Mitochondrial import inner membrane translocase subunit TIM14

Overview
NameMitochondrial import inner membrane translocase subunit TIM14
Smed IDSMED30014556
Length (bp)1424
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial import inner membrane translocase subunit TIM14 (SMED30014556) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial import inner membrane translocase subunit TIM14 (SMED30014556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial import inner membrane translocase subunit TIM14 (SMED30014556) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial import inner membrane translocase subunit TIM14 (SMED30014556) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014556h1SMcG0010703 Contig1341GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
muscle cellSMED30014556h1SMcG0010703 dd_Smed_v4_2309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014556h1SMcG0010703 dd_Smed_v4_2309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014556h1SMcG0010703 dd_Smed_v4_2309_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Match: DNAJC19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:HGNC Symbol;Acc:HGNC:30528])

HSP 1 Score: 105.145 bits (261), Expect = 1.414e-26
Identity = 50/90 (55.56%), Postives = 64/90 (71.11%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   27 KHMEPQVKQVFQSLPKSAFSGG---YYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Match: DNAJC19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:HGNC Symbol;Acc:HGNC:30528])

HSP 1 Score: 103.99 bits (258), Expect = 1.773e-26
Identity = 50/90 (55.56%), Postives = 64/90 (71.11%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:    2 KHMEPQVKQVFQSLPKSAFSGG---YYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 88          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Match: DNAJC19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:HGNC Symbol;Acc:HGNC:30528])

HSP 1 Score: 103.99 bits (258), Expect = 1.773e-26
Identity = 50/90 (55.56%), Postives = 64/90 (71.11%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:    2 KHMEPQVKQVFQSLPKSAFSGG---YYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 88          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Match: DNAJC15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:HGNC Symbol;Acc:HGNC:20325])

HSP 1 Score: 102.449 bits (254), Expect = 3.043e-25
Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            S YY GGFEQKM++REA LILGVS ++ KAKI  +H++ MILNHPD+ GSPY+AAKINEAKD+L+
Sbjct:   81 SSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLE 145          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Match: DNAJC19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:HGNC Symbol;Acc:HGNC:30528])

HSP 1 Score: 51.2174 bits (121), Expect = 2.016e-8
Identity = 21/28 (75.00%), Postives = 26/28 (92.86%), Query Frame = 1
Query:  268 MILNHPDRNGSPYLAAKINEAKDILDKQ 351
            M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:    1 MLLNHPDKGGSPYIAAKINEAKDLLEGQ 28          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Celegans
Match: dnj-21 (Mitochondrial import inner membrane translocase subunit TIM14 [Source:UniProtKB/Swiss-Prot;Acc:P91454])

HSP 1 Score: 100.908 bits (250), Expect = 1.882e-25
Identity = 46/89 (51.69%), Postives = 66/89 (74.16%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGS-SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            R++ +N     + ++ +    G+ S YY GGF+QKM++ EA+ ILGV+ ++  AKI E+HKK MI+NHPDR GSPYLAAKINEAKD+++
Sbjct:   20 RYVLRNQALIKKGMEAIPVAGGAFSNYYRGGFDQKMSRAEAAKILGVAPSAKPAKIKEAHKKVMIVNHPDRGGSPYLAAKINEAKDLME 108          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Match: CG7394 (gene:FBgn0036173 transcript:FBtr0333215)

HSP 1 Score: 110.538 bits (275), Expect = 8.945e-29
Identity = 68/116 (58.62%), Postives = 83/116 (71.55%), Query Frame = 1
Query:   25 MASTVXXXXXXXXXXXXXXRHLSKNGCQ----FSQKLKQLKFLNG----SSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            MAS+VIL GL + A G  G+HL +   Q    F++ LK L   +     +SKYY GGF+ KM KREASLILGVS +++K KI ++HKK M+LNHPDR GSPYLAAKINEAKD LDK
Sbjct:    1 MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDK 116          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Match: CG7394 (gene:FBgn0036173 transcript:FBtr0076098)

