GCR037

Overview
NameGCR037
Smed IDSMED30014545
Length (bp)1592
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR037 (SMED30014545) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR037 (SMED30014545) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR037 (SMED30014545) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR037 (SMED30014545) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014545

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014545SMESG000065390.1 SmedASXL_008358SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014545SMESG000065390.1 dd_Smed_v6_31134_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR037 vs. Ensembl Human
Match: HTR2B (5-hydroxytryptamine receptor 2B [Source:HGNC Symbol;Acc:HGNC:5294])

HSP 1 Score: 174.096 bits (440), Expect = 1.114e-47
Identity = 127/435 (29.20%), Postives = 206/435 (47.36%), Query Frame = 3
Query:  141 WAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWM-ISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            WA L +L++ I TI GN LV ++V LEK+LQ   NYFL+SLAV+D L  + VMP++ + ++   +   WP  L  C AW  LDV F+  +I+HLC IS+DRY+A+  P++ +Q   + + FIKI++ WLI  GIA P+ +  ++ +  N    +          F++   +  F  PL IM+++Y LT+  ++K                   ++ + K   P                         ++L+ L++ST F R     C    ++P K+   +DG +              +  ++P   +   + R S++  + ++  +N                           ++A +VLGIVF LF+  + PFF+  +T   C SC   T  M +    WIGY +S +NP+VY +FN TFR  F R I C
Sbjct:   56 WAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM---WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQK-------------------KAYLVKNKPP-------------------------QRLTWLTVSTVFQRDE-TPC----SSPEKVAM-LDGSR--------------KDKALPNSGDETLMRRTSTIGKKSVQTISN--------------------------EQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITC 397          
BLAST of GCR037 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 149.828 bits (377), Expect = 3.657e-39
Identity = 123/433 (28.41%), Postives = 207/433 (47.81%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNS-------KVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + ISI W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +R++ K ++    S +   H ++    +  + + M    L T I+  N        +V  +      + ++ +LS ST    R+  S    P  PS  Q  +           G  S        P +    + H   +   E ++   N    + L   SRR  +        QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISIVWVLSFTISCPLLFG---LNNADQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM---KLCTVIMKSNGSFPVNRRRVVQEAARRAQELEMEMLS-STSPPERTRYS----PIPPSHHQLTLPDPSH-----HGLHSTPDSPAK-PEKNGHAKDHPKIAKIFE-IQTMPNGKTRTSLKTMSRRKLSQ-------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 445          
BLAST of GCR037 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 147.132 bits (370), Expect = 1.930e-38
Identity = 116/426 (27.23%), Postives = 203/426 (47.65%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + ISI W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +R++ K ++    S +   H ++   ++    + +    L+++     ++    +  S +Q  L       D S   L S  + P  P K     +G  + +     K +++    ++P  K                         + L   SRR  +        QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISIVWVLSFTISCPLLFG---LNNADQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKEAARRAQELEMEMLSSTSPPERTRY-SPIPPSHHQLTLP------DPSHHGLHSTPDSPAKPEK-----NGHAKDH----PKIAKIFEIQTMPNGKT-----------------------RTSLKTMSRRKLSQ-------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 414          
BLAST of GCR037 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 145.206 bits (365), Expect = 1.392e-37
Identity = 124/434 (28.57%), Postives = 202/434 (46.54%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSK--------VCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + ISI W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +R++ K ++    S +   H ++    +  + + M    L T I+  N                  L  E LS    ST    R+  S    P  PS  Q  +           G  S        P +    + H   +   E ++   N    + L   SRR  +        QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISIVWVLSFTISCPLLFG---LNNADQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM---KLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLS----STSPPERTRYS----PIPPSHHQLTLPDPSH-----HGLHSTPDSPAK-PEKNGHAKDHPKIAKIFE-IQTMPNGKTRTSLKTMSRRKLSQ-------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 443          
BLAST of GCR037 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 145.206 bits (365), Expect = 1.392e-37
Identity = 124/434 (28.57%), Postives = 202/434 (46.54%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSK--------VCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + ISI W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +R++ K ++    S +   H ++    +  + + M    L T I+  N                  L  E LS    ST    R+  S    P  PS  Q  +           G  S        P +    + H   +   E ++   N    + L   SRR  +        QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISIVWVLSFTISCPLLFG---LNNADQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM---KLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLS----STSPPERTRYS----PIPPSHHQLTLPDPSH-----HGLHSTPDSPAK-PEKNGHAKDHPKIAKIFE-IQTMPNGKTRTSLKTMSRRKLSQ-------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 443          
BLAST of GCR037 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 170.244 bits (430), Expect = 8.342e-46
Identity = 124/435 (28.51%), Postives = 210/435 (48.28%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNG---WPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT-----KNLDSFSTNGHRKS----RFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSR---RIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCY 1445
            GN LV V++  ++RL N  NYFL SLA++D L   +VMP+S V    V++ +G   W   +CL +   DVF  + +I+H+  IS+DRY+ ++ PLR  + + K  +FIKI+I W++   ++CP+ + ++  +T N   ++   C   +  +I+    +TF++PL IM ++Y  T + + KQ      K  D F+ NG R++    +   +  Y  ++  T      +  + +    +++  N E    L      SR S+               N +G K+                          L + S++N  + R  +N++ N    V  R   + AT DL+        KA +VL +VF  F  C+ PFF I     F      I  W+ S   W+GY +S +NP++Y +FN  FR+ F R++RC+C+
Sbjct:   24 GNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIV----VEVRHGVWTWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLR-TRNRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH-DTANILRNN--QCMIFSRYYIIYGSTMTFLIPLCIMGVTYAKTTQLLNKQASILSQKAGDKFNGNGLRRTMPHRKLGYARTYSATVNGTIANGKAIGAHGRTMSSISNIANGETADRLGT----SRPSI---------------NTNGHKQ--------------------------LQKASTINKWKSR-TSNLVTNFANKVGRRSSLQTATQDLA-----NEHKATRVLAVVFACFFICWTPFFFINFLIGFGGENVQIPDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCF 399          
BLAST of GCR037 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 170.629 bits (431), Expect = 1.316e-45
Identity = 124/435 (28.51%), Postives = 210/435 (48.28%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNG---WPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT-----KNLDSFSTNGHRKS----RFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSR---RIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCY 1445
            GN LV V++  ++RL N  NYFL SLA++D L   +VMP+S V    V++ +G   W   +CL +   DVF  + +I+H+  IS+DRY+ ++ PLR  + + K  +FIKI+I W++   ++CP+ + ++  +T N   ++   C   +  +I+    +TF++PL IM ++Y  T + + KQ      K  D F+ NG R++    +   +  Y  ++  T      +  + +    +++  N E    L      SR S+               N +G K+                          L + S++N  + R  +N++ N    V  R   + AT DL+        KA +VL +VF  F  C+ PFF I     F      I  W+ S   W+GY +S +NP++Y +FN  FR+ F R++RC+C+
Sbjct:   72 GNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIV----VEVRHGVWTWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLR-TRNRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH-DTANILRNN--QCMIFSRYYIIYGSTMTFLIPLCIMGVTYAKTTQLLNKQASILSQKAGDKFNGNGLRRTMPHRKLGYARTYSATVNGTIANGKAIGAHGRTMSSISNIANGETADRLGT----SRPSI---------------NTNGHKQ--------------------------LQKASTINKWKSR-TSNLVTNFANKVGRRSSLQTATQDLA-----NEHKATRVLAVVFACFFICWTPFFFINFLIGFGGENVQIPDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCF 447          
BLAST of GCR037 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 135.961 bits (341), Expect = 2.287e-34
Identity = 126/476 (26.47%), Postives = 216/476 (45.38%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQ--LCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLS---SLKIETMNQEESS--FKGCGPNNAIFIMTAVIVTFILPLLIMMISY--ILTVKTIR----KQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SISTDFSRRSLMSCNNFP---------------------TTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVN---------------SRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFC---VSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GNILV +SV + KR++   N  L SLA +D L  ++VMP+S + ++H    + WP    LC  W + DV     +I++LC IS+DRY A+ +PL++ +T+ +      ++  W I F +  P ++    +L I+  N   SS  FK     +  + + + + +F LPLL+M+  Y  I  V + R    +Q+      S    +  + +Q    + +    S T   +N N   C  +N+S+   + +     S+     R     C + P                     + P+ +Q+      E         + +      P RKNT  +    S+ S+R R C     N+RL  N                + +  S   + Y+++ RKA++ +GIV   F+ C+MPFF++YL + F    V+   I      +  W+GYS S++NP++Y ++N  FRR F  L+   C +
Sbjct:    9 GNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLH---NHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHN---CGRVNYSVRPVEYANRVENSLKPSHERFDSTDCEDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKEAKNSMERECH---SLADIVNSADTPVRKNT-EVGVAPSL-SKRARQC-----NARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRE-RKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 467          
BLAST of GCR037 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 135.961 bits (341), Expect = 4.926e-34
Identity = 126/476 (26.47%), Postives = 216/476 (45.38%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQ--LCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLS---SLKIETMNQEESS--FKGCGPNNAIFIMTAVIVTFILPLLIMMISY--ILTVKTIR----KQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SISTDFSRRSLMSCNNFP---------------------TTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVN---------------SRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFC---VSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GNILV +SV + KR++   N  L SLA +D L  ++VMP+S + ++H    + WP    LC  W + DV     +I++LC IS+DRY A+ +PL++ +T+ +      ++  W I F +  P ++    +L I+  N   SS  FK     +  + + + + +F LPLL+M+  Y  I  V + R    +Q+      S    +  + +Q    + +    S T   +N N   C  +N+S+   + +     S+     R     C + P                     + P+ +Q+      E         + +      P RKNT  +    S+ S+R R C     N+RL  N                + +  S   + Y+++ RKA++ +GIV   F+ C+MPFF++YL + F    V+   I      +  W+GYS S++NP++Y ++N  FRR F  L+   C +
Sbjct:   88 GNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLH---NHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHN---CGRVNYSVRPVEYANRVENSLKPSHERFDSTDCEDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKEAKNSMERECH---SLADIVNSADTPVRKNT-EVGVAPSL-SKRARQC-----NARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRE-RKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 546          
BLAST of GCR037 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 135.961 bits (341), Expect = 6.823e-34
Identity = 121/475 (25.47%), Postives = 217/475 (45.68%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQ--LCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFL---SSLKIETMNQEESS--FKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKV-----CDDLNHSLNQEKLSLL---SISTDFSRRSLMSCNNFP---------------------TTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVN---------------SRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFC---VSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GNILV +SV + KR++   N  L SLA +D L  ++VMP+S + ++H    + WP    LC  W + DV     +I++LC IS+DRY A+ +PL++ +T+ +      ++  W I F +  P ++    +L I+  N   SS  FK     +  + + + + +F LPLL+M+  Y    +   ++   +          +R ++++  +K+  +   T S  +  ++V     C  +N+S+   + +     S+     R     C + P                     + P+ +Q+      E         + +      P RKNT  +    S+ S+R R C     N+RL  N                + +  S   + Y+++ RKA++ +GIV   F+ C+MPFF++YL + F    V+   I      +  W+GYS S++NP++Y ++N  FRR F  L+   C +
Sbjct:  116 GNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLH---NHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQ--QKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSVRPVEYANRVENSLKPSHERFDSTDCEDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKEAKNSMERECH---SLADIVNSADTPVRKNT-EVGVAPSL-SKRARQC-----NARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRE-RKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 574          
BLAST of GCR037 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343171)

