Dynein light chain

Overview
NameDynein light chain
Smed IDSMED30014544
Length (bp)368
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein light chain (SMED30014544) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein light chain (SMED30014544) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014544

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30014544SMESG000067731.1 SmedASXL_004408SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014544SMESG000067731.1 dd_Smed_v4_11037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014544SMESG000067731.1 dd_Smed_v4_11037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL2 (dynein light chain LC8-type 2 [Source:HGNC Symbol;Acc:HGNC:24596])

HSP 1 Score: 152.525 bits (384), Expect = 5.668e-49
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 148.288 bits (373), Expect = 2.602e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 148.288 bits (373), Expect = 2.602e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 148.288 bits (373), Expect = 2.602e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 148.288 bits (373), Expect = 2.602e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 149.828 bits (377), Expect = 2.388e-48
Identity = 64/89 (71.91%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+++MQ+DAI+ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 149.828 bits (377), Expect = 2.388e-48
Identity = 64/89 (71.91%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+++MQ+DAI+ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 149.828 bits (377), Expect = 2.388e-48
Identity = 64/89 (71.91%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+++MQ+DAI+ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-2 (Probable dynein light chain 2, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q21557])

HSP 1 Score: 81.6481 bits (200), Expect = 2.606e-21
Identity = 40/90 (44.44%), Postives = 58/90 (64.44%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRD-AINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M+E K  VK  DM E+ QRD  I++  EA   + ++KDVAA++K+  DKK+   WHVI G+ FGS V++E+ HFI     +  V+I+K G
Sbjct:    1 MSEEKIEVKETDM-EDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSRVSYEMGHFILLKCNKVNVMIYKCG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-5 (Dynein Light Chain [Source:UniProtKB/TrEMBL;Acc:Q65XS9])

HSP 1 Score: 83.5741 bits (205), Expect = 4.582e-21
Identity = 33/84 (39.29%), Postives = 58/84 (69.05%), Query Frame = 3
Query:   84 AIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            A V+++ M   M+++A ++A +++  + +E D+A ++K AFD++Y P+WH I G+ FGS+VT E   FIYF +G  A ++FK+ 
Sbjct:   58 ADVQHSRMPRHMEQEACSLAAKSIMTYHLEHDIARHLKMAFDREYGPDWHCICGKHFGSFVTFEPDSFIYFRIGTIAFMLFKTS 141          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070706)

HSP 1 Score: 151.754 bits (382), Expect = 5.478e-49
Identity = 64/89 (71.91%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070704)

HSP 1 Score: 151.754 bits (382), Expect = 5.478e-49
Identity = 64/89 (71.91%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0307065)

HSP 1 Score: 151.754 bits (382), Expect = 5.478e-49
Identity = 64/89 (71.91%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070707)

HSP 1 Score: 151.754 bits (382), Expect = 5.478e-49
Identity = 64/89 (71.91%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0474174)

HSP 1 Score: 156.377 bits (394), Expect = 1.628e-48
Identity = 64/89 (71.91%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 153.68 bits (387), Expect = 1.178e-49
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2b (dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:ZDB-GENE-050320-132])

HSP 1 Score: 153.68 bits (387), Expect = 1.178e-49
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 153.68 bits (387), Expect = 1.178e-49
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 151.754 bits (382), Expect = 7.355e-49
Identity = 65/89 (73.03%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA+  A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 151.754 bits (382), Expect = 7.355e-49
Identity = 65/89 (73.03%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+EEMQ+DA+  A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:NCBI gene;Acc:448652])

HSP 1 Score: 153.68 bits (387), Expect = 1.774e-49
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M+ERKA++KNADM+EEMQ+DA++ A +A+EKF +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSERKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll2 (dynein light chain LC8-type 2 [Source:NCBI gene;Acc:100038056])

HSP 1 Score: 152.525 bits (384), Expect = 5.138e-49
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: rnf181 (ring finger protein 181 [Source:Xenbase;Acc:XB-GENE-964051])

