Prominin (Prom) protein, putative

Overview
NameProminin (Prom) protein, putative
Smed IDSMED30014549
Length (bp)2743
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prominin (Prom) protein, putative (SMED30014549) t-SNE clustered cells

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30014549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prominin (Prom) protein, putative (SMED30014549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30014549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30014549SMESG000013192.1 dd_Smed_v4_1386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014549SMESG000013192.1 dd_Smed_v4_1386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30014549SMESG000013192.1 dd_Smed_v4_1386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014549SMESG000013192.1 dd_Smed_v6_1386_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Match: PROM1 (prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454])

HSP 1 Score: 51.6026 bits (122), Expect = 7.378e-8
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query: 1953 IDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKP 2174
            +D F C  ++ P N FW+GIG   VF +PA+IFAVKLA  YR  +       E  Y        ++ + IPMK P
Sbjct:    2 VDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMD------SEDVY--------DDVETIPMKNP 62          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Match: PROM1 (prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454])

HSP 1 Score: 51.9878 bits (123), Expect = 1.148e-7
Identity = 31/86 (36.05%), Postives = 43/86 (50.00%), Query Frame = 3
Query: 1920 CVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKP 2174
            C  +  +    +D F C  ++ P N FW+GIG   VF +PA+IFAVKLA  YR  +       E  Y        ++ + IPMK P
Sbjct:   19 CKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMD------SEDVY--------DDVETIPMKNP 90          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Match: PROM1 (prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454])

HSP 1 Score: 56.6102 bits (135), Expect = 2.224e-7
Identity = 36/117 (30.77%), Postives = 56/117 (47.86%), Query Frame = 3
Query: 1812 LEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQ-------------VKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYH 2120
            L+F  + ++NN +S +  E K    +  IG ++                C  +  +    +D F C  ++ P N FW+GIG   VF +PA+IFAVKLA  YR  +     Y++P  H
Sbjct:  720 LDFAQNFITNNTSSVIIEETKK-YGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDV-YDDPSQH 834          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Match: PROM1 (prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454])

HSP 1 Score: 54.6842 bits (130), Expect = 8.725e-7
Identity = 40/135 (29.63%), Postives = 61/135 (45.19%), Query Frame = 3
Query: 1812 LEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQ-------------VKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKP 2174
            L+F  + ++NN +S +  E K    +  IG ++                C  +  +    +D F C  ++ P N FW+GIG   VF +PA+IFAVKLA  YR  +       E  Y        ++ + IPMK P
Sbjct:  720 LDFAQNFITNNTSSVIIEETKK-YGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMD------SEDVY--------DDVETIPMKNP 839          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Match: PROM1 (prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454])