HSP 1 Score: 110.538 bits (275), Expect = 8.945e-29
Identity = 68/116 (58.62%), Postives = 83/116 (71.55%), Query Frame = 1
Query:   25 MASTVXXXXXXXXXXXXXXRHLSKNGCQ----FSQKLKQLKFLNG----SSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            MAS+VIL GL + A G  G+HL +   Q    F++ LK L   +     +SKYY GGF+ KM KREASLILGVS +++K KI ++HKK M+LNHPDR GSPYLAAKINEAKD LDK
Sbjct:    1 MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDK 116          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Match: CG7394 (gene:FBgn0036173 transcript:FBtr0305648)

HSP 1 Score: 110.538 bits (275), Expect = 8.945e-29
Identity = 68/116 (58.62%), Postives = 83/116 (71.55%), Query Frame = 1
Query:   25 MASTVXXXXXXXXXXXXXXRHLSKNGCQ----FSQKLKQLKFLNG----SSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            MAS+VIL GL + A G  G+HL +   Q    F++ LK L   +     +SKYY GGF+ KM KREASLILGVS +++K KI ++HKK M+LNHPDR GSPYLAAKINEAKD LDK
Sbjct:    1 MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDK 116          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Match: CG7394 (gene:FBgn0036173 transcript:FBtr0290024)

HSP 1 Score: 110.538 bits (275), Expect = 1.196e-28
Identity = 55/93 (59.14%), Postives = 69/93 (74.19%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNG----SSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            R + +   +F++ LK L   +     +SKYY GGF+ KM KREASLILGVS +++K KI ++HKK M+LNHPDR GSPYLAAKINEAKD LDK
Sbjct:   34 RRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDK 126          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Match: CG32727 (gene:FBgn0265265 transcript:FBtr0071056)

HSP 1 Score: 62.003 bits (149), Expect = 1.888e-11
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 1
Query:  127 QLKFLN-GSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDIL 342
            +L F N G+ ++Y G F+++M+ REAS IL +S N+   +      + M+  HPDRNGSPYLA KI++ K+ L
Sbjct:   48 RLCFGNLGTGRFYSGCFQKRMSHREASKILSISPNAPWIR------RAMLAKHPDRNGSPYLAGKIHKPKNGL 114          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Zebrafish
Match: dnajc15 (DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:ZFIN;Acc:ZDB-GENE-040801-216])

HSP 1 Score: 110.923 bits (276), Expect = 1.951e-28
Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            S YY GGFEQKMT+REASLILG+S  STK K+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LD
Sbjct:   80 SAYYKGGFEQKMTRREASLILGISPTSTKTKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLD 144          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Zebrafish
Match: dnajc19 (DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:NCBI gene;Acc:393734])

HSP 1 Score: 108.227 bits (269), Expect = 6.666e-28
Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 1
Query:  106 QFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            Q  Q L+  K   GS  YY GGF+ KM +REASLILGVS  + K KI E+H+K MILNHPDR GSPYLAAKINEAKD+LD Q
Sbjct:   32 QVKQALEASKSAFGSG-YYRGGFDPKMNRREASLILGVSPTANKTKIREAHRKLMILNHPDRGGSPYLAAKINEAKDLLDGQ 112          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Xenopus
Match: hnf1a (HNF1 homeobox A [Source:Xenbase;Acc:XB-GENE-484117])

HSP 1 Score: 102.834 bits (255), Expect = 7.245e-26
Identity = 60/112 (53.57%), Postives = 80/112 (71.43%), Query Frame = 1
Query:   25 MASTVXXXXXXXXXXXXXXRHLSKNGCQFSQKLKQ-LKFLNGSS--KYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            MAST+I  GL +  AG  GR+  +   Q   ++KQ L+ L  ++   YY GGF+ KMTKREASL+LG+S  + K KI E+H++ M+LNHPD+ GSPYLAAKINEAKD+L+ Q
Sbjct:    1 MASTLIAAGLTIAVAGFAGRYAVQAMKQMEPQVKQALQTLPKTAFGGYYKGGFDPKMTKREASLVLGISPTANKTKIREAHRRIMLLNHPDKGGSPYLAAKINEAKDLLEGQ 112          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Xenopus
Match: dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:NCBI gene;Acc:448735])