HSP 1 Score: 68.9366 bits (167), Expect = 7.053e-16
Identity = 31/85 (36.47%), Postives = 53/85 (62.35%), Query Frame = 3
Query:   84 AIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAA-YIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIY-FYLGQAAVLIFKS 332
             ++++ DM EEM+ + + +   A EKF    + AA  IK+  DKK+  +WHV++G  FG  +THE+K+ +Y F+ G  A+ ++K 
Sbjct:   21 PLIRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGSLAICVWKC 105          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: ENSXETT00000015639.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:48978690:48979872:1 gene:ENSXETG00000009974.1 transcript:ENSXETT00000015639.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.666e-12
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = -1
Query:   39 LSRFENKYSGLS*IEVYEMFDFVGYVTPELPTNNHMPIRIVFLVECFFNVSSYVFFHFELFHGLIGNVYSISLHFFIHVGIFDNGFSLSHFAIL*RDFIV 338
            L+RF+ +   L+ I+V E+  F+ Y+  ++  N+ +PI +        ++ S VF +  L H L G V SI LH F HV I DN  S+ H A + R  I+
Sbjct:    3 LARFKEENCNLAQIKVDEVLCFMCYIAAKVSANDAVPIYL-------LDIGSNVFLNIILLHCLCGTVNSILLHVFRHVSILDNSLSVRHGAPVTRQNIL 95          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 152.525 bits (384), Expect = 3.892e-49
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 152.525 bits (384), Expect = 3.892e-49
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 152.525 bits (384), Expect = 3.892e-49
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 148.288 bits (373), Expect = 1.786e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 148.288 bits (373), Expect = 1.786e-47
Identity = 63/89 (70.79%), Postives = 78/89 (87.64%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M +RKA++KNADM+EEMQ+D++  A +A+EK+ +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|O02414|DYL1_HELCR (Dynein light chain LC6, flagellar outer arm OS=Heliocidaris crassispina OX=1043166 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.145e-48
Identity = 67/89 (75.28%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M+ERKA++KNADM E+MQ+DA++ A +A+EKF +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ AVL+FKSG
Sbjct:    1 MSERKAVIKNADMPEDMQQDAVDCATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q78P75|DYL2_RAT (Dynein light chain 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Dynll2 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.722e-48
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q9D0M5|DYL2_MOUSE (Dynein light chain 2, cytoplasmic OS=Mus musculus OX=10090 GN=Dynll2 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.722e-48
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q96FJ2|DYL2_HUMAN (Dynein light chain 2, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL2 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.722e-48
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q3MHR3|DYL2_BOVIN (Dynein light chain 2, cytoplasmic OS=Bos taurus OX=9913 GN=DYNLL2 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.722e-48
Identity = 65/89 (73.03%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2M3ZIK2 (Dynein light chain (Fragment) OS=Anopheles braziliensis OX=58242 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.074e-47
Identity = 68/98 (69.39%), Postives = 85/98 (86.73%), Query Frame = 3
Query:   42 NKIASENRKMTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            N+ +S  RKM++RKA++KNADM EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:   11 NRKSSNARKMSDRKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 108          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A553NX61 (Dynein light chain OS=Tigriopus californicus OX=6832 GN=TCAL_17290 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.435e-47
Identity = 67/93 (72.04%), Postives = 83/93 (89.25%), Query Frame = 3
Query:   57 ENRKMTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            E+ KMT+RKA++KNADM+EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:    8 ESNKMTDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 100          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A1Q3FXK9 (Dynein light chain (Fragment) OS=Culex tarsalis OX=7177 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.799e-47
Identity = 68/100 (68.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   36 SHNKIASENRKMTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            + N   S N KM++RKA++KNADM EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:   21 TRNTSKSTNSKMSDRKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 120          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A1Q3FY20 (Dynein light chain (Fragment) OS=Culex tarsalis OX=7177 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.156e-47
Identity = 68/100 (68.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   36 SHNKIASENRKMTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            + N   S N KM++RKA++KNADM EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:   24 TRNTSKSTNSKMSDRKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 123          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2M4CJH8 (Dynein light chain (Fragment) OS=Anopheles darlingi OX=43151 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.374e-47
Identity = 67/98 (68.37%), Postives = 85/98 (86.73%), Query Frame = 3
Query:   42 NKIASENRKMTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            N+ ++  RKM++RKA++KNADM EEMQ+DA++ A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE +HFIYFYLGQ A+L+FKSG
Sbjct:   21 NRKSNNTRKMSDRKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG 118          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000047143.1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 153.68 bits (387), Expect = 9.987e-50
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll2b (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 153.68 bits (387), Expect = 9.987e-50
Identity = 66/89 (74.16%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+E+MQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 137.887 bits (346), Expect = 4.331e-43
Identity = 59/80 (73.75%), Postives = 71/80 (88.75%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQ 308
            M++RKA++KNADM+EEMQ+DA+  A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ 80          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dnal4b (dynein axonemal light chain 4 [Source:NCBI gene;Acc:103029781])