HSP 1 Score: 53.1434 bits (126), Expect = 2.566e-6
Identity = 40/138 (28.99%), Postives = 63/138 (45.65%), Query Frame = 3
Query: 1812 LEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQ-------------VKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSG 2183
            L+F  + ++NN +S +  E K    +  IG ++                C  +  +    +D F C  ++ P N FW+GIG   VF +PA+IFAVKLA  YR  +       E  Y        ++ + IPMK  ++G
Sbjct:  711 LDFAQNFITNNTSSVIIEETKK-YGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMD------SEDVY--------DDVETIPMKNMENG 833          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 62.003 bits (149), Expect = 3.892e-9
Identity = 80/335 (23.88%), Postives = 141/335 (42.09%), Query Frame = 3
Query: 1248 RICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEAC-----RYLTNSYGD-----GVKSIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNV--------NKDLLSSEVLKKI---AYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNIAXXXXXXXXXXXXXXQ------YPFKQKCLEFFDSN------VSNNLNSALTIEVKSILNKVYIG-------------SYDQVKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEP 2111
            R C    G N +MAGV F+F+F+  +M   +  F  GG  +   C     R L  +  D     G+ +  ++  LF+    +  N+ I     D + ++  T+++ ++  +        N +  SS  + +I   A+++   KS  K +L+ ++   + +  D + K  L +   L     S   I         +    KQ        F+ K L+   +       ++NN +S +  E K ++++V IG             ++D   C  + N     +D F C  ++   N FW+G+G   V  IPAIIFA++LA  YR       D E+P
Sbjct:  471 RGCISNTGGNFLMAGVGFSFIFSWILMLIVLVTFLAGGNVEKLVCEPFQERALDTNISDCKENKGIFTALQIDNLFNLNEFLNINMYI-----DEISSRIETLNLDLSNIILLDEKGKRNLEDFSSTGIDEIDFDAFLSEVAKSNTKVDLL-AFANELEENADLLPKGALGN--ALKGHANSIRTIHIQQVVPLEQSMVKKQKILKACITFQGKVLDVITAVEAAQNLINNNASSVIKQESKKLMDEV-IGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRM-----DTEDP 791          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 58.9214 bits (141), Expect = 3.807e-8
Identity = 78/344 (22.67%), Postives = 145/344 (42.15%), Query Frame = 3
Query: 1248 RICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEAC-----RYLTNSYGD----------GVKSIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNV--------NKDLLSSEVLKKI---AYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNIAXXXXXXXXXXXXXXQ--YPFKQKCLEFFDSN------VSNNLNSALTIEVKSILNKVYIG-------------SYDQVKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHT------EKYSADYEEPDY 2117
            R C    G N +MAGV F+F+F+  +M   +  F  GG  +   C     R L     D          G+ +  ++  LF+    +  N+ I     D + ++  T+++ ++  +        N +  SS  + +I   A+++   KS  K +L+ ++   + +  D + K  L +       +G  N+I  +       ++   +    F+ K L+   +       ++NN +S +  E K ++++V IG             ++D   C  + N     +D F C  ++   N FW+G+G   V  IPAIIFA++LA  YR        ++Y   Y E  +
Sbjct:  464 RGCISNTGGNFLMAGVGFSFIFSWILMLIVLVTFLAGGNVEKLVCEPFQERALFKVCRDTNISDCKENKGIFTALQIDNLFNLNEFLNINMYI-----DEISSRIETLNLDLSNIILLDEKGKRNLEDFSSTGIDEIDFDAFLSEVAKSNTKVDLL-AFANELEENADLLPKGALGNAL-----KGHANSIRTIHIQQVVPLEQSMKACITFQGKVLDVITAVEAAQNLINNNASSVIKQESKKLMDEV-IGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDTEDVYDEYGISYPETHF 795          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 53.1434 bits (126), Expect = 2.525e-6
Identity = 38/138 (27.54%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 1833 VSNNLNSALTIEVKSILNKVYIG-------------SYDQVKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            ++NN +S +  E K ++++V IG             ++D   C  + N     +D F C  ++   N FW+G+G   V  IPAIIFA++LA  YR  +       E  Y        ++ + +PMK  ++G +   N 
Sbjct:  716 INNNASSVIKQESKKLMDEV-IGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDT------EDVY--------DDVETVPMKNLENGNNGYHNE 838          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 52.7582 bits (125), Expect = 3.287e-6
Identity = 38/138 (27.54%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 1833 VSNNLNSALTIEVKSILNKVYIG-------------SYDQVKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            ++NN +S +  E K ++++V IG             ++D   C  + N     +D F C  ++   N FW+G+G   V  IPAIIFA++LA  YR  +       E  Y        ++ + +PMK  ++G +   N 
Sbjct:  741 INNNASSVIKQESKKLMDEV-IGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDT------EDVY--------DDVETVPMKNLENGNNGYHNE 863          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 52.7582 bits (125), Expect = 3.322e-6
Identity = 38/138 (27.54%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 1833 VSNNLNSALTIEVKSILNKVYIG-------------SYDQVKCVGMYNSTKMLIDAF-CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            ++NN +S +  E K ++++V IG             ++D   C  + N     +D F C  ++   N FW+G+G   V  IPAIIFA++LA  YR  +       E  Y        ++ + +PMK  ++G +   N 
Sbjct:  747 INNNASSVIKQESKKLMDEV-IGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDT------EDVY--------DDVETVPMKNLENGNNGYHNE 869          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A158QFZ3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9741 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.014e-37
Identity = 122/424 (28.77%), Postives = 192/424 (45.28%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDG----------------------VKSIDEMLKLFSKQSKVKS------NLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSS------EVLKKIAYIANKMKSTGKEELIK--------SYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNI---AXXXXXXXXXXXXXXQYPFKQKCLEFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNA---DNIP-------MKKPKSGKSSQKNRTSS---FNNKDS-LKQTNPQYLPVYPYDSYE 2285
            FG CG+RP E+A  CNRGVGAN +++G+ F FLF+  +M     +F + G  QTE CRY+T+ Y +G                      V+    +L   + +S V S       +++ +N+ +S +      S+   FN   DL+S       + L K+  + +  +    + L K        S FE     L+ ++ E LKD   +  +  S   I   + +    +        Y    + L  F S +   + +++ I+++S+       L    I S+  + C  ++++    +D  C   + P NG W+G+GI LV  IP +IF VKL  LYR TEKYS DYE+PDY SY  FY   A    + P        K   S +S  K    S   F+++      +  Q + VYPYD+YE