HSP 1 Score: 101.293 bits (251), Expect = 1.254e-24
Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            S YY GGFEQKM +REASLILGVS +++K+KI  +H+K MILNHPD+ GSPY+A KINEAKD+L+
Sbjct:   93 SYYYKGGFEQKMNRREASLILGVSPSASKSKIRAAHRKIMILNHPDKGGSPYMAMKINEAKDLLE 157          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Xenopus
Match: dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:NCBI gene;Acc:448735])

HSP 1 Score: 82.0333 bits (201), Expect = 1.300e-17
Identity = 45/103 (43.69%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDR--------------------------------------NGSPYLAAKINEAKDILD 345
            S YY GGFEQKM +REASLILGVS +++K+KI  +H+K MILNHPD+                                       GSPY+A KINEAKD+L+
Sbjct:   80 SYYYKGGFEQKMNRREASLILGVSPSASKSKIRAAHRKIMILNHPDKVLRSGTMETDIAVIGLGECLMEDSCTCRLWQQLPAHFLGGSPYMAMKINEAKDLLE 182          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Match: Dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:MGI Symbol;Acc:MGI:1913398])

HSP 1 Score: 105.145 bits (261), Expect = 2.710e-26
Identity = 48/65 (73.85%), Postives = 57/65 (87.69%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            S YY GGFEQKM+KREASLILGVS ++ KAKI  +HK+ MILNHPD+ GSPYLA+KINEAKD+L+
Sbjct:   79 SSYYKGGFEQKMSKREASLILGVSPSAGKAKIRTAHKRIMILNHPDKGGSPYLASKINEAKDLLE 143          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Match: Dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:MGI Symbol;Acc:MGI:1914963])

HSP 1 Score: 88.5817 bits (218), Expect = 7.527e-21
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:  175 EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            E KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   55 EPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Match: Dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:MGI Symbol;Acc:MGI:1914963])

HSP 1 Score: 87.8113 bits (216), Expect = 1.363e-20
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = 1
Query:  175 EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            E KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   49 EPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 107          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Match: Dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:MGI Symbol;Acc:MGI:1914963])

HSP 1 Score: 57.3806 bits (137), Expect = 1.109e-9
Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1
Query:  175 EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDR 291
            E KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+
Sbjct:   55 EPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDK 93          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Match: Dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:MGI Symbol;Acc:MGI:1914963])