HSP 1 Score: 71.633 bits (174), Expect = 4.321e-17
Identity = 33/85 (38.82%), Postives = 54/85 (63.53%), Query Frame = 3
Query:   84 AIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAA-YIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIY-FYLGQAAVLIFKS 332
             ++++ DM EEM+ + + +   A EKF    + AA  IK++ DKK+  +WHV++G  FG  VTHE+K+ +Y F+ G  AV ++K 
Sbjct:   21 PLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKESMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKC 105          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000013314.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:23335261:23337700:1 gene:ENSAMXG00000012944.2 transcript:ENSAMXT00000013314.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 4.579e-15
Identity = 35/91 (38.46%), Postives = 50/91 (54.95%), Query Frame = -1
Query:   63 SRFENKYSGLS*IEVYEMFDFVGYVTPELPTNNHMPIRIVFLVECFFNVSSYVFFHFELFHGLIGNVYSISLHFFIHVGIFDNGFSLSHFA 335
            +RFE +Y  L+ +EV E+   VG VT E+P +N +P  +V L    F+V   V  +  L H L   V  + LH   HV + D+ FS+SH A
Sbjct:    4 ARFEQEYGHLAQVEVDEVLRLVGDVTAEVPAHNAVPSWVVLLAY-LFDVRCDVLLYVVLLHCLCCTVDCVLLHVLRHVSVLDHSFSVSHGA 93          
BLAST of Dynein light chain vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832])

HSP 1 Score: 99.7525 bits (247), Expect = 3.008e-29
Identity = 40/83 (48.19%), Postives = 62/83 (74.70%), Query Frame = 3
Query:   84 AIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKS 332
             IVK +D+ ++++ D + I+ +A++K+++E+D+A  +KK  D KY   WHVIVG+ FGSYVTHE  HF+YFY+G  A L+FK+
Sbjct:    9 PIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKT 91          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO44582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI5])

HSP 1 Score: 150.599 bits (379), Expect = 8.299e-49
Identity = 66/89 (74.16%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M+ERKA++KNADM E+MQ DAI  A +A+EKF +EKD+AA+IKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO38557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCP2])

HSP 1 Score: 71.633 bits (174), Expect = 1.672e-17
Identity = 32/84 (38.10%), Postives = 55/84 (65.48%), Query Frame = 3
Query:   87 IVKNADMNEEMQRDAINIANEAMEKFKVEKDVAA-YIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIY-FYLGQAAVLIFKS 332
            +++ +DMN+EM+ +A+ +   A EKF    + AA  IK++ DKK+  +WH +VG  FG  +THE+++ +Y F+ G  A+ I+K 
Sbjct:   26 LIRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFGASWHAVVGEGFGFEITHEVRNLLYMFFGGTTAICIWKC 109          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000005747.2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101162462])

HSP 1 Score: 155.221 bits (391), Expect = 3.351e-50
Identity = 67/89 (75.28%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+EEMQ+DA++ A +AMEK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: dynll1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101171417])

HSP 1 Score: 150.599 bits (379), Expect = 1.937e-48
Identity = 64/89 (71.91%), Postives = 79/89 (88.76%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M++RKA++KNADM+E+MQ+DA+  A +A+EK+ +EKD+AAYIKK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: DYNLL2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101174042])

HSP 1 Score: 149.443 bits (376), Expect = 5.864e-48
Identity = 63/89 (70.79%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            M+++KA++KNADM++EMQ+DA++ A +AMEK+ +EKD+AAY+KK FDKKYNP WH IVGR FGSYVTHE KHFIYFYLGQ A+L+FKSG
Sbjct:    1 MSDKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000028916.1 (pep primary_assembly:ASM223467v1:9:6243543:6247014:-1 gene:ENSORLG00000022487.1 transcript:ENSORLT00000028916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 4.314e-17
Identity = 38/90 (42.22%), Postives = 50/90 (55.56%), Query Frame = -1
Query:   69 LSRFENKYSGLS*IEVYEMFDFVGYVTPELPTNNHMPIRIVFLVECFFNVSSYVFFHFELFHGLIGNVYSISLHFFIHVGIFDNGFSLSH 338
            LSR E +   L+ +EV EM   V +V  E+P NN +P R+VFLVE        VF    L  GL G ++ + LH   HVGIFD+  S+ H
Sbjct:    3 LSRLEQQNGHLTQVEVNEMLGLVSHVAAEVPPNNAVPSRVVFLVELL-----DVFLDVVLLQGLCGTLHGVLLHVLRHVGIFDHCLSVRH 87          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: dnal4b (dynein axonemal light chain 4 [Source:NCBI gene;Acc:101161374])