HSP 1 Score: 143.665 bits (361), Expect = 4.964e-36
Identity = 123/448 (27.46%), Postives = 204/448 (45.54%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENID------GDKETYF------DFRGK-------FSRLSRQMSIPFRKN-------TLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCK-----SITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLI 1430
            GNILV +SV  E+ LQ   NYF+VSLA++D L A++VMP +   +V+      W  P  +C  + ++DV  + ++I +L  ISIDRY+A+  P+++ + K    + + I + W I   I  P+ L      T N+E      C   NA FI+ + + +F +P +IM+  Y    K +R + +          RK   S+       +   S+  +I          L+ S +  +     I  D +  +  S +N     + I  +ID       DK T F      +  G        F R   Q ++   +N       +    R    NS+  R    +    + S   R  +++       +K RKA + L IV G+F+ C++PFF   + D  C   K      +T++M+  + W+GY  S +NPV+Y IFNP FR+ F +++
Sbjct:  392 GNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVN----GAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLG--LNNTPNREPDV---CAFYNADFILYSSLSSFYIPCIIMVFLYWNIFKALRSRARK-----QRAARKPHLSE-------LTGGSVIENIAQTRRLAETALDSSRHASR-----ILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNVAMKPLSFVRYGVQEAMTLARNDSTLSTTSKTSSRKDKKNSQASRF--TIYKVHKASKKKREKSSA-------KKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMM--TTWLGYINSFVNPVIYTIFNPEFRKAFKKIM 802          
BLAST of GCR037 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343167)

HSP 1 Score: 142.895 bits (359), Expect = 8.929e-36
Identity = 118/435 (27.13%), Postives = 194/435 (44.60%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENID------GDKETYF------DFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCK-----SITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIR 1433
            GNILV +SV  E+ LQ   NYF+VSLA++D L A++VMP +   +V+      W  P  +C  + ++DV  + ++I +L  ISIDRY+A+  P+++ + K    + + I + W I   I  P+ L      T N+E      C   NA FI+ + + +F +P +IM+  Y    K +R + +          RK   S+       +   S+  +I          L+ S +  +     I  D +  +  S +N     + I  +ID       DK T F      +  GKF+               ++H+ S    E+                              +K RKA + L IV G+F+ C++PFF   + D  C   K      +T++M+  + W+GY  S +NPV+Y IFNP FR+ F +++ 
Sbjct:  392 GNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVN----GAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLG--LNNTPNREPDV---CAFYNADFILYSSLSSFYIPCIIMVFLYWNIFKALRSRARK-----QRAARKPHLSE-------LTGGSVIENIAQTRRLAETALDSSRHASR-----ILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGKFT-------------IYKVHKASKKKREK---------------------------SSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMM--TTWLGYINSFVNPVIYTIFNPEFRKAFKKIMH 758          
BLAST of GCR037 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0303603)

HSP 1 Score: 134.806 bits (338), Expect = 4.357e-33
Identity = 71/185 (38.38%), Postives = 111/185 (60.00%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKG-CGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDS 737
            GNILV +++  E+RLQN  NYFL+SLA++D + A+LVMP+  + +V      G  H  CL W  LDV F   +I+HLCTIS+DRY++L  P+RF + K +  + +KI   WL+   ++ PL L    + + N       G C   + ++ +   IV F +PL +M+++Y LTV+ + +Q +NL  
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEH--CLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL----MYSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGG 268          

HSP 2 Score: 83.1889 bits (204), Expect = 2.193e-16
Identity = 51/141 (36.17%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 1056 RKNTLRLH--RNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKS-ITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRS 1469
            R+ T+R H  RNSSV                +S NS R        R I+  +KA +VLG+VF  FV  + PFFV+ L    C  C+  I+ W+     W+GY++SM+NP+ Y IFN  FR+ F +++ CR    S ++ S
Sbjct:  785 RQQTVRSHHSRNSSV----------------ISRNSSRHG------RIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCRYSSTSAWRPS 903          
BLAST of GCR037 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0339322)

HSP 1 Score: 134.806 bits (338), Expect = 4.357e-33
Identity = 71/185 (38.38%), Postives = 111/185 (60.00%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKG-CGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDS 737
            GNILV +++  E+RLQN  NYFL+SLA++D + A+LVMP+  + +V      G  H  CL W  LDV F   +I+HLCTIS+DRY++L  P+RF + K +  + +KI   WL+   ++ PL L    + + N       G C   + ++ +   IV F +PL +M+++Y LTV+ + +Q +NL  
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEH--CLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL----MYSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGG 268          

HSP 2 Score: 83.1889 bits (204), Expect = 2.193e-16
Identity = 51/141 (36.17%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 1056 RKNTLRLH--RNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKS-ITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRS 1469
            R+ T+R H  RNSSV                +S NS R        R I+  +KA +VLG+VF  FV  + PFFV+ L    C  C+  I+ W+     W+GY++SM+NP+ Y IFN  FR+ F +++ CR    S ++ S
Sbjct:  785 RQQTVRSHHSRNSSV----------------ISRNSSRHG------RIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCRYSSTSAWRPS 903          
BLAST of GCR037 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0330144)

HSP 1 Score: 134.806 bits (338), Expect = 5.007e-33
Identity = 71/185 (38.38%), Postives = 111/185 (60.00%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKG-CGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDS 737
            GNILV +++  E+RLQN  NYFL+SLA++D + A+LVMP+  + +V      G  H  CL W  LDV F   +I+HLCTIS+DRY++L  P+RF + K +  + +KI   WL+   ++ PL L    + + N       G C   + ++ +   IV F +PL +M+++Y LTV+ + +Q +NL  
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYFPLGSEH--CLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL----MYSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGG 268          

HSP 2 Score: 83.1889 bits (204), Expect = 2.188e-16
Identity = 51/141 (36.17%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 1056 RKNTLRLH--RNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKS-ITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRS 1469
            R+ T+R H  RNSSV                +S NS R        R I+  +KA +VLG+VF  FV  + PFFV+ L    C  C+  I+ W+     W+GY++SM+NP+ Y IFN  FR+ F +++ CR    S ++ S
Sbjct:  785 RQQTVRSHHSRNSSV----------------ISRNSSRHG------RIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCRYSSTSAWRPS 903          
BLAST of GCR037 vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 149.058 bits (375), Expect = 2.010e-39
Identity = 113/421 (26.84%), Postives = 194/421 (46.08%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GN  V  ++ LE+ LQN  NY + SLAV+D + ++LV+P++ +  V    T G   ++C  + SLDV    ++I+HLC I++DRY A+ +P+ +   +      I IS++WLI F I+ P  L   K E     ++        +  + + +    F +PL++M++ Y                      R +RF   +  KK        T    +  K C  ++ +L   K +     T   RRS+  C N       ++ + DG+    F+     S     +S+P        +RN   N+E                  R++A        + + RK V+ LGI+ G F+ C++PFF++ L   FC  C  +  W+ +   W+GYS S++NPV+Y  FN  F+  F ++++C+C +
Sbjct:   45 GNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLG--QEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPMLGWRKPEDRADPDACTIS---QDHGYTIYSTFGAFYIPLILMLVLY------------------GRIFRAARFRIRKTVKK--------TEKAKIADK-CLAVSPALFPRKANGEVGKT--WRRSVEPCAN-----GALKNSDDGES---FEITEVQSISKNHLSLPNNPQPCFENRNEK-NTEA----------------KRKVA--------LARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCQDC-FMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKCIR 397          
BLAST of GCR037 vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 148.673 bits (374), Expect = 6.007e-39
Identity = 119/425 (28.00%), Postives = 207/425 (48.71%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSR-QMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + IS+ W++ F I+CPL        T +        C   N  F++ + IV+F +P +I ++ Y+     +RK+ K +++  T        S S I K + P      +++  +S  C   N ++   K  +++   D     + + N     PS+ Q   D    +  + R   S L    +S P  +  ++  RN   N+  +   A             + +   L+ R I  QK +KA Q+L IV G+F+ C++PFF+ ++ + +C     +   + +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISVVWILSFAISCPLLFGLNNTVTHDDAL-----CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVNTKRTCPVTDMDMS-STIKKCTHPDDVKLCTVIVKSSGNCPVNNKNVIFIK-EVVNNGDDIQMDEITNRN-----PSR-QRKQDQSGGSQQNSRLVNSNLRETDISPPSPEAGVKPERNG--NTSSITKGAKAFEIQVSPTGKTQTSVKTLNKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHIVNTYC----QVPPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of GCR037 vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 148.673 bits (374), Expect = 6.007e-39
Identity = 119/425 (28.00%), Postives = 207/425 (48.71%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSR-QMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + IS+ W++ F I+CPL        T +        C   N  F++ + IV+F +P +I ++ Y+     +RK+ K +++  T        S S I K + P      +++  +S  C   N ++   K  +++   D     + + N     PS+ Q   D    +  + R   S L    +S P  +  ++  RN   N+  +   A             + +   L+ R I  QK +KA Q+L IV G+F+ C++PFF+ ++ + +C     +   + +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISVVWILSFAISCPLLFGLNNTVTHDDAL-----CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVNTKRTCPVTDMDMS-STIKKCTHPDDVKLCTVIVKSSGNCPVNNKNVIFIK-EVVNNGDDIQMDEITNRN-----PSR-QRKQDQSGGSQQNSRLVNSNLRETDISPPSPEAGVKPERNG--NTSSITKGAKAFEIQVSPTGKTQTSVKTLNKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHIVNTYC----QVPPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of GCR037 vs. Ensembl Zebrafish
Match: drd2b (dopamine receptor D2b [Source:ZFIN;Acc:ZDB-GENE-030910-2])

HSP 1 Score: 147.132 bits (370), Expect = 2.295e-38
Identity = 115/438 (26.26%), Postives = 203/438 (46.35%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK-SMPS-TSLTTSILNVNSKV---------CDDLNHSLNQEKLSLLSISTDFSRRSLMS---CNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ ++   IS+ W++ F I+CPL          N        C   N  F++ + I++F +P +I ++ Y+     +RK+ K +++   +  +    +Q  + +K + P    L T I+  N  V           ++ H      + +++ ++   ++ L S    +   T PS    N        +   G   +      +   K T  +   +  N +                 +R   T  +S R +   K +KA Q+L IV G+F+ C++PFF+ ++    C SC  +   M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVM--ISVVWVLSFAISCPLLFG-----LNNTATRDGSVCEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNT-KRSCQKTDADAQPPLKEKCTHPEDVKLCTVIIKTNGGVPAKNKKAQLIKEVLHQGGDVGMEMVAGTSPPEKKKLASSLVVDLLATPPS---PNHGSPSHAEYQSNGD-EKNGHAKDVQSPKETKPVETQALPNGK-----------------TRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSC-VVPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 452          
BLAST of GCR037 vs. Ensembl Zebrafish
Match: drd2b (dopamine receptor D2b [Source:ZFIN;Acc:ZDB-GENE-030910-2])