HSP 1 Score: 56.9954 bits (136), Expect = 2.594e-9
Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1
Query:  175 EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDR 291
            E KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+
Sbjct:   55 EPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDK 93          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Match: sp|Q9VTJ8|TIM14_DROME (Mitochondrial import inner membrane translocase subunit TIM14 OS=Drosophila melanogaster OX=7227 GN=Tim14 PE=3 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 8.966e-28
Identity = 68/116 (58.62%), Postives = 83/116 (71.55%), Query Frame = 1
Query:   25 MASTVXXXXXXXXXXXXXXRHLSKNGCQ----FSQKLKQLKFLNG----SSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            MAS+VIL GL + A G  G+HL +   Q    F++ LK L   +     +SKYY GGF+ KM KREASLILGVS +++K KI ++HKK M+LNHPDR GSPYLAAKINEAKD LDK
Sbjct:    1 MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDK 116          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Match: sp|Q6PBT7|TIM14_DANRE (Mitochondrial import inner membrane translocase subunit TIM14 OS=Danio rerio OX=7955 GN=dnajc19 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.931e-27
Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 1
Query:  106 QFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            Q  Q L+  K   GS  YY GGF+ KM +REASLILGVS  + K KI E+H+K MILNHPDR GSPYLAAKINEAKD+LD Q
Sbjct:   32 QVKQALEASKSAFGSG-YYRGGFDPKMNRREASLILGVSPTANKTKIREAHRKLMILNHPDRGGSPYLAAKINEAKDLLDGQ 112          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Match: sp|Q3ZBN8|TIM14_BOVIN (Mitochondrial import inner membrane translocase subunit TIM14 OS=Bos taurus OX=9913 GN=DNAJC19 PE=3 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 8.163e-27
Identity = 51/90 (56.67%), Postives = 65/90 (72.22%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + KAKI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   27 KHMEPQVKQVFQSLPKTAFSGG---YYRGGFEPKMTKREAALILGVSPTANKAKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Match: sp|Q5RF34|TIM14_PONAB (Mitochondrial import inner membrane translocase subunit TIM14 OS=Pongo abelii OX=9601 GN=DNAJC19 PE=3 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 6.792e-26
Identity = 50/90 (55.56%), Postives = 64/90 (71.11%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   27 KHMEPQVKQVFQSLPKSAFSGG---YYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Match: sp|Q96DA6|TIM14_HUMAN (Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 6.792e-26
Identity = 50/90 (55.56%), Postives = 64/90 (71.11%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            +H+     Q  Q L +  F  G   YY GGFE KMTKREA+LILGVS  + K KI ++H++ M+LNHPD+ GSPY+AAKINEAKD+L+ Q
Sbjct:   27 KHMEPQVKQVFQSLPKSAFSGG---YYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Match: A0A3B3ZIQ6 (DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.173e-27
Identity = 56/83 (67.47%), Postives = 69/83 (83.13%), Query Frame = 1
Query:  100 GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            G  FS+ +K++  L  S+ YY GGFEQKMTKREASLILG+S  STKAK+ E+H+K M+LNHPD+ GSPY+AAKINEAKD+LDK
Sbjct:   34 GQVFSESVKKMPSLAFSA-YYKGGFEQKMTKREASLILGISPTSTKAKLREAHRKIMVLNHPDKGGSPYIAAKINEAKDLLDK 115          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Match: A2RQR9 (DnaJ domain-containing protein OS=Siniperca chuatsi OX=119488 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.946e-27
Identity = 53/84 (63.10%), Postives = 69/84 (82.14%), Query Frame = 1
Query:  100 GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            G  FS+ +K++   +  S YY GGFEQKM+KREASL+LG+S  STKAK+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LDK+
Sbjct:   63 GQIFSETVKKMP-TSAFSSYYKGGFEQKMSKREASLVLGISPTSTKAKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLDKE 145          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Match: A0A3P9D235 (DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.103e-27
Identity = 58/90 (64.44%), Postives = 72/90 (80.00%), Query Frame = 1
Query:   85 HLSKN-GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            HL K  G  FS+ +K++     SS YY GGFEQKM+KREASLILG+S  STKAK+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LDK+
Sbjct:   58 HLWKPLGQVFSETVKKMPSSTFSS-YYKGGFEQKMSKREASLILGISPASTKAKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLDKE 146          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Match: A0A3P8R716 (DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.589e-27
Identity = 58/90 (64.44%), Postives = 72/90 (80.00%), Query Frame = 1
Query:   85 HLSKN-GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            HL K  G  FS+ +K++     SS YY GGFEQKM+KREASLILG+S  STKAK+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LDK+
Sbjct:   58 HLWKPLGQVFSETVKKMPSSTFSS-YYKGGFEQKMSKREASLILGISPASTKAKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLDKE 146          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Match: A0A3Q2W0V9 (DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.589e-27
Identity = 58/90 (64.44%), Postives = 72/90 (80.00%), Query Frame = 1
Query:   85 HLSKN-GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            HL K  G  FS+ +K++     SS YY GGFEQKM+KREASLILG+S  STKAK+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LDK+
Sbjct:   58 HLWKPLGQVFSETVKKMPSSTFSS-YYKGGFEQKMSKREASLILGISPASTKAKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLDKE 146          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Cavefish
Match: dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:NCBI gene;Acc:103042432])