Sbjct:  345 FGVCGDRPHEEASFCNRGVGANFLLSGIVFTFLFSTLLMIVCTVIFLSAGLVQTEVCRYVTDRYPNGPAVFDDTVEAFFASLKSVGVANVRPFSTLLTRCANESLVDSLGDEAVGIMVSDNSINSFLE-----SILRTFN-GVDLISPLRKTAVDTLNKLNEVRDLQRYDFSQALQKTSERLTEISDFEAYITQLESLDIENLKDPIMILKETVSSLTIRMDSPIRQLYADLQSIRGTYNQLAEELNSFSSELDRTVPTSIRIQIESMRPLFLKELRLAVIASWRDIPCTRLHSAATNAVDTVCHNFMNPPNGIWFGLGIFLVLCIPVLIFGVKLVNLYRKTEKYSPDYEQPDYISYHAFYMRPAASEGDAPSRKKRRPRKGKASDRSQSKGDNGSAYGFSHRHGPASNSTYQTVSVYPYDAYE 762          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A564YL07 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6965 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.750e-36
Identity = 122/424 (28.77%), Postives = 192/424 (45.28%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDG----------------------VKSIDEMLKLFSKQSKVKS------NLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSS------EVLKKIAYIANKMKSTGKEELIK--------SYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNI---AXXXXXXXXXXXXXXQYPFKQKCLEFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNA---DNIP-------MKKPKSGKSSQKNRTSS---FNNKDS-LKQTNPQYLPVYPYDSYE 2285
            FG CG+RP E+A  CNRGVGAN +++G+ F FLF+  +M     +F + G  QTE CRY+T+ Y +G                      V+    +L   + +S V S       +++ +N+ +S +      S+   FN   DL+S       + L K+  + +  +    + L K        S FE     L+ ++ E LKD   +  +  S   I   + +    +        Y    + L  F S +   + +++ I+++S+       L    I S+  + C  ++++    +D  C   + P NG W+G+GI LV  IP +IF VKL  LYR TEKYS DYE+PDY SY  FY   A    + P        K   S +S  K    S   F+++      +  Q + VYPYD+YE
Sbjct:  445 FGVCGDRPHEEASFCNRGVGANFLLSGIVFTFLFSTLLMIVCTVIFLSAGLVQTEVCRYVTDRYPNGPAVFDDTVEAFFASLKSVGVANVRPFSTLLTRCANESLVDSLGDEAVGIMVSDNSINSFLE-----SILRTFN-GVDLISPLRKTAVDTLNKLNEVRDLQRYDFSQALQKTSERLTEISDFEAYITQLESLDIENLKDPIMILKETVSSLTIRMDSPIRQLYADLQSIRGTYNQLAEELNSFSSELDRTVPTSIRIQIESMRPLFLKELRLAVIASWRDIPCTRLHSAATNAVDTVCHNFMNPPNGIWFGLGIFLVLCIPVLIFGVKLVNLYRKTEKYSPDYEQPDYISYHAFYMRPAASEGDAPSRKKRRPRKGKASDRSQSKGDNGSAYGFSHRHGPASNSTYQTVSVYPYDAYE 862          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A564YL70 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6965 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.782e-35
Identity = 107/365 (29.32%), Postives = 169/365 (46.30%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDG----------------------VKSIDEMLKLFSKQSKVKS------NLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSS------EVLKKIAYIANKMKSTGKEELIK--------SYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNI---AXXXXXXXXXXXXXXQYPFKQKCLEFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNA 2150
            FG CG+RP E+A  CNRGVGAN +++G+ F FLF+  +M     +F + G  QTE CRY+T+ Y +G                      V+    +L   + +S V S       +++ +N+ +S +      S+   FN   DL+S       + L K+  + +  +    + L K        S FE     L+ ++ E LKD   +  +  S   I   + +    +        Y    + L  F S +   + +++ I+++S+       L    I S+  + C  ++++    +D  C   + P NG W+G+GI LV  IP +IF VKL  LYR TEKYS DYE+PDY SY  FY   A
Sbjct:  445 FGVCGDRPHEEASFCNRGVGANFLLSGIVFTFLFSTLLMIVCTVIFLSAGLVQTEVCRYVTDRYPNGPAVFDDTVEAFFASLKSVGVANVRPFSTLLTRCANESLVDSLGDEAVGIMVSDNSINSFLE-----SILRTFN-GVDLISPLRKTAVDTLNKLNEVRDLQRYDFSQALQKTSERLTEISDFEAYITQLESLDIENLKDPIMILKETVSSLTIRMDSPIRQLYADLQSIRGTYNQLAEELNSFSSELDRTVPTSIRIQIESMRPLFLKELRLAVIASWRDIPCTRLHSAATNAVDTVCHNFMNPPNGIWFGLGIFLVLCIPVLIFGVKLVNLYRKTEKYSPDYEQPDYISYHAFYMRPA 803          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A2T7PN92 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06106 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.104e-29
Identity = 111/373 (29.76%), Postives = 169/373 (45.31%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGVKSIDEMLK--------LFSKQSKVKSNLII--CNNT--------FDSLINKCPTMSMAMAFNVNKDLLSSEV------LKKIAYIANKMKSTGKEELIKSYFENIYDTL-DGIEKETLKDNQYLGFDEGSFNNIAXXXXXXXXXXXXXXQYPFKQKC----LEFFDSNVSNNL--NSALTIEVKSILNKVYIGSYDQV------------KCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRH-TEKYSADYEEPDYHSYMGFY-TNNADNIPMKKPKSGKSSQ 2195
            FG CGERP   A  CN G GAN +MAGV F FL+T  +M   + LF  GG   TE CRY  +     +++   +L+        LF ++  +    I+  C N          D ++N    ++   +  VNK+L ++++      L  +A + N   +  K   + S   ++  TL   +   T   NQ LG  E                    KQ   K K        + S  + NL  N+ +T +++ ++N V+  S   V            +C  +Y+S  M  D+ CV+ L P N FW+ +G CL F +P +IFAVKLAGLYR  TEK   D++ P++  Y G Y  N+ D IP+     G+ + 
Sbjct:  486 FGLCGERPGFGAPCCNTGTGANFLMAGVGFTFLYTWLLMLVCIILFVTGGIAYTEVCRYFNSHNPSDLQAFSNVLREATAFEKTLFDEKVNLDVAEILEKCQNNEAVYSVMKLDHMVN----ITQYTSLEVNKNLTAAKLDQMAINLLSLATMQNDRTNKEKLTTLSSELTDLERTLVSAMTNSTRSLNQSLGILE--------------------KQVTIKVKTQILLTGLYQSQTNFNLRKNALVTEQLRVVINDVWNKSQSAVDEILYKVQNENGRCRPLYDSFYMASDSVCVSALDPLNAFWFSLGWCLFFFVPCLIFAVKLAGLYRRETEKEYDDFDRPNF--YGGMYGGNHQDTIPLTSVDRGQQAH 832          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A3P7CWM4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9918 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.421e-27
Identity = 59/174 (33.91%), Postives = 95/174 (54.60%), Query Frame = 3
Query: 1797 FKQKCLEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNRTSS-----------FNNKDSLKQTNPQYLPVYPYDSYE 2285
            F Q   +   +++   +N   ++ ++  L    I S+ ++ C  ++ ++   +DA CVT L P NGFW   G CL+ +I ++IFAVKL  LYR  EKYS DYEEPDY SY GFY    + + +++P+  +  + N+              F+++     +N Q + VYPYD+YE
Sbjct:   90 FSQDLEQTVPNSIHARINDMRSLFLRE-LRLAVIASWREIPCTNLHTASVSAVDALCVTYLGPLNGFWASFGTCLLLSIVSLIFAVKLVSLYRKIEKYSPDYEEPDYISYHGFYMRPTNEVDVQRPRKRRGQKGNKNDRNGGGGGKDAYGFSHRHGPSNSNYQQVSVYPYDAYE 262          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Cavefish
Match: prom2 (prominin-1-A-like [Source:NCBI gene;Acc:103040130])