HSP 1 Score: 147.132 bits (370), Expect = 2.295e-38
Identity = 115/438 (26.26%), Postives = 203/438 (46.35%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK-SMPS-TSLTTSILNVNSKV---------CDDLNHSLNQEKLSLLSISTDFSRRSLMS---CNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ ++   IS+ W++ F I+CPL          N        C   N  F++ + I++F +P +I ++ Y+     +RK+ K +++   +  +    +Q  + +K + P    L T I+  N  V           ++ H      + +++ ++   ++ L S    +   T PS    N        +   G   +      +   K T  +   +  N +                 +R   T  +S R +   K +KA Q+L IV G+F+ C++PFF+ ++    C SC  +   M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVM--ISVVWVLSFAISCPLLFG-----LNNTATRDGSVCEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNT-KRSCQKTDADAQPPLKEKCTHPEDVKLCTVIIKTNGGVPAKNKKAQLIKEVLHQGGDVGMEMVAGTSPPEKKKLASSLVVDLLATPPS---PNHGSPSHAEYQSNGD-EKNGHAKDVQSPKETKPVETQALPNGK-----------------TRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSC-VVPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 452          
BLAST of GCR037 vs. Ensembl Xenopus
Match: rhoc (ras homolog family member C [Source:Xenbase;Acc:XB-GENE-941426])

HSP 1 Score: 163.696 bits (413), Expect = 2.949e-44
Identity = 126/424 (29.72%), Postives = 191/424 (45.05%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIE--TMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV--SC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GNILV +++ LEK+LQN  NYFL+SLAV+D L  I VMP++   ++++     W  P  LC  W  LDV F+  +I+HLC IS+DRY+A+  P++  Q   +    IKI++ W+I  GIA P+ +  L     T +   +   G  P    FI+   +  F +P  IM++ Y LT+  +RK+   +                    K+ P   LT S                        ++ST F R          ++P KI       K+  F+F G+         +P R       R SSV  + ++   N                           ++A +VLGIVF LFV  + PFF+  +T   C    C + +   ++    W+GY +S +NP+VY +FN TFR  F R I+C
Sbjct:   35 GNILVILAISLEKKLQNATNYFLMSLAVADLLVGIFVMPIA---LINILFQQVWQLPQCLCAIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQASQYNSRGKTLIKIAVVWVISAGIAVPIPIQGLLYPNTTFSASYTCVVGLEPFKY-FIIYGSMAAFFVPFGIMVVIYFLTIHLLRKKAYLI--------------------KNKPPQRLTWS------------------------TVSTVFQRDMTPG-----SSPEKIVMLEGPRKDGTFNFTGE--------ELPIR-------RLSSVGKKSMQTITN--------------------------EQRASKVLGIVFFLFVFMWCPFFITNVTSVLCGKDQCDEDVIKMLMDIFVWVGYISSGVNPLVYTLFNKTFRDAFRRYIKC 364          
BLAST of GCR037 vs. Ensembl Xenopus
Match: rhoc (ras homolog family member C [Source:Xenbase;Acc:XB-GENE-941426])

HSP 1 Score: 163.696 bits (413), Expect = 3.326e-44
Identity = 126/424 (29.72%), Postives = 191/424 (45.05%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIE--TMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV--SC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GNILV +++ LEK+LQN  NYFL+SLAV+D L  I VMP++   ++++     W  P  LC  W  LDV F+  +I+HLC IS+DRY+A+  P++  Q   +    IKI++ W+I  GIA P+ +  L     T +   +   G  P    FI+   +  F +P  IM++ Y LT+  +RK+   +                    K+ P   LT S                        ++ST F R          ++P KI       K+  F+F G+         +P R       R SSV  + ++   N                           ++A +VLGIVF LFV  + PFF+  +T   C    C + +   ++    W+GY +S +NP+VY +FN TFR  F R I+C
Sbjct:   44 GNILVILAISLEKKLQNATNYFLMSLAVADLLVGIFVMPIA---LINILFQQVWQLPQCLCAIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQASQYNSRGKTLIKIAVVWVISAGIAVPIPIQGLLYPNTTFSASYTCVVGLEPFKY-FIIYGSMAAFFVPFGIMVVIYFLTIHLLRKKAYLI--------------------KNKPPQRLTWS------------------------TVSTVFQRDMTPG-----SSPEKIVMLEGPRKDGTFNFTGE--------ELPIR-------RLSSVGKKSMQTITN--------------------------EQRASKVLGIVFFLFVFMWCPFFITNVTSVLCGKDQCDEDVIKMLMDIFVWVGYISSGVNPLVYTLFNKTFRDAFRRYIKC 373          
BLAST of GCR037 vs. Ensembl Xenopus
Match: rhoc (ras homolog family member C [Source:Xenbase;Acc:XB-GENE-941426])

HSP 1 Score: 163.696 bits (413), Expect = 5.497e-44
Identity = 126/424 (29.72%), Postives = 191/424 (45.05%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIE--TMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV--SC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GNILV +++ LEK+LQN  NYFL+SLAV+D L  I VMP++   ++++     W  P  LC  W  LDV F+  +I+HLC IS+DRY+A+  P++  Q   +    IKI++ W+I  GIA P+ +  L     T +   +   G  P    FI+   +  F +P  IM++ Y LT+  +RK+   +                    K+ P   LT S                        ++ST F R          ++P KI       K+  F+F G+         +P R       R SSV  + ++   N                           ++A +VLGIVF LFV  + PFF+  +T   C    C + +   ++    W+GY +S +NP+VY +FN TFR  F R I+C
Sbjct:   66 GNILVILAISLEKKLQNATNYFLMSLAVADLLVGIFVMPIA---LINILFQQVWQLPQCLCAIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQASQYNSRGKTLIKIAVVWVISAGIAVPIPIQGLLYPNTTFSASYTCVVGLEPFK-YFIIYGSMAAFFVPFGIMVVIYFLTIHLLRKKAYLI--------------------KNKPPQRLTWS------------------------TVSTVFQRDMTPG-----SSPEKIVMLEGPRKDGTFNFTGE--------ELPIR-------RLSSVGKKSMQTITN--------------------------EQRASKVLGIVFFLFVFMWCPFFITNVTSVLCGKDQCDEDVIKMLMDIFVWVGYISSGVNPLVYTLFNKTFRDAFRRYIKC 395          
BLAST of GCR037 vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 152.525 bits (384), Expect = 2.780e-40
Identity = 113/428 (26.40%), Postives = 208/428 (48.60%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDS------FSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ ++   IS+ W++ F I+CPL         +N   S  K C  +N  F++ + IV+F +P ++ ++ Y+     +RK+ K +++         N H K + +  E  K          S      KV  +  +      + ++S ++   +    S      +P+  Q  +          +   + L   +  P++       ++S+  ++   +    + N +   + + ++   LS     K +KA Q+L IV G+F+ C++PFF+I++ +  C +C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   45 GNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVM--ISVVWVLSFAISCPLLFG------LNNTAS--KVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSHGVEVNAH-KDKCTHPEDVKLCAVFVKSNGSFPTDKKKVVSEAGNHPEDMDVEMMSSTSPPEKTKHKS-----ASPNHHQLAVPATSN-----QCNNANLPSPVDSPYKAEKNGHPKDSTKPAKVFEI--QTMPNGKTRTSIKTMSKRKLSQ---HKEKKATQMLAIVLGVFIICWLPFFIIHILNMHC-NC-NIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 440          
BLAST of GCR037 vs. Ensembl Xenopus
Match: HTR2C (5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled [Source:NCBI gene;Acc:100496012])

HSP 1 Score: 143.28 bits (360), Expect = 8.511e-37
Identity = 101/287 (35.19%), Postives = 154/287 (53.66%), Query Frame = 3
Query:   84 PNFYHNDSKKQPDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNN 944
            P     + K   +   D  W+ L  L+I I+TI GNILV ++V LEK+LQN  N+FL+SLAV+D L  ILVMPVS V +++ D     P +LC  W SLDV F+  +I+HLC IS+DRYVA+ NP+   +   +    +KI+  W I  GI+ P+ +  L+ ++     SS   C  N+  F++    V F +PL+IM+ +Y LT++ ++KQ      F      K R S     KK   + +++   +  N +    LN  +N+E          F + ++ S NN
Sbjct:   39 PANASEEEKLSHESLADKNWSALLTLIIIILTIGGNILVIMAVSLEKKLQNATNFFLMSLAVADMLVGILVMPVSLVTILY-DYAWPLPRKLCPIWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAMMKIAAVWTISIGISMPVPVIGLQDDSRVFVNSS---CVLNDENFVLLGSFVAFFIPLIIMVFTYCLTIQVLQKQAT---VFMYEEVPKQRRSSVNCLKKENNTENIS---MIQNHEAASHLNSPINKE-------GALFRKGTMQSINN 308          

HSP 2 Score: 69.3218 bits (168), Expect = 6.048e-12
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 3
Query: 1182 SLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCY 1445
            +++ I   R+A +VLGIVF LF+  + PFF+  +    C       +   +++   W+GY +S +NP+VY +FN T+RR F   IRC+ Y
Sbjct:  302 TMQSINNERRASKVLGIVFFLFLIMWCPFFITNIMSVLCKEACDNELMVELLNVFVWVGYVSSGINPLVYTLFNRTYRRAFASYIRCQYY 391          
BLAST of GCR037 vs. Ensembl Mouse
Match: Drd2 (dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94924])

HSP 1 Score: 144.05 bits (362), Expect = 2.493e-37
Identity = 119/440 (27.05%), Postives = 214/440 (48.64%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLS---RQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSV---------NSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + I+I W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +RK+ K ++    S +   + K+    +  + + M    L T I+  N       +  +N+ ++     + +     L S     T+P +               R ++S +     Q+++P   +   LH N    ++  +     ++N R++             R +   +S R +  QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMIAIVWVLSFTISCPLLFG---LNNTDQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDM---KLCTVIMKSNG------SFPVNRRRMDAARRAQELEMEMLSS-----TSPPE---------------RTRYSPIPPSHHQLTLP-DPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC 444          
BLAST of GCR037 vs. Ensembl Mouse
Match: Htr2b (5-hydroxytryptamine (serotonin) receptor 2B [Source:MGI Symbol;Acc:MGI:109323])

HSP 1 Score: 140.969 bits (354), Expect = 5.461e-36
Identity = 77/198 (38.89%), Postives = 122/198 (61.62%), Query Frame = 3
Query:  135 VKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPH--QLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT 722
            V WA L +L + I TI GNILV ++V LEKRLQ   NYFL+SLA++D L  + VMP++ + ++   +   WP    LC AW  LDV F+  +I+HLC IS+DRY+A+  P++ +Q   + + FIKI++ WLI  GIA P+ +  ++ + +N    + +        F++   +  F  PL IM+++Y LT+ T++K+ 
Sbjct:   53 VHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIMFEAI---WPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSLAAFFAPLTIMVVTYFLTIHTLQKKA 247          

HSP 2 Score: 71.633 bits (174), Expect = 8.543e-13
Identity = 40/106 (37.74%), Postives = 59/106 (55.66%), Query Frame = 3
Query: 1125 VLLNSRLSVNSRRIAT-SDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSIT-SWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            +L NS      RR+++    S + I   ++A + LG+VF LF+  + PFF+  LT   C SC   T   ++    WIGY +S +NP++Y +FN TFR  F R I C
Sbjct:  291 ILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFFITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITC 396          
BLAST of GCR037 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 138.272 bits (347), Expect = 4.609e-35
Identity = 80/202 (39.60%), Postives = 126/202 (62.38%), Query Frame = 3
Query:  117 PDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT 722
            PD  ++  W  L +++I I+TI GNILV ++V +EK+L N  NYFL+SLA++D L  +LVMP+S + +++ D     P  LC  W SLDV F+  +I+HLC IS+DRYVA+ NP+   +   +    +KI+I W I  G++ P+ +  L+ E+     ++   C  N+  F++    V F +PL IM+I+Y LT+  +R+QT
Sbjct:   50 PDGVQN--WPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILY-DYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDESKVFVNNT--TCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIYVLRRQT 246          