HSP 1 Score: 112.079 bits (279), Expect = 2.181e-29
Identity = 56/90 (62.22%), Postives = 63/90 (70.00%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            R + +   Q  Q L+        S YY GGFE KMTKREASLILGVS  + K KI E+H+K MILNHPDR GSPYLAAKINEAKD+LD Q
Sbjct:   24 RAMKQMEPQVKQALQAFPKTAFGSGYYRGGFEPKMTKREASLILGVSPTANKNKIREAHRKLMILNHPDRGGSPYLAAKINEAKDLLDGQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Cavefish
Match: dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:NCBI gene;Acc:103029295])

HSP 1 Score: 111.309 bits (277), Expect = 1.194e-28
Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILD 345
            S YY GGFEQKMTKREASLILG+S  STKAK+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+L+
Sbjct:   81 SAYYKGGFEQKMTKREASLILGISPTSTKAKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLE 145          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Cavefish
Match: dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:NCBI gene;Acc:103029295])

HSP 1 Score: 80.4925 bits (197), Expect = 1.020e-17
Identity = 34/48 (70.83%), Postives = 41/48 (85.42%), Query Frame = 1
Query:  151 SKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRN 294
            S YY GGFEQKMTKREASLILG+S  STKAK+ E+H++ M+LNHPD+ 
Sbjct:   81 SAYYKGGFEQKMTKREASLILGISPTSTKAKVREAHRRIMVLNHPDKE 128          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Yeast
Match: PAM18 (Subunit of the import motor (PAM complex); the PAM complex is a component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); essential J-protein cochaperone that stimulates Ssc1p ATPase activity to drive import; inhibited by Pam16p [Source:SGD;Acc:S000003998])

HSP 1 Score: 77.0258 bits (188), Expect = 3.725e-17
Identity = 40/79 (50.63%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  133 KFLNG---SSKYYHGGFEQKMTKREASLILGVSQNS-TKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ*I 357
            K LNG   ++ +  GGF+ KM  +EA  IL +++N+ TK K+ E H+K M+ NHPD+ GSP+LA KINEAKD L+K+ I
Sbjct:   88 KGLNGGKSTTAFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Yeast
Match: MDJ2 (Constituent of the mitochondrial import motor; associated with the presequence translocase; function overlaps with that of Pam18p; stimulates the ATPase activity of Ssc1p to drive mitochondrial import; contains a J domain [Source:SGD;Acc:S000005272])

HSP 1 Score: 71.633 bits (174), Expect = 1.948e-15
Identity = 33/67 (49.25%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  160 YHGGFEQKMTKREASLILGVSQNST----KAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            Y GGF  +MT+ EA LIL +S        +  + + H+K M+ NHPDR GSPY+AAKINEAK++L++
Sbjct:   73 YQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEAKEVLER 139          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Nematostella
Match: EDO30800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR3])

HSP 1 Score: 98.5969 bits (244), Expect = 1.398e-25
Identity = 43/63 (68.25%), Postives = 54/63 (85.71%), Query Frame = 1
Query:  160 YHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDK 348
            Y GGFE KMTKREA+LILG+S  S K K+ E+H++ M++NHPDR GSPY+AAKINEAKD+LD+
Sbjct:    2 YRGGFEPKMTKREAALILGISPASQKNKVREAHRRIMLINHPDRGGSPYIAAKINEAKDLLDE 64          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Medaka
Match: dnajc15 (DnaJ heat shock protein family (Hsp40) member C15 [Source:NCBI gene;Acc:101156448])