HSP 1 Score: 52.7582 bits (125), Expect = 1.606e-6
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3
Query: 1917 KCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYE 2105
            +C  +  +     +  C  L+   N FW+ +G C+VF IP+IIF+VKLA  YR   K++  YE
Sbjct:  746 RCRPVAAAVNTAENLICAQLVDSLNAFWFSLGWCMVFLIPSIIFSVKLAKFYRRM-KFTDVYE 807          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Match: prom1b (prominin 1 b [Source:ZFIN;Acc:ZDB-GENE-031003-1])

HSP 1 Score: 54.299 bits (129), Expect = 1.219e-7
Identity = 33/87 (37.93%), Postives = 45/87 (51.72%), Query Frame = 3
Query: 1965 CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEK---YSADYEEP----DYHS--YMGFYTNNADNIPMKKPKSGKSSQK 2198
            C  ++   N FW+G+G   VF IP+IIFAVKLA  YR  +    Y  D   P    D+ S  Y    ++  DN   K P SG+S ++
Sbjct:  784 CSYVMDSLNAFWFGLGWATVFLIPSIIFAVKLAKYYRRMDTEDVYDEDEHIPMTNMDFGSNGYQTRQSHGIDNPVAKSPYSGESWER 870          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000308.1 (pep scaffold:Pmarinus_7.0:GL477401:35780:63383:-1 gene:ENSPMAG00000000265.1 transcript:ENSPMAT00000000308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.286e-6
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 3
Query: 1950 LIDAF----CVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEE 2108
            LID+     C  L+   N FW+G+G   +F IP++IFAVKLA  YR  +    DY E
Sbjct:  656 LIDSIELIGCKYLVNSMNSFWFGLGWATIFLIPSVIFAVKLAKFYRRMDTED-DYSE 711          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Nematostella
Match: EDO38922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH1])