HSP 2 Score: 64.6994 bits (156), Expect = 1.180e-10
Identity = 31/87 (35.63%), Postives = 54/87 (62.07%), Query Frame = 3
Query: 1182 SLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV-SC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            +++ I   +KA +VLGIVF +F+  + PFF+  +    C  +C + +   +++   WIGY  S +NP+VY +FN  +RR F++ +RC
Sbjct:  300 TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRC 386          
BLAST of GCR037 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 138.272 bits (347), Expect = 4.609e-35
Identity = 80/202 (39.60%), Postives = 126/202 (62.38%), Query Frame = 3
Query:  117 PDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT 722
            PD  ++  W  L +++I I+TI GNILV ++V +EK+L N  NYFL+SLA++D L  +LVMP+S + +++ D     P  LC  W SLDV F+  +I+HLC IS+DRYVA+ NP+   +   +    +KI+I W I  G++ P+ +  L+ E+     ++   C  N+  F++    V F +PL IM+I+Y LT+  +R+QT
Sbjct:   50 PDGVQN--WPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILY-DYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDESKVFVNNT--TCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIYVLRRQT 246          

HSP 2 Score: 64.6994 bits (156), Expect = 1.180e-10
Identity = 31/87 (35.63%), Postives = 54/87 (62.07%), Query Frame = 3
Query: 1182 SLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV-SC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            +++ I   +KA +VLGIVF +F+  + PFF+  +    C  +C + +   +++   WIGY  S +NP+VY +FN  +RR F++ +RC
Sbjct:  300 TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRC 386          
BLAST of GCR037 vs. Ensembl Mouse
Match: Htr2a (5-hydroxytryptamine (serotonin) receptor 2A [Source:MGI Symbol;Acc:MGI:109521])

HSP 1 Score: 137.502 bits (345), Expect = 7.931e-35
Identity = 79/202 (39.11%), Postives = 124/202 (61.39%), Query Frame = 3
Query:  129 KDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW----PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT 722
            ++  W+ L   ++ I+TI GNILV ++V LEK+LQN  NYFL+SLA++D L   LVMPVS + +++     G+    P +LC  W  LDV F+  +I+HLC IS+DRYVA+ NP+   +   +   F+KI   W I  GI+ P+ +  L+ ++   +E S   C   +  F++    V F +PL IM+I+Y LT+K+++K+ 
Sbjct:   72 QEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILY-----GYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGS---CLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSLQKEA 265          

HSP 2 Score: 71.2478 bits (173), Expect = 1.265e-12
Identity = 37/91 (40.66%), Postives = 59/91 (64.84%), Query Frame = 3
Query: 1182 SLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFC-VSC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            +++ I   +KA +VLGIVF LFV  + PFF+  +    C  SC +++   +++   WIGY +S +NP+VY +FN T+R  F+R I+C+ YK
Sbjct:  311 TMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQ-YK 400          
BLAST of GCR037 vs. UniProt/SwissProt
Match: sp|P41595|5HT2B_HUMAN (5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.349e-47
Identity = 127/435 (29.20%), Postives = 206/435 (47.36%), Query Frame = 3
Query:  141 WAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWM-ISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            WA L +L++ I TI GN LV ++V LEK+LQ   NYFL+SLAV+D L  + VMP++ + ++   +   WP  L  C AW  LDV F+  +I+HLC IS+DRY+A+  P++ +Q   + + FIKI++ WLI  GIA P+ +  ++ +  N    +          F++   +  F  PL IM+++Y LT+  ++K                   ++ + K   P                         ++L+ L++ST F R     C    ++P K+   +DG +              +  ++P   +   + R S++  + ++  +N                           ++A +VLGIVF LF+  + PFF+  +T   C SC   T  M +    WIGY +S +NP+VY +FN TFR  F R I C
Sbjct:   56 WAALLILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM---WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQK-------------------KAYLVKNKPP-------------------------QRLTWLTVSTVFQRDE-TPC----SSPEKVAM-LDGSR--------------KDKALPNSGDETLMRRTSTIGKKSVQTISN--------------------------EQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITC 397          
BLAST of GCR037 vs. UniProt/SwissProt
Match: sp|P24628|DRD2A_XENLA (D(2) dopamine receptor A OS=Xenopus laevis OX=8355 GN=drd2-a PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.746e-40
Identity = 115/429 (26.81%), Postives = 210/429 (48.95%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK--SMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRG-----KFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP +    V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ ++   IS+ W++ F I+CPL         +N   S  K C  +N  F++ + IV+F +P ++ ++ Y+     +RK+ K +     N  R SR    + +K   + P      S+      V  + +   +++K+ L+  +        M   +  + P K +                    K + L+  +  P++       ++S+  ++   +    + N +   + + ++   LS     K +KA Q+L IV G+F+ C++PFF+I++ +  C +C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   45 GNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWA----VYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVM--ISVVWVLSFAISCPLLFG------LNNTGS--KVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRV-----NTKRNSRGVAVDAHKDKCTHPEDVKLCSVF-----VKSNGSFPADKKKVILVQEAGKHPEDMEMEMMSSTSPPEKTKHKSASPDHNQLAVPATSNQCKNASLTSPVESPYKAEKNGHPKDSTKPAKVFEI--QSMPNGKTRTSIKTMSKKKLSQ---HKEKKATQMLAIVLGVFIICWLPFFIIHILNMHC-NC-NIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 442          
BLAST of GCR037 vs. UniProt/SwissProt
Match: sp|O42385|5H1AA_TAKRU (5-hydroxytryptamine receptor 1A-alpha OS=Takifugu rubripes OX=31033 GN=htr1aa PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.780e-39
Identity = 103/421 (24.47%), Postives = 193/421 (45.84%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GN  V  ++ LE+ LQN  NY + SLAV+D + ++LV+P++ +  V    T G    +C  + +LDV    ++I+HLC I++DRY A+ +P+ +   +      + IS++WLI F I+ P  L     E     ++      P   I+   +    F +PL++M++ Y    K                   +RF   +  KK+  + +         S +C  L+ ++  ++ +  ++S ++ R         P++P        G++    +     S     + +P    +   H N               +N + +   R+IA        + + RK V+ LGI+ G F+ C++PFF++ L   FC     +  W+ +   W+GYS S++NP++Y  FN  F+  F +++RC+ ++
Sbjct:   62 GNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLG--QDICDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISVTWLIGFSISIPPMLGWRSAEDRANPDACIISQDPGYTIY---STFGAFYIPLILMLVLYGRIFKA------------------ARFRIRKTVKKTEKAKA---------SDMCLTLSPAVFHKRANGDAVSAEWKRGYKFK----PSSPCANGAVRHGEEMESLEIIEVNSNSKTHLPLPNTPQS-SSHEN---------------INEKTTGTRRKIA--------LARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCAENCYMPEWLGAVINWLGYSNSLLNPIIYAYFNKDFQSAFKKILRCKFHR 422          
BLAST of GCR037 vs. UniProt/SwissProt
Match: sp|P53453|DRD2L_TAKRU (D(2)-like dopamine receptor OS=Takifugu rubripes OX=31033 GN=d215 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 3.790e-37
Identity = 114/439 (25.97%), Postives = 202/439 (46.01%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHS-----LNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVN-----SRRIATSDLSLRYIQK-------SRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + ++R+ +  + IS+ W++ F I+CPL        T +Q       C   N  F++ + IV+F +P ++ ++ Y+     +RK+ K +     N   K R  Q+      +P++         + ++C  +  S     +N++K+  +    +      +   N+     K        +       G     S Q+ +  + N        +   E  R   N         N     + R   +  SL+ + K        +KA Q+L IV G+F+ C++PFF+ ++ +  C  CK + + M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVT--VMISVVWVLSFAISCPLLFGLNNTATRDQSL-----CFIANPAFVVYSSIVSFYVPFIVTLLVYVQIYVVLRKRRKRV-----NTKPKQRLCQAA--DPDIPTSLKDKCTHPEDVRLCTMIVKSNGSFPVNKKKVIFIKDGVNEVEGLELDELNYCGGSHKQPPPQQQPRAL-----GDTPATSHQLLMSTKANASPTSTPPTPPEEGQRTEKNGDPTKEAQGNPAPVVALRNGKTQTSLKTLSKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHILNTHCTRCK-VPAEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 463          
BLAST of GCR037 vs. UniProt/SwissProt
Match: sp|P60026|DRD2_PANTR (D(2) dopamine receptor OS=Pan troglodytes OX=9598 GN=DRD2 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 6.684e-37
Identity = 124/434 (28.57%), Postives = 202/434 (46.54%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD----SFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSK--------VCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + ISI W++ F I+CPL      +   +Q E     C   N  F++ + IV+F +P ++ ++ YI     +R++ K ++    S +   H ++    +  + + M    L T I+  N                  L  E LS    ST    R+  S    P  PS  Q  +           G  S        P +    + H   +   E ++   N    + L   SRR  +        QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  C +I   + S   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   51 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISIVWVLSFTISCPLLFG---LNNADQNE-----CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDM---KLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLS----STSPPERTRYS----PIPPSHHQLTLPDPSH-----HGLHSTPDSPAK-PEKNGHAKDHPKIAKIFE-IQTMPNGKTRTSLKTMSRRKLSQ-------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DC-NIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 443          
BLAST of GCR037 vs. TrEMBL
Match: A0A193KUM1 (GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr037 PE=2 SV=1)