HSP 1 Score: 112.849 bits (281), Expect = 4.780e-29
Identity = 52/84 (61.90%), Postives = 68/84 (80.95%), Query Frame = 1
Query:  100 GCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            G  FS+ L+++   +  S YY GGFEQKM++REASLILG+S  STK K+ E+H++ M+LNHPD+ GSPYLAAKINEAKD+LDK+
Sbjct:   85 GQVFSETLRKMPS-SAFSSYYKGGFEQKMSRREASLILGISPTSTKNKVREAHRRIMVLNHPDKGGSPYLAAKINEAKDLLDKE 167          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Medaka
Match: dnajc19 (DnaJ heat shock protein family (Hsp40) member C19 [Source:NCBI gene;Acc:101162514])

HSP 1 Score: 95.1301 bits (235), Expect = 3.420e-23
Identity = 43/59 (72.88%), Postives = 50/59 (84.75%), Query Frame = 1
Query:  175 EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            E KMTKREA+L+LGVS  + K KI E+H+K MILNHPDR GSPYLAAKINEAKD++D Q
Sbjct:   55 EPKMTKREAALVLGVSPTANKMKIREAHRKLMILNHPDRGGSPYLAAKINEAKDLMDDQ 113          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Planmine SMEST
Match: SMESG000039858.1 (SMESG000039858.1)

HSP 1 Score: 362.073 bits (928), Expect = 3.414e-125
Identity = 176/178 (98.88%), Postives = 176/178 (98.88%), Query Frame = 1
Query:  520 MFHLNAILEKSIREGNVTEAVNSLTKIFDNGYSFQISLAKRQGNPIAANVNVFDADMSMPLKLKMYVYKEDNFYDIKRKVCGELSISSPYQQKLFLCKGTIAEVKYEFPNDTELISDFFKTEDDFKLNPICIFVTQACPSVEFKAESFQQSNSKWACSSCSFQNSSDIINCLACGKMK 1053
            MFHLNAILEKSIREGNVTEAVNSLTKIFDNGYS QISLAKRQGNPIAANVNVFDADMSMPLKLKMYVYKEDNFYDIKRKVCGELSISSPYQQKLFLCKGTIAEVKYEFPNDTELISDFFKTEDDFKLNPICIFVTQACPSVEFK ESFQQSNSKWACSSCSFQNSSDIINCLACGKMK
Sbjct:    1 MFHLNAILEKSIREGNVTEAVNSLTKIFDNGYSCQISLAKRQGNPIAANVNVFDADMSMPLKLKMYVYKEDNFYDIKRKVCGELSISSPYQQKLFLCKGTIAEVKYEFPNDTELISDFFKTEDDFKLNPICIFVTQACPSVEFKTESFQQSNSKWACSSCSFQNSSDIINCLACGKMK 178          
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Planmine SMEST
Match: SMESG000039857.1 (SMESG000039857.1)

