATAAAGCTCTATTTGTTACCAGACAAATCCCCCA
ATGGTAAACGTAAAACTTCTGTAAAAAAAAATATCACTAGCCCCATATTC
AATGAAGAACTCTCTTATAAAATTGACAGGAACTCGCTAATTGGTCGCAC
TCTTAATGTTTCCGTGTGGCATCAAGAATCGTTGAAAGGAAATCTTTTTC
TGGGAGAAACAAACATTCCAATTTATAATATCAGACTGAATAATGCCCAG
GAATGCTGGCACAGCCTAAAAACGAAGGAAGCTGTCCCACAAATATTGTC
ACTTTACCAATACAAAGGTGAAATATTAATTGGTCTTCAATTCATACAGA
ATACAAAAAGACGAAATTCAGAAACAATTTCAGAATATGAAACAGGAAAG
CTAAACATATTCATTCAAAGCGGAAAACATATTGGAGATGAGAAAAATAT
TCCAAATTCATTTGTTAGATGTACGATAAAACATATAGGAATTCAAGTTG
GTAAAAAAGAAACCAAAGTTGTGTCCAATACTACAAATCCTATCTGGGAT
GAAGTTTACCTTCAACGATATCGACAAACTCAGCCTAGGAGAAACAGAGA
TTGAATTATGCATTTTAAACAAAAAACTTATAAAAACTCAAATTTTGGGA
AAATTGTTGTT
back to top

protein sequence of SMED30014567-orf-1

>SMED30014567-orf-1 ID=SMED30014567-orf-1|Name=SMED30014567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=559bp
MNCYQKSDEDSYLEEIKTKCSFNEIKKLMVVLNKNEDIERRESKRVKMLE
RELNFFRKIIREIEIKTNHCSICNSQFIICFNPVNICQFCQNEVCGNCMV
FIKSPKVMQLCKLCYKEWLKQVKSGNWLLEIAKETDRQISVLERNQKLPM
IQKEIERLLQEKVEYSKANDFKTQIDNLICKKDNLHTNRYEPYDDSGNLN
DFVKHISASVDNLSKSYSASSGPLKALINSKNDSEILSDIGCCQERPLSR
NSQSLPNSERLRKKQKELVINEENHTQDKICDQIIPNGDVPSDNERFLKL
ARSSANSYSSMNSSEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNL
IIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKID
RNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTK
EAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGK
HIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVYLQRYRQ
TQPRRNRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005543phospholipid binding
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR041282FYVE_2
IPR035892C2_domain_sf
IPR000008C2_dom
IPR011011Znf_FYVE_PHD
IPR013083Znf_RING/FYVE/PHD
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0006887exocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 46..66
NoneNo IPR availablePANTHERPTHR45716FAMILY NOT NAMEDcoord: 301..556
NoneNo IPR availableCDDcd08521C2A_SLPcoord: 325..447
e-value: 2.48019E-45
score: 153.95
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 464..547
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 319..449
IPR000008C2 domainSMARTSM00239C2_3ccoord: 339..444
e-value: 6.9E-17
score: 72.1
IPR000008C2 domainPFAMPF00168C2coord: 340..447
e-value: 4.6E-16
score: 59.0
coord: 490..548
e-value: 1.4E-5
score: 25.3
IPR000008C2 domainPROSITEPS50004C2coord: 477..559
score: 9.583
IPR000008C2 domainPROSITEPS50004C2coord: 340..429
score: 13.727
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 21..128
e-value: 8.5E-11
score: 42.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 319..455
e-value: 5.6E-30
score: 105.9
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 459..559
e-value: 1.0E-9
score: 40.2
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 17..147
e-value: 7.6E-16
score: 59.8
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 24..129