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 476/476 (100.00%), Postives = 476/476 (100.00%), Query Frame = 3
Query:   57 MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS 1484
            MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS
Sbjct:    1 MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS 476          
BLAST of GCR037 vs. TrEMBL
Match: A0A193KU74 (GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr027 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 2.194e-100
Identity = 199/475 (41.89%), Postives = 276/475 (58.11%), Query Frame = 3
Query:  141 WAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SIST-------DFSRRSLMSCNNFPTTP-------SKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLN-------SRLSVNSRRIATSDLS------------LRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 1451
            WA++ L +IP+++++GN LV +SV++E  L+ RFNYFLVSLA+SDFLCAILVMP+S  KM+         HQ CL WYSLDVFFTA+TIIHLCTISIDRY AL NPL+ H  KR  SL +++  +W+IPF IACPLFL +L+++   +E SSFKGCGP NA FI+ A IVTF +PL+IM ++Y+LTVK +  Q K  +      +  S    S ++K  + S+SL       ++KV  +   +   E  S +   SIST       D   +   + N+F  TP       +   EN   +     + +        + ++P R+ + R  + +  +  +      VL N        R    S +  T + S            L+ I +SRKAVQ LGI+F LFV CY+PFFV YL DFF   C   S    M+++ EW+GYS SM NP+VYH FNP FR T+ RL++C+CY+V
Sbjct:   19 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAE-----ANLYSNAVASLVFKPKL-SSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPPLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 486          
BLAST of GCR037 vs. TrEMBL
Match: A0A0K0PUK1 (Orphan G-protein coupled receptor 55 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 7.317e-81
Identity = 174/464 (37.50%), Postives = 238/464 (51.29%), Query Frame = 3
Query:  105 SKKQPDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIY------KKSMPSTSLTTSILNVNSKVCDDLNHSL----------NQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENID-GDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKS-ITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRC 1442
            +K+QP       W  L    I ++ + GN+LV ++V  E++LQN FNYFLVSLA+SD L A LVMP+S +K    +L    P  +C+AWYSLDV FT++TIIHLC ISIDRY++L  PL++   K+     +KI I W++ F IA PLFL S+     NQE+  +KGCGP    F+++A I +F LPL IM I YILTVK +  Q K     + N    S  S  E        +KS+P  +   S  +        L H L          +Q   S L + TD  R           TPS    +I   D +   D  G  +  S    +   K   RL R +  +S R  L                            K R+AVQVLGI+F +FV  Y+PFF  Y  +  C  C++ I+  MI   EW+ YS SM+NP++YHIFNP FRR F++++ C+C
Sbjct:   37 AKEQPSY----NWPVLCFFTIVVLAMAGNVLVCLAVKFERKLQNMFNYFLVSLALSDMLSATLVMPLSIIKAFIDELP--VPKLMCVAWYSLDVLFTSSTIIHLCMISIDRYMSLKYPLKYGHAKKTKHTVMKIVIVWILSFSIAGPLFLFSM---FDNQEDVYYKGCGPETTTFVLSATISSFYLPLFIMTIMYILTVKALHAQRKTQQRLAVNNCAASSLSLKEQVPIMSPKRKSLPKQASAESRDSAAGGRSPLLGHKLFKSPDASPTSSQRNNSFLCVDTDNGRG---------LTPSSTCTDIALQDFDNTSDSHGGPTHSSSTRRV---KKVFRLRRENGGSSTRSSL---------------------------DKGRRAVQVLGILFAVFVVFYLPFFATYTINATCTKCQAFISPQMIMAFEWLAYSGSMVNPIIYHIFNPDFRRAFHKILHCKC 452          
BLAST of GCR037 vs. TrEMBL
Match: A0A1S8WK07 (7 transmembrane receptor (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09436 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.610e-80
Identity = 171/461 (37.09%), Postives = 248/461 (53.80%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRK--YSLFIKISISWLIPFGIACPLFLSSLKIETMNQE--------------ESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRK---QTKNLDSFSTNG-----------HRKSRFSQSEIYK--KSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFR--GKFSRLSRQMSIPFRKNTLRLHRNSSVNSER----LRLCANVLLNSRLSVNSRRI----ATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRC 1442
            GNI V ++VYLE+RL++RFN FLVSLA+SD LCAILVMPVS   M+     N     LCL  YS+D+FFTATTIIHLC+IS+DRY+AL  P   ++   K   SL  +I +SW +PF IA PLF+ +LK E  ++E                S+KGCGPN+  F++TA+ VTF+LPL+IM  +Y+LTVK +R+   Q K +  ++T              R + F  +EI +  K+    +   S +   +K     +   +++ +   S+S   S  +  + N     P  ++     D+ +    R  GK           + K +  L   S+  ++     L L +N  L   L    RR     A +  ++  I   ++AV+V+ ++FGLFV CY PFF++Y     C  C+S     I + EW+GY  SM+NPVVYH FN TFRRTF R+ +C C
Sbjct:   22 GNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQN---RILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWERGDEEFIVTMTPESANITTSKSYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLYATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPPRRIPIGVENPSTQDEASLSGNRVCGKDPSDKSNDQQSYVKASETLFLTSTAKNDHDISGLELSSNHELG--LPSQGRRTDISSAQTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCAC 477          
BLAST of GCR037 vs. TrEMBL
Match: A0A074ZZH1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02329 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.921e-80
Identity = 171/461 (37.09%), Postives = 248/461 (53.80%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRK--YSLFIKISISWLIPFGIACPLFLSSLKIETMNQE--------------ESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRK---QTKNLDSFSTNG-----------HRKSRFSQSEIYK--KSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFR--GKFSRLSRQMSIPFRKNTLRLHRNSSVNSER----LRLCANVLLNSRLSVNSRRI----ATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRC 1442
            GNI V ++VYLE+RL++RFN FLVSLA+SD LCAILVMPVS   M+     N     LCL  YS+D+FFTATTIIHLC+IS+DRY+AL  P   ++   K   SL  +I +SW +PF IA PLF+ +LK E  ++E                S+KGCGPN+  F++TA+ VTF+LPL+IM  +Y+LTVK +R+   Q K +  ++T              R + F  +EI +  K+    +   S +   +K     +   +++ +   S+S   S  +  + N     P  ++     D+ +    R  GK           + K +  L   S+  ++     L L +N  L   L    RR     A +  ++  I   ++AV+V+ ++FGLFV CY PFF++Y     C  C+S     I + EW+GY  SM+NPVVYH FN TFRRTF R+ +C C
Sbjct:   22 GNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQN---RILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWERGDEEFIVTMTPESANITTSKSYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLYATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPPRRIPIGVENPSTQDEASLSGNRVCGKDPSDKSNDQQSYVKASETLFLTSTAKNDHDISGLELSSNHELG--LPSQGRRTDISSAQTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCAC 477          
BLAST of GCR037 vs. Ensembl Cavefish
Match: htr2cl1 (5-hydroxytryptamine receptor 2C-like [Source:NCBI gene;Acc:103044140])

HSP 1 Score: 156.762 bits (395), Expect = 2.122e-41
Identity = 115/426 (27.00%), Postives = 195/426 (45.77%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSF--KGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTK----NLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCR 1439
            GNILV ++V LEK+LQN  N+FL SLAV+D L  ILVMP+S + +++ D     P+ LC  W  LDV F+  +I+HLC IS+DRYVA+ NP++  +   +    +KI+  W I  GI+ P     + +  ++ E+  F    C  N   F++    V F +PL+IM+++Y LTV+ +++Q         + S    + +  S S++     PS   + + L +     + L+ +   + +S++  S                 PS++   +  D       RG                        ++ +ER                               ++ K + V+  +F L  C   PFF+  +    C     + + + +++   WIGY +S +NP+VY +FN T+RR F+  +RCR
Sbjct:   83 GNILVILAVSLEKKLQNATNFFLRSLAVADMLVGILVMPISLINILY-DYAWPLPNALCPIWIYLDVLFSTASIMHLCAISLDRYVAICNPIQHSRFNSRTKAMLKIAAVWTISIGISMP-----IPVIGLSNEDKVFVNHSCVLNEERFVLVGSFVAFFIPLVIMVVTYCLTVQALQRQASVFLYETKASSQQPLQPTGPSSSQLAPPLAPSRRSSLNCLRLGGGDGNSLSPATLSDSVSIVGSS---------------EAPSQLNSPVGRDPTGAHGRRGMM---------------------QAIKNER-------------------------------RASKVLGVVFFLFLLMWC---PFFITNVLFVLCRGACNEPLLNELLNVFVWIGYISSGVNPLVYTLFNKTYRRAFSSYMRCR 432          
BLAST of GCR037 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 147.132 bits (370), Expect = 1.315e-38
Identity = 112/428 (26.17%), Postives = 200/428 (46.73%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDS----FSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + IS+ W++ F I+CPL        T +        C   N  F++ + I++F +P +I ++ Y+     +RK+ K +++       +   +    Q  I +   P T +   ++   S            EK+ L +        +L++  + P+  S + E    + + + D +   +                  +++    E        L N +    +R   T  +S R +   K +KA Q+L IV G+F+ C++PFF+ ++    C SC  +   M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISVVWVLSFAISCPLLFGLNNTATRDDSV-----CEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNTKRNCQKADAEPQPPLKQLLIKEVVQPGTGVEMGLMTSTSP----------PEKMKLAAPPA----VNLLATQS-PSHASPLHE----EWQPHDDEKNGHA------------------KDAQTPKETKSFETQALPNGK----TRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSC-YVPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 423          
BLAST of GCR037 vs. Ensembl Cavefish
Match: drd2a (D(2)-like dopamine receptor [Source:NCBI gene;Acc:103036974])

HSP 1 Score: 145.976 bits (367), Expect = 3.616e-38
Identity = 127/451 (28.16%), Postives = 207/451 (45.90%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKG-CGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPST-----SLTTSILN------VNSK--VC----DDLN--HSLNQEKL--------SLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTD-FFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + ++R+ +  + IS+ W++ F I+CPL         +N  ES     C   N  F++ + IV+F +P +I ++ Y+     +RK+ K + +       K  F +  ++  S   T      L T I+       VN+K  VC    D++     LNQ  L         LL +ST      L +    P  PS+     D  + T   F  + S   +  S                              S  S N R+ +         QK +KA Q+L IV G+F+ C++PFF+ ++ + ++ V  +  T++      W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   39 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVT--VMISVVWILSFAISCPLLFG------LNNTESRDDALCVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVST-------KRTFPKFNVHLNSPKCTHPDDVKLCTVIVKSNGNFPVNNKNVVCQISADEVTNPEPLNQRTLEQTGASQHGLLLVSTHSETEVLPTVPEAPIKPSRNGNTGDAPRVTK-AFETQVSPSGKTQS------------------------------SVKSFNKRKFSQ--------QKEKKATQMLAIVLGVFIICWLPFFITHIVNTYYNVPAELYTAF-----TWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 426          
BLAST of GCR037 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 145.591 bits (366), Expect = 5.104e-38
Identity = 112/426 (26.29%), Postives = 196/426 (46.01%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK-SMPS-TSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + IS+ W++ F I+CPL        T +        C   N  F++ + I++F +P +I ++ Y+     +RK+ K +++   N  +     Q  + +K + P    L T I+  N  +       +       + + T  S    M     P       ++       + +++            P         +++    E        L N +    +R   T  +S R +   K +KA Q+L IV G+F+ C++PFF+ ++    C SC  +   M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   43 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISVVWVLSFAISCPLLFGLNNTATRDDSV-----CEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNT-KRNCQKADAEPQPPLKEKCTHPEDVKLCTVIVKTNGSLPVKNKKVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPLHEEWQ------------PHDDEKNGHAKDAQTPKETKSFETQALPNGK----TRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSC-YVPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 439          
BLAST of GCR037 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 145.976 bits (367), Expect = 5.681e-38
Identity = 113/426 (26.53%), Postives = 196/426 (46.01%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK-SMPS-TSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + +KR+ +  + IS+ W++ F I+CPL        T +        C   N  F++ + I++F +P +I ++ Y+     +RK+ K +++   N  +     Q  + +K + P    L T I+  N  +        N++   L+           M      + P K++                 +    +   P         +++    E        L N +    +R   T  +S R +   K +KA Q+L IV G+F+ C++PFF+ ++    C SC  +   M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVT--VMISVVWVLSFAISCPLLFGLNNTATRDDS-----VCEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNT-KRNCQKADAEPQPPLKEKCTHPEDVKLCTVIVKTNGSLPVK-----NKKAQLLIKEVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPLHEEWQPHDDEKNGHAKDAQTPKETKSFETQALPNGK----TRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSC-YVPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 452          
BLAST of GCR037 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 2.464e-35
Identity = 70/184 (38.04%), Postives = 115/184 (62.50%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKG-CGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLD 734
            GN+LV ++V+LEK+LQ   NYFL+SLAV+D L  + VMP+S + +++ ++    P ++C  W  LDV F+  +I+HLC IS+DRY+A+  P++  +   +    +KI+  W I  GIA P+ +  L+    +Q+     G C  N   FI+   +V+F LPLLIM++ Y+LT++ +R Q   ++
Sbjct:   21 GNLLVILAVWLEKKLQTATNYFLMSLAVADLLVGLTVMPISVINILY-NMRWPLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQ----DQQHVFVNGACILNIQNFIIYGSVVSFFLPLLIMVVIYVLTIRLLRGQVGLME 199          