HSP 1 Score: 184.882 bits (468), Expect = 3.516e-57
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
Query:   82 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 351
            RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ
Sbjct:   18 RHLSKNGCQFSQKLKQLKFLNGSSKYYHGGFEQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKINEAKDILDKQ 107          
The following BLAST results are available for this feature:
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC191.414e-2655.56DnaJ heat shock protein family (Hsp40) member C19 ... [more]
DNAJC191.773e-2655.56DnaJ heat shock protein family (Hsp40) member C19 ... [more]
DNAJC191.773e-2655.56DnaJ heat shock protein family (Hsp40) member C19 ... [more]
DNAJC153.043e-2569.23DnaJ heat shock protein family (Hsp40) member C15 ... [more]
DNAJC192.016e-875.00DnaJ heat shock protein family (Hsp40) member C19 ... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnj-211.882e-2551.69Mitochondrial import inner membrane translocase su... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG73948.945e-2958.62gene:FBgn0036173 transcript:FBtr0333215[more]
CG73948.945e-2958.62gene:FBgn0036173 transcript:FBtr0076098[more]
CG73948.945e-2958.62gene:FBgn0036173 transcript:FBtr0305648[more]
CG73941.196e-2859.14gene:FBgn0036173 transcript:FBtr0290024[more]
CG327271.888e-1143.84gene:FBgn0265265 transcript:FBtr0071056[more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnajc151.951e-2873.85DnaJ (Hsp40) homolog, subfamily C, member 15 [Sour... [more]
dnajc196.666e-2865.85DnaJ (Hsp40) homolog, subfamily C, member 19 [Sour... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hnf1a7.245e-2653.57HNF1 homeobox A [Source:Xenbase;Acc:XB-GENE-484117... [more]
dnajc151.254e-2469.23DnaJ heat shock protein family (Hsp40) member C15 ... [more]
dnajc151.300e-1743.69DnaJ heat shock protein family (Hsp40) member C15 ... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc152.710e-2673.85DnaJ heat shock protein family (Hsp40) member C15 ... [more]
Dnajc197.527e-2166.10DnaJ heat shock protein family (Hsp40) member C19 ... [more]
Dnajc191.363e-2066.10DnaJ heat shock protein family (Hsp40) member C19 ... [more]
Dnajc191.109e-961.54DnaJ heat shock protein family (Hsp40) member C19 ... [more]
Dnajc192.594e-961.54DnaJ heat shock protein family (Hsp40) member C19 ... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VTJ8|TIM14_DROME8.966e-2858.62Mitochondrial import inner membrane translocase su... [more]
sp|Q6PBT7|TIM14_DANRE4.931e-2765.85Mitochondrial import inner membrane translocase su... [more]
sp|Q3ZBN8|TIM14_BOVIN8.163e-2756.67Mitochondrial import inner membrane translocase su... [more]
sp|Q5RF34|TIM14_PONAB6.792e-2655.56Mitochondrial import inner membrane translocase su... [more]
sp|Q96DA6|TIM14_HUMAN6.792e-2655.56Mitochondrial import inner membrane translocase su... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3ZIQ61.173e-2767.47DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Pe... [more]
A2RQR93.946e-2763.10DnaJ domain-containing protein OS=Siniperca chuats... [more]
A0A3P9D2354.103e-2764.44DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Ma... [more]
A0A3P8R7164.589e-2764.44DnaJ (Hsp40) homolog, subfamily C, member 15 OS=As... [more]
A0A3Q2W0V94.589e-2764.44DnaJ (Hsp40) homolog, subfamily C, member 15 OS=Ha... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnajc192.181e-2962.22DnaJ heat shock protein family (Hsp40) member C19 ... [more]
dnajc151.194e-2875.38DnaJ heat shock protein family (Hsp40) member C15 ... [more]
dnajc151.020e-1770.83DnaJ heat shock protein family (Hsp40) member C15 ... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PAM183.725e-1750.63Subunit of the import motor (PAM complex); the PAM... [more]
MDJ21.948e-1549.25Constituent of the mitochondrial import motor; ass... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO308001.398e-2568.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnajc154.780e-2961.90DnaJ heat shock protein family (Hsp40) member C15 ... [more]
dnajc193.420e-2372.88DnaJ heat shock protein family (Hsp40) member C19 ... [more]
back to top
BLAST of Mitochondrial import inner membrane translocase subunit TIM14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039858.13.414e-12598.88SMESG000039858.1[more]
SMESG000039857.13.516e-57100.00SMESG000039857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014556 ID=SMED30014556|Name=Mitochondrial import inner membrane translocase subunit TIM14|organism=Schmidtea mediterranea sexual|type=transcript|length=1424bp
TAAATAACTATTTTAGCTTTCAAAATGGCTTCTACAGTTATTTTAACGGG
TTTAGGATTAACTGCTGCCGGCCTGATAGGTAGACATTTATCAAAAAATG
GCTGTCAATTTTCTCAAAAGTTAAAACAATTAAAGTTTCTTAATGGTTCA
TCAAAGTATTATCACGGCGGTTTTGAACAAAAAATGACGAAGCGTGAGGC
GTCATTGATACTTGGTGTGAGTCAAAATTCAACCAAAGCTAAAATAAGCG
AAAGTCATAAAAAGAAAATGATATTGAATCATCCAGATCGAAATGGATCT
CCTTATTTGGCAGCAAAAATTAATGAAGCAAAAGATATATTAGATAAACA
GTAAATTAGGACAAGCATTTCAGTTTTCATTAGAATATATTTTTGCTTAT
TTTTTGAATTTCCTTGTTTTAACGCTTCAAATTATAATTTAGCATCCTGT
AATTTTAAAATTTAAACGAGATTTTGATTATAATTATTTAACTCTATATT
TAAATACAAATTTAATAGAATGTTTCATTTAAATGCTATTCTTGAAAAAA
GCATACGTGAAGGAAATGTTACTGAAGCAGTAAATAGTTTAACGAAGATT
TTTGACAATGGTTATTCGTTTCAAATTTCTTTAGCTAAGCGCCAGGGAAA
TCCTATTGCGGCTAATGTTAATGTTTTTGATGCAGATATGTCAATGCCAC
TTAAATTGAAAATGTATGTTTATAAGGAAGACAACTTTTATGATATTAAA
CGAAAAGTTTGTGGTGAATTATCAATTAGTTCTCCGTACCAACAGAAATT
ATTCCTATGCAAGGGCACAATAGCTGAAGTTAAATACGAATTTCCAAATG
ATACAGAACTAATTAGTGATTTTTTTAAAACAGAAGACGATTTCAAATTA
AATCCCATTTGTATATTTGTTACTCAAGCATGTCCTAGTGTTGAGTTTAA
AGCAGAATCGTTTCAACAATCCAATTCGAAATGGGCTTGTTCCAGTTGCA
GTTTTCAAAACAGTTCTGATATTATAAATTGCTTGGCCTGTGGTAAAATG
AAGTGATTCCGCAAAATTAACTGTTGAATTAACTGATTGCTTATGACTAT
ATTTGTATTTGGCTATTCTAGTTATGCTATTTATCATTTCATATGATTGC
TGATTTTCGTGGTAGACGTTAAATAACTAATTTCCAGCAACATTACTTTG
ATTGGCGAGAGCATTCTGTACCAACTTTCATTATTTTCAATGTTTTGATA
CGTAGTTTTATCATTACGATTCCTACTTTAGTTTGGAGTTTTATTTTCTA
TAATTTCATCTTTTTCTACAAATTTGAGCCAAATTTGAAATTTTTATCGA
TTTATTATTTTCTAATGAATTTCATTCCCTTTTCATGTTAATTTGTTATT
AATTCATCAATTTGTTTTTACCGC
back to top