HSP 1 Score: 67.0106 bits (162), Expect = 2.276e-15
Identity = 31/85 (36.47%), Postives = 52/85 (61.18%), Query Frame = 3
Query:   84 AIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAA-YIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIY-FYLGQAAVLIFKS 332
             ++++ DM +EM+ + + +   A E F    + AA  IK+  DKK+  +WHV++G  FG  VTHE+K+ +Y F+ G  AV ++K 
Sbjct:   21 PLIRHTDMPDEMRIETMELCVSACETFATNNESAAKMIKEHMDKKFGSSWHVVIGESFGFEVTHELKNLLYMFFGGSLAVCVWKC 105          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000067731.1 (SMESG000067731.1)

HSP 1 Score: 184.111 bits (466), Expect = 8.434e-62
Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG
Sbjct:    1 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000055712.1 (SMESG000055712.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.269e-49
Identity = 68/89 (76.40%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+EEMQ+DAI +A  AMEK+ VEKD+AAY+KK FD+KYNP+WH IVGR FGSYVTHE KHFIYFYLGQ AVL+FKSG
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAIELAALAMEKYNVEKDIAAYLKKEFDRKYNPSWHAIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000055711.1 (SMESG000055711.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.269e-49
Identity = 68/89 (76.40%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+EEMQ+DAI +A  AMEK+ VEKD+AAY+KK FD+KYNP+WH IVGR FGSYVTHE KHFIYFYLGQ AVL+FKSG
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAIELAALAMEKYNVEKDIAAYLKKEFDRKYNPSWHAIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000055686.1 (SMESG000055686.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.269e-49
Identity = 68/89 (76.40%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+EEMQ+DAI +A  AMEK+ VEKD+AAY+KK FD+KYNP+WH IVGR FGSYVTHE KHFIYFYLGQ AVL+FKSG
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAIELAALAMEKYNVEKDIAAYLKKEFDRKYNPSWHAIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000024024.1 (SMESG000024024.1)