HSP 2 Score: 66.2402 bits (160), Expect = 4.911e-12
Identity = 44/143 (30.77%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1026 RLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNS--RRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFC----VSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            R S    + FR         + ++ ERL            S+ +  R  A    S + +   R+A +VLGIVF LF+  + PFFV  +T   C     S +++   M  +  W+GY +S +NP+VY +FN T+R+ F R + C
Sbjct:  217 RGSEHQRVIFRHKETLERLPTLLDGERLSAVGGAAAAVAASMGTLRRTQAAHSRSAQALSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFV-WVGYVSSGVNPLVYTLFNQTYRQAFRRYVAC 358          
BLAST of GCR037 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 9.962e-32
Identity = 69/179 (38.55%), Postives = 106/179 (59.22%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQT 722
            GN+LV ++V LEK+LQ   NYFL+SLAV+D L  ILVMP+S + +++       P  LC  W  LDV F+  +I+HLC IS+DRY+A+  P+   +   +    +KI   W+I  GI+ P+ +  L+       + S   C  N + FI+   + +F LPL+IM+ SY+ T + +R+Q 
Sbjct:   41 GNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILY-GFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGS---CQMNISDFIIYGSLSSFFLPLIIMVASYVSTTRVLRQQA 215          

HSP 2 Score: 63.1586 bits (152), Expect = 5.844e-11
Identity = 32/88 (36.36%), Postives = 53/88 (60.23%), Query Frame = 3
Query: 1182 SLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVS--C-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            +++ I   ++A +VLGIVF LFV  + PFF+  +    C +  C +   + ++    W+GY +S +NP+VY +FN T+R+ F R I C
Sbjct:  305 TMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFARYIAC 392          
BLAST of GCR037 vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 105.531 bits (262), Expect = 1.172e-24
Identity = 109/430 (25.35%), Postives = 173/430 (40.23%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGW--PHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPN-NAIFIMTAVIVTF-----ILPLLIMMISYILTVKTIR-KQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVC----DDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCV--SCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLI 1430
            GN LV ++V     L+   N FLVSLA +D L A LV+P S       +L   W      C  + +LDV F  ++I+HLC IS+DRY +++  + ++  +    +   I I W I   I+ P  +S  +     QEE     C  N N  +I+ + I +F     I+ L+   I +++  +  + ++ K     S       R S+                      K C    D   H  +    S      D    S+ S  N        +   DGD           ++ SR+   P + +          N E       +L     +   R+IA +        + R+   VL ++ G+FV C+ PFF  Y     C   SC +I   +  +  W GY  S +NPV+Y +FN  FRR F +++
Sbjct:   68 GNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFN----ELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHLVKWRAAKLRRDKEAPITSCRPMESIRMSEVNGNGGGGGGGGGGGEGNGNGEKNCNGAGDKSRHHPHHHPPSHHHPEVDVEETSVSSDKN--------ERRRDGDSAG--------AKASRKPCSPTKDD---------YNPE-----MEILERQNKARERRKIAQA--------RERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESC-AIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKIL 454          
BLAST of GCR037 vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 90.5077 bits (223), Expect = 5.070e-20
Identity = 63/203 (31.03%), Postives = 98/203 (48.28%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQN-RFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPH--QLCLAWYSLDVFFTATTIIHLCTISIDRYVAL-NNPLRFHQTKRKYSLFIKISISWLIP--------------FGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSF 740
            GN+LV V+V  ++ L+  + NYF+VSLAV+D L AILVMP   V+ V     N WP+  + C+   S DV FT  +I+HLC I++DR+ A+   PL +        + + +   W++P               GI   L L   + +  NQ    F      N ++ +   +V F +PL +M  +Y     T R   + + S 
Sbjct:   36 GNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQ----NDWPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVYQNKMTPLRVGLMLGACWVVPSLISFIPIANGWNIIGIEQQLELRLGQAKEANQTHCIFM----VNKVYAVACSLVAFYIPLGLMAAAYQRIYVTARAHARQIGSL 230          

HSP 2 Score: 52.373 bits (124), Expect = 1.157e-7
Identity = 29/90 (32.22%), Postives = 49/90 (54.44%), Query Frame = 3
Query: 1209 KAVQVLGIVFGLFVCCYMPFFVIYLTDFFC---VSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRS 1469
            KA + L I+ G F  C+ PFF+  + D F       +   +W+     W+GY+ S +NP++Y   N +FRR F  ++ C C+  + ++RS
Sbjct:  258 KAAKTLAIIMGCFCLCWAPFFINNVIDPFVNYDTPQQLWDAWL-----WLGYANSALNPLLYAFLNRSFRRAFLAIL-C-CWDAARYRRS 340          
BLAST of GCR037 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 1.656e-19
Identity = 62/209 (29.67%), Postives = 106/209 (50.72%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCG-PNNAIFIMTAVIVTFILPLLIMMISYILTVKTIR-KQTKNLDSFSTNGHRKSRFSQSEIYKKSMPS 806
            GN  V  ++ LE+ LQN  NY + SLAV+D L +ILV+P++ +  V    T G    +C  + +LDV    ++I+HLC I++DRY A+ NP+ +   +      I IS++WL+ F I+ P  L     E    + +    C    +  + + +    F +PL++M++ Y    +  R +  KN+   +      + F+ S   +  MPS
Sbjct:   53 GNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLG--QVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPE----DRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKNVKKATEKKSFDAPFAISN--RAEMPS 253          
BLAST of GCR037 vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 95.9005 bits (237), Expect = 1.085e-21
Identity = 66/203 (32.51%), Postives = 104/203 (51.23%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNL-DSFSTNGHRKSRFSQSEI 785
            GN+LV V++Y  +RL++  NY + SLAVSD L A L MP      +H+     W   L  C  W  +D   +  +I +L  I+IDRY+ L+ P  + +  RK   FI I   WL  F IA    LS  +  + +   +SF  C   +  +   A+ ++F LPL++++I+Y +  K  RKQ   +  +  + GH + R   S +
Sbjct:   36 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHL---MCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIAS---LSLTEPWSPDGFNASFPACAKMDKYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRANDSQGHLEYRTETSVV 232          
BLAST of GCR037 vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 95.5153 bits (236), Expect = 1.847e-21
Identity = 66/203 (32.51%), Postives = 104/203 (51.23%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNL-DSFSTNGHRKSRFSQSEI 785
            GN+LV V++Y  +RL++  NY + SLAVSD L A L MP      +H+     W   L  C  W  +D   +  +I +L  I+IDRY+ L+ P  + +  RK   FI I   WL  F IA    LS  +  + +   +SF  C   +  +   A+ ++F LPL++++I+Y +  K  RKQ   +  +  + GH + R   S +
Sbjct:   47 GNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHL---MCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIAS---LSLTEPWSPDGFNASFPACAKMDKYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRANDSQGHLEYRTETSVV 243          
BLAST of GCR037 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 85.5001 bits (210), Expect = 5.698e-18
Identity = 53/178 (29.78%), Postives = 93/178 (52.25%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL----CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKT 707
            GN+LV  SV+  +RL++  NY +VSLAVSD L   L +P    ++++ +    WP  L    C  W  +D+  +  ++++L  IS DR +A+  PLR+ +        I I + W+  +  +C  FLS ++ E      +++  CG    ++I    +  F  PLLI++I Y + ++ 
Sbjct:   40 GNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEE---NWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWI--YAASCA-FLSFVEWEG-ESTIAAYPQCGIRARVYITLMALAAFFCPLLIVIICYGMVLQV 210          

HSP 2 Score: 47.7506 bits (112), Expect = 8.347e-6
Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = 3
Query: 1191 YIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLT----DFFCVSCKSITS-----WMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRL 1427
            +I K  KA + L +V G+F+ C+ PFFVI++T    D  C   + I        +I +   +  S S  NP++Y  FN  FR  F ++
Sbjct:  284 HIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAFLKI 371          
BLAST of GCR037 vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 82.4185 bits (202), Expect = 1.962e-17
Identity = 56/206 (27.18%), Postives = 95/206 (46.12%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFK-GCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKK 794
            GN +V ++V L  R++   NYF+VSLAVSD L A L +P    +  H      W   L  C+AW  +D+     +I +L  IS+DR++A+  P R+H      +    I   W++  G+     LS +    +       +  C   + ++     +V F LPL I+++ Y         Q + + +  T+  R+ R S   + K+
Sbjct:   15 GNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTH---NTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMG---MLSLINWTELGSPHFHIEVQCRKFDPVYYTVVSVVGFFLPLFIVLLMYGQVFVVAMNQARAVAALQTDSKRRGRRSSINLVKE 214          

HSP 2 Score: 46.9802 bits (110), Expect = 9.801e-6
Identity = 26/84 (30.95%), Postives = 43/84 (51.19%), Query Frame = 3
Query: 1200 KSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFF--------CVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRL 1427
            K  KA ++L IV G FV C+ PFFV+ L   +         +S  +     +++   +    S +NP++Y +FN  FRR F ++
Sbjct:  213 KEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAFGKI 296          
BLAST of GCR037 vs. Ensembl Nematostella
Match: EDO35292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM05])

HSP 1 Score: 81.6481 bits (200), Expect = 5.260e-17
Identity = 57/202 (28.22%), Postives = 98/202 (48.51%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVD--LTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEI 785
            GN+LV  + ++ +RL+   N+F++SLAV+D L A++ MPV    ++     + + W +++   W  +D+     +I+HLC IS++R + +++PL +H T       I IS  W+          ++ LKI   N     ++          +   I  FI+PL+IM  SY+    T R Q K +   +  G  K      EI
Sbjct:    5 GNLLVLSAFWVFRRLRTVTNFFIISLAVADILVAVVSMPVWAAYLIGGPSVILSSWLNKV---WNFMDILCGVASIVHLCFISLERCICISSPLTYHDTVTTEKAKIAISCIWIF------AAIMAGLKIVLWNTPPPVYE----------LAVTISCFIIPLIIMTGSYMKMFTTARHQIKKMI-LTVQGKPKRFLLSKEI 186          

HSP 2 Score: 60.8474 bits (146), Expect = 3.419e-10
Identity = 28/85 (32.94%), Postives = 48/85 (56.47%), Query Frame = 3
Query: 1194 IQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNR--LIRCRC 1442
            + K  KA + + +V G FV C+ PFFV+ L    C +C+ + +  I  ++W+ Y  S++NP++Y   N  FR+ F +  +  C C
Sbjct:  182 LSKEIKAAKTVAVVIGGFVICWCPFFVLNLMYGLCEACRPLPTESILVAKWMHYVNSVLNPIIYACMNKDFRKAFKKHLMYACAC 266          
BLAST of GCR037 vs. Ensembl Medaka
Match: drd2a (dopamine receptor D2 [Source:NCBI gene;Acc:101164579])