HSP 1 Score: 61.6178 bits (148), Expect = 1.365e-9
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 3
Query: 1917 KCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNRTSSFNNKDSLKQTNPQYLPVY 2267
            KC  + N     +   C  LL+P+NGFW  +G CL F IP+IIF+VKLA  YR   KY +D+++        F         M +P       + +    N K+S+    P   P Y
Sbjct:  787 KCKPLTNIFDGTVMYMCNDLLYPFNGFWLSMGFCLFFFIPSIIFSVKLAKHYRCM-KYESDFDQEGMAGMEAF--------EMAQPPPYNDVGQEKKLWANPKNSVYPKAPSAPPQY 894          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000013192.1 (SMESG000013192.1)

HSP 1 Score: 1271.53 bits (3289), Expect = 0.000e+0
Identity = 738/739 (99.86%), Postives = 738/739 (99.86%), Query Frame = 3
Query:   69 MKLFSCLLLTFAIFISIVFGNDDKTNAANVENLKILRKSVNFSYKIGNDFLDFIRGSTPTHEAITHLMDVLNSNEQQKLNRIVPVFMPXXXXXXXXXXXXXXXXXMPIXXXXXXXXXXXXXXXXXXXXMDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHXXXXXXXXXXXXXXXXXRNNDGMIDKTQFQDVLSRQYFNKLKVDSFNEKVKDSLSLIMEALSQTTNFLQRVKKPNXXXXXXXXXXXXYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSKPELTTGSVLKRIVNEYNTTVVVNIDQMLKAYNRNIKQEFLEYRMXXXXXXXXXXXXXXXXXXXXXXFGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGVKSIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSSEVLKKIAYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNIAXXXXXXXXXXXXXXQYPFKQKCLEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNRTSSFNNKDSLKQTNPQYLPVYPYDSYE 2285
            MKLFSCLLLTFAIFISIVFGNDDKTNAANVENLKILRKSVNFSYKIGNDFLDFIRGSTPTHEAITHLMDVLNSNEQQKLNRIVPVFMPFIGYIILLIIGVLFVVLMPIVGFCFCLCRCGGKCGGKVKGMDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHNSLSNISIEISNAEKSSRNNDGMIDKTQFQDVLSRQYFNKLKVDSFNEKVKDSLSLIMEALSQTTNFLQRVKKPNEKLKDLETKLKTYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSKPELTTGSVLKRIVNEYNTTVVVNIDQMLKAYNRNIKQEFLEYRMYICIGVCCLLLLIVLFYFLGLCFGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMG TMTLFTNGGFTQTEACRYLTNSYGDGVKSIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSSEVLKKIAYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNIAKLFSSTSSKVKSFKQYPFKQKCLEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNRTSSFNNKDSLKQTNPQYLPVYPYDSYE
Sbjct:    1 MKLFSCLLLTFAIFISIVFGNDDKTNAANVENLKILRKSVNFSYKIGNDFLDFIRGSTPTHEAITHLMDVLNSNEQQKLNRIVPVFMPFIGYIILLIIGVLFVVLMPIVGFCFCLCRCGGKCGGKVKGMDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHNSLSNISIEISNAEKSSRNNDGMIDKTQFQDVLSRQYFNKLKVDSFNEKVKDSLSLIMEALSQTTNFLQRVKKPNEKLKDLETKLKTYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSKPELTTGSVLKRIVNEYNTTVVVNIDQMLKAYNRNIKQEFLEYRMYICIGVCCLLLLIVLFYFLGLCFGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGITMTLFTNGGFTQTEACRYLTNSYGDGVKSIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNVNKDLLSSEVLKKIAYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGFDEGSFNNIAKLFSSTSSKVKSFKQYPFKQKCLEFFDSNVSNNLNSALTIEVKSILNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNRTSSFNNKDSLKQTNPQYLPVYPYDSYE 739          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.593e-16
Identity = 45/137 (32.85%), Postives = 75/137 (54.74%), Query Frame = 3
Query: 1815 EFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            E F+SN+   + S   I +K I       +N ++   + +V CV +  +   ++   C  ++ P NG WYG+G+ L+  IP++IFA+ L  LYR  +K+  D +EPDY +Y+GFY   AD   +KK  + +    +R
Sbjct:  638 EIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYA-RADGDGVKKNPANQGKPPHR 773          

HSP 2 Score: 69.3218 bits (168), Expect = 1.030e-11
Identity = 37/87 (42.53%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGV----KSIDEMLKLFSKQSK 1460
            FG CGERP EDA   NRGVGAN ++  V   FL +  IM   ++        QT+ CRY TNS  D      K +D+ L L  K +K
Sbjct:  405 FGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAK 491          