protein sequence of SMED30014556-orf-1

>SMED30014556-orf-1 ID=SMED30014556-orf-1|Name=SMED30014556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=179bp
MFHLNAILEKSIREGNVTEAVNSLTKIFDNGYSFQISLAKRQGNPIAANV
NVFDADMSMPLKLKMYVYKEDNFYDIKRKVCGELSISSPYQQKLFLCKGT
IAEVKYEFPNDTELISDFFKTEDDFKLNPICIFVTQACPSVEFKAESFQQ
SNSKWACSSCSFQNSSDIINCLACGKMK*
back to top

protein sequence of SMED30014556-orf-2

>SMED30014556-orf-2 ID=SMED30014556-orf-2|Name=SMED30014556-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MASTVILTGLGLTAAGLIGRHLSKNGCQFSQKLKQLKFLNGSSKYYHGGF
EQKMTKREASLILGVSQNSTKAKISESHKKKMILNHPDRNGSPYLAAKIN
EAKDILDKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001876Znf_RanBP2
IPR001623DnaJ_domain
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0001671ATPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0001405presequence translocase-associated import motor
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005744mitochondrial inner membrane presequence translocase complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
GO:0022008neurogenesis
GO:0030150protein import into mitochondrial matrix
GO:0032781positive regulation of ATPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 153..177
e-value: 7.2E-4
score: 28.9
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 155..174
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 150..178
score: 9.179