HSP 1 Score: 157.532 bits (397), Expect = 4.127e-42
Identity = 124/449 (27.62%), Postives = 218/449 (48.55%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQL--CLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRF---HQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNS-KVCDDLNHS-----LNQEKLSLL-SISTDFSRRSLMSCNNFPTTPSKIQ--ENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTL-------------RLHRN---SSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYI--QKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  EK LQ   NY +VSLAV+D L A LVMP     +V++++   W      C  + +LDV     +I++LC ISIDRY A+  P+ +   + ++R+ +  + IS+ W++ F I+CPL        T  ++ES    C   N  F++ + IV+F +P +I ++ Y+     +RK+ K +     N   K R  Q+     +  +TSL     +    ++C  +  S     +N++K+  +  ++ D     L   NN  ++  + Q  +++ GD              S Q  +P + N               +  +N   + V ++   + A       L     + +   +S R I  QK +KA Q+L IV G+F+ C++PFF+ ++ +  C  CK + + M +   W+GY  S +NP++Y  FN  FR+ F +++ C
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP----WVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVT--VMISVVWVMSFAISCPLLFG--LNNTATRDESL---CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRV-----NTKPKQRICQAA---DTDGATSLKDKCTHPEDVRLCTMIVKSNGSFPVNKKKVIFIKDVANDGEDLELDELNNSGSSQKQKQLTQSVLGDTPA----------TSHQQLMPSKANASPTSTPPTPPEEGQKAEKNEDTTDVLTDPAPIVAKAFQTQALPNGKTQTSVKTMSKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHILNTHCTKCK-VPAEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 467          
BLAST of GCR037 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 3.072e-39
Identity = 110/425 (25.88%), Postives = 192/425 (45.18%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKT----IRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYK 1448
            GN  V  ++ LE+ LQN  NY + SLAV+D + ++LV+P++ +  V    T G   ++C  + SLDV    ++I+HLC I++DRY A+ +P+ +   +      + I  +WLI F I+ P  L     E     ++      P   I+   +    F +PL++M++ Y    +     IRK  K +++   +  +    S +  +KKS   +           K CD                             + P++P      + GD+    +     S     + +P   NT    ++SS   E         +N R S   R++A S        + RK V+ LGI+ G F+ C++PFF++ L   FC     +  W+ +   W+GYS S++NP++Y  FN  F+  F ++I+C+ ++
Sbjct:   59 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLG--QEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIY---STFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKIETAKVS-DKCLAVSPAFFHKKSNGQSG------GRGWKRCD----------------------------GSKPSSPCVNGAVMHGDEGESLEIIEVISNSKTHLPLP---NT---PQSSSHGYEN--------MNERNSGAKRKLALS--------RERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCKFHR 421          
BLAST of GCR037 vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 146.362 bits (368), Expect = 1.519e-38
Identity = 111/434 (25.58%), Postives = 199/434 (45.85%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIAC-PLFLSSLKIETMNQEESSFKGCG-PNNAIFIMTAVIVTFILPLLIMMISYILTVK--------TIRKQTKNLDSFSTNGHRKSRF-------SQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN  V  ++ LE+ LQN  NY + SLAV+D + ++LV+P++ +  V    T G     C  + SLDV    ++I+HLC I++DRY A+  P+ + + +      + IS++WL+ F I+  P+ +   +  +M ++ ++ K C    +  + + +    F +PL +M++ Y    K        T+RK  K   + S      S F       +Q + +K+S+    L  ++ +VN  V     H+ + E L ++ + ++ SR +L      P TPS +           F+ R                                        + + +   R+IA        + + RK V+ LGI+ G F+ C++PFF++ L   FC     +  W+     W+GYS S++NP++Y  FN  F+  F ++I+C
Sbjct:   35 GNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLG--QVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKVADSCLAISPSLFHKTPHGDAQGKSWKRSVEPRPL--ALPSVNGAV----KHAEDGESLEIIEVHSN-SRGNL----PLPNTPSTV---------PLFESR----------------------------------------HDKATEAKRKIA--------LARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKC 398          
BLAST of GCR037 vs. Ensembl Medaka
Match: htr2b (5-hydroxytryptamine receptor 2B [Source:NCBI gene;Acc:101162203])

HSP 1 Score: 144.436 bits (363), Expect = 2.193e-37
Identity = 101/299 (33.78%), Postives = 160/299 (53.51%), Query Frame = 3
Query:   99 NDSKKQPDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQ--LCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAI---------FIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFST---NGHRKSRFSQSEIYKKSM---PSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNN 944
            N S+        +KWA L ++++ I TI GNILV ++V LE++LQN  NYFL+SLAV+D L  +LVMP++ V +++    +GWP    LC  W  LDV F+  +I+HLC IS+DRY+A+  P++  Q K +    +KI++ WLI   IA P+ +  L     N   S+      N+           FI+   +  F +PL+IMM+ Y+LTV+ +RK+   L S  T   N    S   Q E     +   P   L T +  +  K+ + +     +++LS   +ST   ++S+ + +N
Sbjct:   12 NSSRAAEAPEIQLKWAALLIIMVIIPTIGGNILVILAVSLERKLQNATNYFLMSLAVADLLVGLLVMPIALVTVLY---NSGWPLPDFLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKAIVKIALVWLISICIAIPIPIKGLT----NYHPSNNITFNSNHTCLLKTDTFRDFIIFGSLAAFFIPLMIMMVIYLLTVQVLRKKVYLLKSKVTQRFNSQIVSSVFQREAATPPLQMEPMDMLDTKLPRMQDKLNEGMGTPPTEDELSFRRMST-MGKKSMQTLSN 302          

HSP 2 Score: 82.8037 bits (203), Expect = 1.510e-16
Identity = 46/111 (41.44%), Postives = 66/111 (59.46%), Query Frame = 3
Query: 1158 RRIAT-SDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC-KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS 1484
            RR++T    S++ +   ++A +VLGIVF LFV  + PFF+  +T   C SC  SI S ++    W+GY +S +NP+VY +FN TFR  F R I C  Y  S   R+G  L+
Sbjct:  287 RRMSTMGKKSMQTLSNEQRASKVLGIVFLLFVVMWCPFFITNITSALCTSCSASIVSRLMEIFVWVGYVSSGINPLVYTLFNKTFREAFTRYITCN-YSNSASSRTGPHLA 396          
BLAST of GCR037 vs. Ensembl Medaka
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:101163209])

HSP 1 Score: 144.05 bits (362), Expect = 2.408e-37
Identity = 124/444 (27.93%), Postives = 201/444 (45.27%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNG---WPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTK-RKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPST---SLTTSILNVNSKVCDDLN---------HSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENID----GDKETYFDF-RGKFSR---LSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRY---IQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRC 1436
            GN+LV ++V  E+ LQ   NY +VSLAV+D L A LVMP +    V++++  G   +    C  + +LDV     +I++LC ISIDRY A+  P+ ++ T   +  +F  I+  W++ F ++CPL          N  +     C  +N  F++ + +V+F LP ++ ++ YI     +R              R+ R +  +   K  P +   S+ T +     K   DL+          S    K SLLS      R       N    P  +Q            T FD  +G+  +    S Q+ +P       +  N  V           L N R   + R I+ S  + R+     + +KA Q+L IV G+F+ C++PFFV ++ +  C +C+ I   +     W+GY  S +NPV+Y  FN  FRR F +++ C
Sbjct:   53 GNVLVCLAVLRERSLQTTTNYLVVSLAVADLLVASLVMPWA----VYLEVVGGAWLFNRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHCSRKRVFAMIATVWVLAFAVSCPLLFG------FNTTDDPMV-CSISNPDFVIYSSVVSFYLPFIVTLLVYIRIYVFLRM-------------RRKRIAFGQARGKVQPGSTHPSVETCLQEETPKAKQDLSPIRIKVQSVESSGTSKPSLLSGCLWRKRPKTGPAQNSGLPPVDMQNYCSISHASCGRTEFDLEQGQVEQDASDSNQLELP------PIRMNCEVKE---------LSNGRTHTSLRPISHSQNNPRFRSMHAREKKATQMLAIVLGVFLICWLPFFVTHILNTHCRTCQ-IPPALYGAFTWLGYVNSALNPVIYTTFNIEFRRAFIKILSC 456          
BLAST of GCR037 vs. Planmine SMEST
Match: SMESG000065390.1 (SMESG000065390.1)

HSP 1 Score: 939.873 bits (2428), Expect = 0.000e+0
Identity = 475/476 (99.79%), Postives = 475/476 (99.79%), Query Frame = 3
Query:   57 MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS 1484
            MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFR KFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS
Sbjct:    1 MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRSKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKVSNFQRSGSFLS 476          
BLAST of GCR037 vs. Planmine SMEST
Match: SMESG000032679.1 (SMESG000032679.1)

HSP 1 Score: 342.043 bits (876), Expect = 6.100e-112
Identity = 201/457 (43.98%), Postives = 284/457 (62.14%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKI-------------------ETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVL------LNSRLSV-----NSRRIA-----TSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 1451
            GN LV VSV++EKRLQNRFN+FLVSLA+SD LCA+LVMPVS   MV  +     P  +CLAWYSLDVFFT+TTIIHLC+IS+DRY  LNNPL++H T+ + SL +KISI+WLIPF IACPLF+ +L++                   ET++Q+  S+KGCGP+N  FI+ + ++TF+LPL IM+++YILTV +I +Q        TN  R++ +       KS P T +   I + +  + +  N + N    S++ +   +   S +S N+F +   +    I    E         + + R      ++N L + + SS+  +  +   N          ++LS+     NS RI      ++  +L  +   +KAVQVLGI+FGLF+ CY+PFFVIYL DFFC+ C+++T  ++S +EWIGYSASM+NP+VYHIFNPTFR TFNRL+RC+CYKV
Sbjct:   47 GNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQ--------TNQARQNLYPNKS-STKSRPLTQI--KITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQN-LAIKKQSSLTDKNFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 491          
BLAST of GCR037 vs. Planmine SMEST
Match: SMESG000032682.1 (SMESG000032682.1)