HSP 3 Score: 62.003 bits (149), Expect = 1.940e-9
Identity = 57/191 (29.84%), Postives = 103/191 (53.93%), Query Frame = 3
Query:  453 MDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHXXXXXXXXXXXXXXXXXRNNDGMIDKTQFQDVLS--RQYFNKLKVDSFNEKVKDSLSLIMEALS--QTTNFLQRVKKPNXXXXXXXXXXXXYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSK 1013
            MDPKH  CK+  Y++ L  ++VIM+  +++   NNQL+H+++ N    IN   Q+KN  E +  +L  +  EI  A  S  +N+ M  +  F+++ S  +++F+ L   S    + D   ++ +A+   + +NF   +K  N+KLK+L   L     N+ +TK++  +SD     K   D+LK +   +S+
Sbjct:   90 MDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHM--QKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNI-STKLSPCLSDQCRDMKDKIDSLKVITVDESQ 277          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.949e-16
Identity = 45/137 (32.85%), Postives = 75/137 (54.74%), Query Frame = 3
Query: 1815 EFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            E F+SN+   + S   I +K I       +N ++   + +V CV +  +   ++   C  ++ P NG WYG+G+ L+  IP++IFA+ L  LYR  +K+  D +EPDY +Y+GFY   AD   +KK  + +    +R
Sbjct:  668 EIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYA-RADGDGVKKNPANQGKPPHR 803          

HSP 2 Score: 69.3218 bits (168), Expect = 9.652e-12
Identity = 37/87 (42.53%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGV----KSIDEMLKLFSKQSK 1460
            FG CGERP EDA   NRGVGAN ++  V   FL +  IM   ++        QT+ CRY TNS  D      K +D+ L L  K +K
Sbjct:  435 FGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAK 521          

HSP 3 Score: 62.003 bits (149), Expect = 1.797e-9
Identity = 57/191 (29.84%), Postives = 103/191 (53.93%), Query Frame = 3
Query:  453 MDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHXXXXXXXXXXXXXXXXXRNNDGMIDKTQFQDVLS--RQYFNKLKVDSFNEKVKDSLSLIMEALS--QTTNFLQRVKKPNXXXXXXXXXXXXYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSK 1013
            MDPKH  CK+  Y++ L  ++VIM+  +++   NNQL+H+++ N    IN   Q+KN  E +  +L  +  EI  A  S  +N+ M  +  F+++ S  +++F+ L   S    + D   ++ +A+   + +NF   +K  N+KLK+L   L     N+ +TK++  +SD     K   D+LK +   +S+
Sbjct:  120 MDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHM--QKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNI-STKLSPCLSDQCRDMKDKIDSLKVITVDESQ 307          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 82.8037 bits (203), Expect = 7.989e-16
Identity = 45/137 (32.85%), Postives = 75/137 (54.74%), Query Frame = 3
Query: 1815 EFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 2204
            E F+SN+   + S   I +K I       +N ++   + +V CV +  +   ++   C  ++ P NG WYG+G+ L+  IP++IFA+ L  LYR  +K+  D +EPDY +Y+GFY   AD   +KK  + +    +R
Sbjct:  664 EIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYA-RADGDGVKKNPANQGKPPHR 799          

HSP 2 Score: 69.3218 bits (168), Expect = 1.031e-11
Identity = 37/87 (42.53%), Postives = 46/87 (52.87%), Query Frame = 3
Query: 1212 FGQCGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGV----KSIDEMLKLFSKQSK 1460
            FG CGERP EDA   NRGVGAN ++  V   FL +  IM   ++        QT+ CRY TNS  D      K +D+ L L  K +K
Sbjct:  431 FGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAK 517          

HSP 3 Score: 62.003 bits (149), Expect = 1.689e-9
Identity = 57/191 (29.84%), Postives = 103/191 (53.93%), Query Frame = 3
Query:  453 MDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHXXXXXXXXXXXXXXXXXRNNDGMIDKTQFQDVLS--RQYFNKLKVDSFNEKVKDSLSLIMEALS--QTTNFLQRVKKPNXXXXXXXXXXXXYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSK 1013
            MDPKH  CK+  Y++ L  ++VIM+  +++   NNQL+H+++ N    IN   Q+KN  E +  +L  +  EI  A  S  +N+ M  +  F+++ S  +++F+ L   S    + D   ++ +A+   + +NF   +K  N+KLK+L   L     N+ +TK++  +SD     K   D+LK +   +S+
Sbjct:  116 MDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHM--QKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNI-STKLSPCLSDQCRDMKDKIDSLKVITVDESQ 303          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000062666.1 (SMESG000062666.1)