HSP 1 Score: 153.295 bits (386), Expect = 1.269e-49
Identity = 68/89 (76.40%), Postives = 80/89 (89.89%), Query Frame = 3
Query:   69 MTERKAIVKNADMNEEMQRDAINIANEAMEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYLGQAAVLIFKSG 335
            MT+RKA++KNADM+EEMQ+DAI +A  AMEK+ VEKD+AAY+KK FD+KYNP+WH IVGR FGSYVTHE KHFIYFYLGQ AVL+FKSG
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAIELAALAMEKYNVEKDIAAYLKKEFDRKYNPSWHAIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKSG 89          
The following BLAST results are available for this feature:
BLAST of Dynein light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNLL25.668e-4973.03dynein light chain LC8-type 2 [Source:HGNC Symbol;... [more]
DYNLL12.602e-4770.79dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.602e-4770.79dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.602e-4770.79dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL12.602e-4770.79dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlc-12.388e-4871.91Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.388e-4871.91Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.388e-4871.91Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-22.606e-2144.44Probable dynein light chain 2, cytoplasmic [Sourc... [more]
dlc-54.582e-2139.29Dynein Light Chain [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctp5.478e-4971.91gene:FBgn0011760 transcript:FBtr0070706[more]
ctp5.478e-4971.91gene:FBgn0011760 transcript:FBtr0070704[more]
ctp5.478e-4971.91gene:FBgn0011760 transcript:FBtr0307065[more]
ctp5.478e-4971.91gene:FBgn0011760 transcript:FBtr0070707[more]
ctp1.628e-4871.91gene:FBgn0011760 transcript:FBtr0474174[more]
back to top
BLAST of Dynein light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynll2a1.178e-4974.16dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll2b1.178e-4974.16dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:... [more]
dynll2a1.178e-4974.16dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll17.355e-4973.03dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dynll17.355e-4973.03dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dynll11.774e-4974.16dynein light chain LC8-type 1 [Source:NCBI gene;Ac... [more]
dynll25.138e-4973.03dynein light chain LC8-type 2 [Source:NCBI gene;Ac... [more]
rnf1817.053e-1636.47ring finger protein 181 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000015639.11.666e-1235.00pep primary_assembly:Xenopus_tropicalis_v9.1:2:489... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dynll23.892e-4973.03dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll23.892e-4973.03dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll23.892e-4973.03dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll11.786e-4770.79dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
Dynll11.786e-4770.79dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Dynein light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02414|DYL1_HELCR1.145e-4875.28Dynein light chain LC6, flagellar outer arm OS=Hel... [more]
sp|Q78P75|DYL2_RAT2.722e-4873.03Dynein light chain 2, cytoplasmic OS=Rattus norveg... [more]
sp|Q9D0M5|DYL2_MOUSE2.722e-4873.03Dynein light chain 2, cytoplasmic OS=Mus musculus ... [more]
sp|Q96FJ2|DYL2_HUMAN2.722e-4873.03Dynein light chain 2, cytoplasmic OS=Homo sapiens ... [more]
sp|Q3MHR3|DYL2_BOVIN2.722e-4873.03Dynein light chain 2, cytoplasmic OS=Bos taurus OX... [more]
back to top
BLAST of Dynein light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2M3ZIK21.074e-4769.39Dynein light chain (Fragment) OS=Anopheles brazili... [more]
A0A553NX611.435e-4772.04Dynein light chain OS=Tigriopus californicus OX=68... [more]
A0A1Q3FXK91.799e-4768.00Dynein light chain (Fragment) OS=Culex tarsalis OX... [more]
A0A1Q3FY202.156e-4768.00Dynein light chain (Fragment) OS=Culex tarsalis OX... [more]
A0A2M4CJH82.374e-4768.37Dynein light chain (Fragment) OS=Anopheles darling... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047143.19.987e-5074.16dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll2b9.987e-5074.16dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll14.331e-4373.75dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dnal4b4.321e-1738.82dynein axonemal light chain 4 [Source:NCBI gene;Ac... [more]
ENSAMXT00000013314.24.579e-1538.46pep primary_assembly:Astyanax_mexicanus-2.0:1:2333... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN23.008e-2948.19Cytoplasmic light chain dynein, microtubule motor ... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO445828.299e-4974.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385571.672e-1738.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005747.23.351e-5075.28dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll11.937e-4871.91dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
DYNLL25.864e-4870.79dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000028916.14.314e-1742.22pep primary_assembly:ASM223467v1:9:6243543:6247014... [more]
dnal4b2.276e-1536.47dynein axonemal light chain 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067731.18.434e-62100.00SMESG000067731.1[more]
SMESG000055712.11.269e-4976.40SMESG000055712.1[more]
SMESG000055711.11.269e-4976.40SMESG000055711.1[more]
SMESG000055686.11.269e-4976.40SMESG000055686.1[more]
SMESG000024024.11.269e-4976.40SMESG000024024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014544 ID=SMED30014544|Name=Dynein light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=368bp
TTAAAACAAAATCTTATATAAATACTTGTTTATTTTCACACAATAAAATC
GCGTCAGAGAATCGCAAAATGACTGAGAGAAAAGCCATTGTCAAAAATGC
CGACATGAATGAAGAAATGCAACGAGATGCTATAAACATTGCCAATGAGG
CCATGGAAAAGTTCAAAGTGGAAAAAGACGTAGCTGCTTACATTAAAAAA
GCATTCGACAAGAAATACAATCCGAATTGGCATGTGATTGTTGGTCGGAA
GTTCGGGAGTTACGTAACCCACGAAATCAAACATTTCATATACTTCTATT
TAGGACAAGCCGCTGTACTTATTTTCAAATCTGGATAATTATCTCTCCTC
GATACATTTTGTATGGGT
back to top

protein sequence of SMED30014544-orf-1

>SMED30014544-orf-1 ID=SMED30014544-orf-1|Name=SMED30014544-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
KTKSYINTCLFSHNKIASENRKMTERKAIVKNADMNEEMQRDAINIANEA
MEKFKVEKDVAAYIKKAFDKKYNPNWHVIVGRKFGSYVTHEIKHFIYFYL
GQAAVLIFKSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
IPR019763Dynein_light_1/2_CS
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0006810transport
GO:0008039synaptic target recognition
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005875microtubule associated complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005874microtubule
GO:0016020membrane
GO:0016459myosin complex
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005515protein binding
GO:0008092cytoskeletal protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 23..110
e-value: 1.0E-53
score: 194.4
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 27..110
e-value: 1.9E-38
score: 130.6
IPR001372Dynein light chain, type 1/2PANTHERPTHR11886DYNEIN LIGHT CHAINcoord: 23..111
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 23..111
e-value: 9.1E-43
score: 146.3
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 20..111
NoneNo IPR availablePANTHERPTHR11886:SF62DYNEIN LIGHT CHAINcoord: 23..111
IPR019763Dynein light chain, type 1/2, conserved sitePROSITEPS01239DYNEIN_LIGHT_1coord: 77..91