HSP 1 Score: 334.724 bits (857), Expect = 6.580e-107
Identity = 200/469 (42.64%), Postives = 285/469 (60.77%), Query Frame = 3
Query:  186 GNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKI-------------------ETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTTPSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVL------LNSRLSV-----NSRRI-----ATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCR----CYKVSNFQRSGS 1475
            GN LV VSV++EKRLQNRFN+FLVSLA+SD LCA+LVMPVS   MV  +     P  +CLAWYSLDVFFT+TTIIHLC+IS+DRY  LNNPL++H T+ + SL +KISI+WLIPF IACPLF+ +L++                   ET++Q+  S+KGCGP+N  FI+ + ++TF+LPL IM+++YILTV +I +QT            +     ++   KS P T +   I + +  + +  N + N    S++ +   +   S +S N+F +   +    I    E         + + R      ++N L + + SS+  +  +   N          ++LS+     NS RI      ++  +L  +   +KAVQVLGI+FGLF+ CY+PFFVIYL DFFC+ C+++T  ++S +EWIGYSASM+NP+VYHIFNPTFR TFNRL+RC+    C +  N Q SG+
Sbjct:   47 GNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTN---------QARQNLYPNKSSTKSRPLTQIK--ITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQN-LAIKKQSSLTDKNFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKQIHLCLR--NGQASGN 501          
BLAST of GCR037 vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 321.242 bits (822), Expect = 5.225e-104
Identity = 203/475 (42.74%), Postives = 279/475 (58.74%), Query Frame = 3
Query:  141 WAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SIST-------DFSRRSLMSCNNFPTTP-------SKIQENI-------DGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLS------------LRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 1451
            WA++ L +IP+++++GN LV +SV++E  L+ RFNYFLVSLA+SDFLCAILVMP+S  KM+         HQ CL WYSLDVFFTA+TIIHLCTISIDRY AL NPL+ H  KR  SL +++  +W+IPF IACPLFL +L+++   +E SSFKGCGP NA FI+ A IVTF +PL+IM ++Y+LTVK +  Q K  +      +  S    S ++K  + S+SL       ++KV  +   +   E  S +   SIST       D   +   + N+F  TP       +   EN        D  K +  + + K +   RQ+S   ++ T   +  S+     L     +L + R    S +  T + S            L+ I +SRKAVQ LGI+F LFV CY+PFFV YL DFF   C   S    M+++ EW+GYS SM NP+VYH FNP FR T+ RL++C+CY+V
Sbjct:    9 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAE-----ANLYSNAVASLVFKPKL-SSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 476          
BLAST of GCR037 vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 321.242 bits (822), Expect = 5.846e-104
Identity = 203/475 (42.74%), Postives = 279/475 (58.74%), Query Frame = 3
Query:  141 WAXXXXXXXXXXXXXGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SIST-------DFSRRSLMSCNNFPTTP-------SKIQENI-------DGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLS------------LRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 1451
            WA++ L +IP+++++GN LV +SV++E  L+ RFNYFLVSLA+SDFLCAILVMP+S  KM+         HQ CL WYSLDVFFTA+TIIHLCTISIDRY AL NPL+ H  KR  SL +++  +W+IPF IACPLFL +L+++   +E SSFKGCGP NA FI+ A IVTF +PL+IM ++Y+LTVK +  Q K  +      +  S    S ++K  + S+SL       ++KV  +   +   E  S +   SIST       D   +   + N+F  TP       +   EN        D  K +  + + K +   RQ+S   ++ T   +  S+     L     +L + R    S +  T + S            L+ I +SRKAVQ LGI+F LFV CY+PFFV YL DFF   C   S    M+++ EW+GYS SM NP+VYH FNP FR T+ RL++C+CY+V
Sbjct:   19 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAE-----ANLYSNAVASLVFKPKL-SSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 486          
The following BLAST results are available for this feature:
BLAST of GCR037 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR2B1.114e-4729.205-hydroxytryptamine receptor 2B [Source:HGNC Symbo... [more]
DRD23.657e-3928.41dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD21.930e-3827.23dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD21.392e-3728.57dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD21.392e-3728.57dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of GCR037 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-18.342e-4628.51SERotonin/octopamine receptor family; Serotonin re... [more]
ser-11.316e-4528.51SERotonin/octopamine receptor family; Serotonin re... [more]
tyra-32.287e-3426.47TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-34.926e-3426.47TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-36.823e-3425.47TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of GCR037 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop2R4.964e-3627.46gene:FBgn0053517 transcript:FBtr0343171[more]
Dop2R8.929e-3627.13gene:FBgn0053517 transcript:FBtr0343167[more]
5-HT2B4.357e-3338.38gene:FBgn0261929 transcript:FBtr0303603[more]
5-HT2B4.357e-3338.38gene:FBgn0261929 transcript:FBtr0339322[more]
5-HT2B5.007e-3338.38gene:FBgn0261929 transcript:FBtr0330144[more]
back to top
BLAST of GCR037 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1aa2.010e-3926.845-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
drd2a6.007e-3928.00dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
drd2a6.007e-3928.00dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
drd2b2.295e-3826.26dopamine receptor D2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
drd2b2.295e-3826.26dopamine receptor D2b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of GCR037 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhoc2.949e-4429.72ras homolog family member C [Source:Xenbase;Acc:XB... [more]
rhoc3.326e-4429.72ras homolog family member C [Source:Xenbase;Acc:XB... [more]
rhoc5.497e-4429.72ras homolog family member C [Source:Xenbase;Acc:XB... [more]
DRD22.780e-4026.40dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
HTR2C8.511e-3735.195-hydroxytryptamine (serotonin) receptor 2C, G pro... [more]
back to top
BLAST of GCR037 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drd22.493e-3727.05dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94... [more]
Htr2b5.461e-3638.895-hydroxytryptamine (serotonin) receptor 2B [Sourc... [more]
Htr2c4.609e-3539.605-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Htr2c4.609e-3539.605-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Htr2a7.931e-3539.115-hydroxytryptamine (serotonin) receptor 2A [Sourc... [more]
back to top
BLAST of GCR037 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41595|5HT2B_HUMAN5.349e-4729.205-hydroxytryptamine receptor 2B OS=Homo sapiens OX... [more]
sp|P24628|DRD2A_XENLA2.746e-4026.81D(2) dopamine receptor A OS=Xenopus laevis OX=8355... [more]
sp|O42385|5H1AA_TAKRU7.780e-3924.475-hydroxytryptamine receptor 1A-alpha OS=Takifugu ... [more]
sp|P53453|DRD2L_TAKRU3.790e-3725.97D(2)-like dopamine receptor OS=Takifugu rubripes O... [more]
sp|P60026|DRD2_PANTR6.684e-3728.57D(2) dopamine receptor OS=Pan troglodytes OX=9598 ... [more]
back to top
BLAST of GCR037 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUM10.000e+0100.00GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KU742.194e-10041.89GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A0K0PUK17.317e-8137.50Orphan G-protein coupled receptor 55 OS=Platynerei... [more]
A0A1S8WK072.610e-8037.097 transmembrane receptor (Fragment) OS=Opisthorchi... [more]
A0A074ZZH12.921e-8037.09G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR037 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr2cl12.122e-4127.005-hydroxytryptamine receptor 2C-like [Source:NCBI ... [more]
drd2b1.315e-3826.17D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2a3.616e-3828.16D(2)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
drd2b5.104e-3826.29D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2b5.681e-3826.53D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of GCR037 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004593.12.464e-3538.04pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
ENSPMAT00000006953.19.962e-3238.55pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
adra2c1.172e-2425.35adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
si:dkey-247m21.35.070e-2031.03si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000009127.11.656e-1929.67pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
back to top
BLAST of GCR037 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR037 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO286031.085e-2132.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409991.847e-2132.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473595.698e-1829.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366101.962e-1727.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352925.260e-1728.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR037 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a4.127e-4227.62dopamine receptor D2 [Source:NCBI gene;Acc:1011645... [more]
ENSORLT00000005282.23.072e-3925.88pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
htr1ab1.519e-3825.585-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr2b2.193e-3733.785-hydroxytryptamine receptor 2B [Source:NCBI gene;... [more]
drd32.408e-3727.93dopamine receptor D3 [Source:NCBI gene;Acc:1011632... [more]
back to top
BLAST of GCR037 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065390.10.000e+099.79SMESG000065390.1[more]
SMESG000032679.16.100e-11243.98SMESG000032679.1[more]
SMESG000032682.16.580e-10742.64SMESG000032682.1[more]
SMESG000000740.15.225e-10442.74SMESG000000740.1[more]
SMESG000000740.15.846e-10442.74SMESG000000740.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014545 ID=SMED30014545|Name=GCR037|organism=Schmidtea mediterranea sexual|type=transcript|length=1592bp
TGAAAATCCTACTAATCTGAATTCTGATATCGTAGTGCAGAATTCATTCA
TTTGTCATGGATAACGTATCCTCCTTCAATAAGCCAAATTTCTATCATAA
TGATTCGAAAAAACAGCCCGATTTAACCAAAGATGTCAAATGGGCTTTTT
TATTTTTATTATTAATACCAATCATTACTATATTTGGGAATATTCTCGTT
GGGGTATCTGTCTACCTTGAGAAGAGACTCCAAAATCGTTTCAATTATTT
CTTAGTATCTCTTGCAGTCAGTGATTTTCTATGTGCAATTTTAGTTATGC
CAGTATCAACCGTAAAAATGGTCCATGTTGATCTCACAAATGGCTGGCCA
CATCAACTGTGTTTAGCATGGTACAGTTTGGATGTCTTCTTTACAGCAAC
TACTATTATCCATTTGTGTACAATTTCAATAGATAGGTACGTCGCCCTCA
ACAATCCTCTGCGCTTTCACCAAACTAAAAGAAAATATTCGCTTTTTATT
AAGATTTCTATTTCTTGGTTAATTCCATTTGGAATAGCTTGTCCTTTATT
TCTCTCATCTTTGAAAATCGAAACTATGAATCAAGAAGAAAGCTCTTTCA
AAGGATGCGGTCCAAATAATGCAATTTTTATCATGACTGCCGTCATCGTC
ACTTTCATTTTACCACTGCTTATAATGATGATTTCTTATATTCTAACTGT
GAAAACCATTAGAAAACAAACAAAGAATCTCGATTCTTTTTCTACCAACG
GCCACAGAAAATCTCGTTTTAGTCAGTCGGAAATATATAAGAAATCTATG
CCGAGTACAAGTCTAACGACCTCTATTCTCAACGTGAATTCCAAGGTCTG
TGATGACTTAAATCATTCTTTAAATCAAGAGAAACTCAGTTTGTTATCAA
TTTCAACAGATTTCTCCAGAAGGTCCCTGATGAGTTGCAACAACTTTCCT
ACGACTCCAAGCAAAATACAGGAAAATATTGATGGTGACAAGGAAACTTA
TTTTGATTTCAGAGGCAAATTTAGCCGATTGTCCCGGCAAATGAGTATAC
CATTCCGTAAGAATACTTTGCGTCTTCATCGAAACAGTTCAGTTAATTCA
GAACGTTTAAGATTATGCGCCAATGTGCTTCTAAATAGTCGGCTTTCAGT
TAACTCGCGTAGAATCGCGACTTCTGATTTGAGTTTGAGATACATTCAAA
AGTCTCGAAAAGCCGTTCAAGTATTGGGAATAGTTTTCGGGTTGTTTGTC
TGTTGTTACATGCCATTTTTTGTGATCTATCTTACTGATTTTTTCTGTGT
TTCCTGCAAAAGTATAACGAGTTGGATGATTTCATACAGCGAATGGATTG
GATATTCTGCTTCAATGATGAATCCAGTCGTTTATCACATCTTTAATCCG
ACCTTTCGTCGGACATTTAACAGATTGATTCGATGTCGATGCTACAAAGT
CAGCAATTTTCAAAGATCCGGAAGCTTTCTTTCATAATTAATTGTCATAA
ATAATTTGTTTCATGTTTTCCAATGAATTTTTATATCAAATCGGTGGAGC
GATAGCTTTATCTAATATTAGTCCAATATGGACTAGAAGGAC
back to top

protein sequence of SMED30014545-orf-1

>SMED30014545-orf-1 ID=SMED30014545-orf-1|Name=SMED30014545-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=477bp
MDNVSSFNKPNFYHNDSKKQPDLTKDVKWAFLFLLLIPIITIFGNILVGV
SVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQ
LCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKI
SISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTF
ILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPS
TSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCNNFPTT
PSKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSER
LRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCC
YMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTF
RRTFNRLIRCRCYKVSNFQRSGSFLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 386..410
score: 25.95
coord: 425..451
score: 28.41
coord: 109..131
score: 29.96
coord: 29..53
score: 23.39
coord: 62..83
score: 35.46
coord: 192..215
score: 25.95
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 44..443
e-value: 3.9E-55
score: 187.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 115..131
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 36..222
e-value: 1.5E-51
score: 177.7
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 326..464
e-value: 3.7E-23
score: 84.1
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 223..275
e-value: 1.5E-51
score: 177.7
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 20..468
NoneNo IPR availablePANTHERPTHR24247:SF2285-HYDROXYTRYPTAMINE (SEROTONIN) RECEPTOR 2A, ISOFORM Bcoord: 20..468
NoneNo IPR availableCDDcd150527tmA_5-HT2coord: 28..454
e-value: 1.61311E-67
score: 215.255
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 10..471
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 424..446
NoneNo IPR availableTMHMMTMhelixcoord: 101..123
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 44..443
score: 37.062