HSP 1 Score: 73.559 bits (179), Expect = 4.805e-13
Identity = 43/110 (39.09%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 1869 VKSILNKVYIGSYDQV-KCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYR--HTEKYSADYEEPDYHSYMG----FYTNNADNIPMKKPK 2177
            VK+ +N+   G +     C    NS    ++ FCV +L P+N  W G+G  L+F IPAIIFAVKL G+YR  H E  SA Y     H+YM        N  + I M +P+
Sbjct:  717 VKATINQTLYGLFTVAGDCKEASNSVNSAVNIFCVIILGPFNNIWMGMGWFLLFIIPAIIFAVKLTGIYRITHVETESAAYN----HAYMSSNQFLNKNGLEMIRMGRPQ 822          
The following BLAST results are available for this feature:
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PROM17.378e-840.00prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454][more]
PROM11.148e-736.05prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454][more]
PROM12.224e-730.77prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454][more]
PROM18.725e-729.63prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454][more]
PROM12.566e-628.99prominin 1 [Source:HGNC Symbol;Acc:HGNC:9454][more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prom13.892e-923.88prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom13.807e-822.67prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom12.525e-627.54prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom13.287e-627.54prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom13.322e-627.54prominin 1 [Source:NCBI gene;Acc:100036621][more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QFZ36.014e-3728.77Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YL071.750e-3628.77Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YL702.782e-3529.32Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A2T7PN921.104e-2929.76Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3P7CWM44.421e-2733.91Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prom21.606e-638.10prominin-1-A-like [Source:NCBI gene;Acc:103040130][more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prom1b1.219e-737.93prominin 1 b [Source:ZFIN;Acc:ZDB-GENE-031003-1][more]
ENSPMAT00000000308.16.286e-643.86pep scaffold:Pmarinus_7.0:GL477401:35780:63383:-1 ... [more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO389221.365e-932.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013192.10.000e+099.86SMESG000013192.1[more]
SMESG000025078.17.593e-1632.85SMESG000025078.1[more]
SMESG000025078.17.949e-1632.85SMESG000025078.1[more]
SMESG000025078.17.989e-1632.85SMESG000025078.1[more]
SMESG000062666.14.805e-1339.09SMESG000062666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014549 ID=SMED30014549|Name=Prominin (Prom) protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2743bp
TCTAATTATACACTATATTTTGATCCCCAAATTTCAGAAAGTGAAAATTA
ATTTTGCGTATTGAAGGAATGAAGTTATTTTCATGTTTGCTTTTAACTTT
TGCAATATTCATTTCTATCGTATTTGGAAATGATGATAAAACCAATGCAG
CGAATGTCGAAAATTTAAAAATTCTCAGAAAGAGTGTCAATTTCTCATAC
AAAATCGGAAATGATTTCTTGGATTTTATTCGAGGAAGTACTCCCACACA
TGAAGCTATAACTCATCTAATGGATGTTTTGAATAGTAATGAACAACAAA
AACTAAATCGAATCGTTCCGGTTTTCATGCCGTTTATTGGATATATTATA
TTACTAATAATTGGGGTTTTATTTGTTGTTCTGATGCCTATTGTTGGATT
TTGCTTCTGCTTATGTCGATGTGGAGGGAAATGTGGTGGTAAAGTTAAAG
GTATGGACCCTAAACATGCTATATGCAAACGATATACTTATGCCGTTCTA
TTAGGCATGATTTCTGTTATTATGCTAGCTGGTATTGTTCTAGCGTTTAT
TAATAATCAACTAATTCATGATACACTAACAAATCCAAGTAAAGAAATCA
ATGCCATTTCCCAAATCAAAAACAGTGCGGAACTTATGCACAATTCTCTT
TCTAATATTTCAATTGAAATCTCAAACGCAGAAAAGTCCTCCAGGAACAA
TGATGGGATGATAGATAAAACTCAGTTTCAAGATGTGCTCAGTCGCCAAT
ACTTTAATAAGCTAAAAGTGGATTCTTTTAATGAAAAAGTCAAAGACAGT
CTAAGTCTAATAATGGAAGCTTTATCACAAACTACAAACTTCCTACAAAG
AGTCAAGAAACCCAATGAAAAATTAAAGGATCTCGAAACTAAACTGAAAA
CCTATATTGAAAATCTCGAAACTACGAAAATGAATCAAGCAGTCTCAGAT
TTGTTATCAACTTGTAAATCCGATTTCGATGCATTGAAACAATTAATGAA
AAGCCAATCTAAACCAGAATTAACTACGGGTTCGGTTTTAAAAAGGATAG
TCAATGAATACAATACTACAGTGGTAGTAAACATTGATCAAATGCTCAAA
GCATATAACAGAAATATAAAACAAGAATTTTTAGAATACAGAATGTATAT
ATGTATCGGAGTTTGCTGCTTACTTCTTCTCATTGTTCTATTTTATTTTC
TTGGATTATGCTTTGGGCAATGTGGTGAAAGACCATTTGAAGATGCTAGA
ATATGCAACAGAGGTGTAGGAGCTAATCTCATGATGGCTGGTGTTGCTTT
TGCATTTTTATTTACTCCTTCAATAATGGGTTTCACAATGACATTATTCA
CGAATGGCGGATTTACTCAAACGGAAGCATGTCGTTATCTTACAAATTCA
TATGGAGACGGTGTGAAGTCAATAGATGAAATGCTGAAATTATTTTCAAA
GCAATCCAAAGTTAAATCGAATTTGATTATTTGCAACAATACTTTTGATA
GCTTGATAAATAAATGCCCAACGATGTCAATGGCTATGGCTTTTAATGTG
AACAAAGATCTCTTATCCTCGGAGGTTTTGAAAAAGATTGCTTATATAGC
AAATAAAATGAAGAGTACCGGAAAGGAAGAACTAATAAAATCTTATTTTG
AAAATATTTACGACACATTGGATGGTATTGAGAAAGAAACTCTGAAAGAT
AATCAATATTTGGGTTTTGATGAAGGAAGCTTTAATAATATTGCTAAATT
ATTTTCTTCGACTTCTTCAAAAGTTAAAAGTTTTAAGCAGTATCCATTCA
AACAAAAATGTCTTGAGTTTTTTGATTCTAACGTTTCAAATAATTTAAAT
TCTGCTTTGACGATTGAAGTGAAATCTATCTTAAATAAAGTCTATATCGG
TTCTTACGACCAAGTCAAATGTGTTGGAATGTATAATTCTACGAAGATGT
TAATTGATGCATTTTGCGTTACTTTGCTCTGGCCATATAATGGATTCTGG
TATGGAATTGGAATTTGCCTGGTTTTTACAATTCCTGCCATTATATTTGC
CGTCAAATTAGCTGGCTTATATCGGCACACGGAAAAATATTCGGCAGATT
ACGAAGAACCTGATTATCATTCATATATGGGATTTTATACCAATAATGCT
GACAACATTCCGATGAAGAAGCCTAAATCGGGAAAATCTAGTCAAAAAAA
TAGAACTTCAAGTTTTAATAACAAGGATTCTTTGAAACAAACAAATCCCC
AATATTTGCCCGTTTATCCTTACGATTCGTATGAATAAAATATTCTAATG
AAATCCGCAATCTCCTGTAAAGCGATTTATTGGTCATTTGAAGACAGCAA
TACACTTTTCTCATCATTGATATTCATTTTATATCTTAATAATAATAATA
ATGAGTAACCTAGTCCGAGTAGTTTAAAATTCCATTTTCTCATGAATTGG
AACACCTGTACAAAAAATATGAACTTTACACATCCAGCGTAATTTTACTA
TAAGTGTTGTGAATTTCATTGTCTTATTGTTATTTTGCTATTCATACTCT
TAAACATGGGCGCGACCAACAGAGAATGAATGAAAATTTTATTATGTCAA
ACATTTATGTAAACTTTTTATGTTTAATCTCATTTTTTATTCATGCAATG
AAATATGTGGTCGATTTTAGTTTTTGTATTTATGATTGAAGATATTATGT
ATATTCATGGTGTACTTATAATAAAATTTATTAAAGTTTTCCA
back to top

protein sequence of SMED30014549-orf-1

>SMED30014549-orf-1 ID=SMED30014549-orf-1|Name=SMED30014549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=740bp
MKLFSCLLLTFAIFISIVFGNDDKTNAANVENLKILRKSVNFSYKIGNDF
LDFIRGSTPTHEAITHLMDVLNSNEQQKLNRIVPVFMPFIGYIILLIIGV
LFVVLMPIVGFCFCLCRCGGKCGGKVKGMDPKHAICKRYTYAVLLGMISV
IMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHNSLSNISIE
ISNAEKSSRNNDGMIDKTQFQDVLSRQYFNKLKVDSFNEKVKDSLSLIME
ALSQTTNFLQRVKKPNEKLKDLETKLKTYIENLETTKMNQAVSDLLSTCK
SDFDALKQLMKSQSKPELTTGSVLKRIVNEYNTTVVVNIDQMLKAYNRNI
KQEFLEYRMYICIGVCCLLLLIVLFYFLGLCFGQCGERPFEDARICNRGV
GANLMMAGVAFAFLFTPSIMGFTMTLFTNGGFTQTEACRYLTNSYGDGVK
SIDEMLKLFSKQSKVKSNLIICNNTFDSLINKCPTMSMAMAFNVNKDLLS
SEVLKKIAYIANKMKSTGKEELIKSYFENIYDTLDGIEKETLKDNQYLGF
DEGSFNNIAKLFSSTSSKVKSFKQYPFKQKCLEFFDSNVSNNLNSALTIE
VKSILNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGIC
LVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMK
KPKSGKSSQKNRTSSFNNKDSLKQTNPQYLPVYPYDSYE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008795Prominin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 269..289
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 702..731
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 700..739
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.902
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 357..379
NoneNo IPR availableTMHMMTMhelixcoord: 400..422
NoneNo IPR availableTMHMMTMhelixcoord: 3..20
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 642..664
IPR008795PromininPFAMPF05478Prominincoord: 487..669
e-value: 6.2E-12
score: 44.3
coord: 32..308
e-value: 6.6E-31
score: 107.1
coord: 230..443
e-value: 2.7E-22
score: 78.6
IPR008795PromininPANTHERPTHR22730PROMININ PROM PROTEINcoord: 24..333
coord: 618..703
coord: 245..443