cAMP-dependent protein kinase type II regulatory subunit

Overview
NamecAMP-dependent protein kinase type II regulatory subunit
Smed IDSMED30014539
Length (bp)1923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type II regulatory subunit (SMED30014539) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit (SMED30014539) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type II regulatory subunit (SMED30014539) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit (SMED30014539) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014539SMESG000019065.1 dd_Smed_v4_2902_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014539SMESG000019065.1 Contig50857newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014539SMESG000019065.1 Contig50857uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 325.479 bits (833), Expect = 5.808e-105
Identity = 175/393 (44.53%), Postives = 240/393 (61.07%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEND-----------DQMEELXXXX-------------XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV VLR  P D+++F ++YF   +  +  ++ L + +              D++ +                      RR  V AE+++P++E++    R+++PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFER V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPLLK L   ERM I D +  +IY+    II QGE     Y +E G V + +R      + G + E E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 395          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 325.479 bits (833), Expect = 5.808e-105
Identity = 175/393 (44.53%), Postives = 240/393 (61.07%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEND-----------DQMEELXXXX-------------XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV VLR  P D+++F ++YF   +  +  ++ L + +              D++ +                      RR  V AE+++P++E++    R+++PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFER V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPLLK L   ERM I D +  +IY+    II QGE     Y +E G V + +R      + G + E E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 395          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 307.76 bits (787), Expect = 2.326e-98
Identity = 168/387 (43.41%), Postives = 231/387 (59.69%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEND-----------DQMEELXXXX-------------XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV VLR  P D+++F ++YF   +  +  ++ L + +              D++ +                      RR  V AE+++P++E++    R+++PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFER V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPLLK L   ERM I D +  +IY+    II Q +   +                G + E E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQTKSNKD----------------GGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 300.442 bits (768), Expect = 3.649e-95
Identity = 145/295 (49.15%), Postives = 200/295 (67.80%), Query Frame = 1
Query:  301 VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V AE+++P++E+D  + RI++PKT +QR RL  A ++ILLF+ LD EQM  V+DAMFE+ V  GE VI QG+DGDNFYVI+ GT+DI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YE+ +E++P LK L   ER+ + D + T++Y     II QG+     + +E G V++T++  G      +   E+ R   G YFGELAL+T  PRAAS + +   K   +DV +FERLLGPC++IM+R+I+ YEEQL  +FG+
Sbjct:  115 VCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGT 409          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 300.442 bits (768), Expect = 3.649e-95
Identity = 145/295 (49.15%), Postives = 200/295 (67.80%), Query Frame = 1
Query:  301 VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V AE+++P++E+D  + RI++PKT +QR RL  A ++ILLF+ LD EQM  V+DAMFE+ V  GE VI QG+DGDNFYVI+ GT+DI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YE+ +E++P LK L   ER+ + D + T++Y     II QG+     + +E G V++T++  G      +   E+ R   G YFGELAL+T  PRAAS + +   K   +DV +FERLLGPC++IM+R+I+ YEEQL  +FG+
Sbjct:  115 VCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGT 409          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 204.527 bits (519), Expect = 3.924e-60
Identity = 115/281 (40.93%), Postives = 162/281 (57.65%), Query Frame = 1
Query:  313 SFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLK 1155
            S +P KEDD   +++V PK    R  L  A++  LLF  L+E++   + DAMF      GE +I QGE+GDNFYVI+ GT D+ V    V T     +  GSFGELAL+Y TPRAAT+    D  +WA+ R T+R I++    +KR  Y+  L  V +L +L  +ER N+ADAL    +EP T +++QG+PG E + + EG   V  + +       V  +G   YFGE+ALL   PRAA+V      K   LD   FER++GP  +I++R +SNY   +K
Sbjct:   55 SAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLT----INEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 331          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 205.297 bits (521), Expect = 5.749e-60
Identity = 115/281 (40.93%), Postives = 162/281 (57.65%), Query Frame = 1
Query:  313 SFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLK 1155
            S +P KEDD   +++V PK    R  L  A++  LLF  L+E++   + DAMF      GE +I QGE+GDNFYVI+ GT D+ V    V T     +  GSFGELAL+Y TPRAAT+    D  +WA+ R T+R I++    +KR  Y+  L  V +L +L  +ER N+ADAL    +EP T +++QG+PG E + + EG   V  + +       V  +G   YFGE+ALL   PRAA+V      K   LD   FER++GP  +I++R +SNY   +K
Sbjct:   87 SAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLT----INEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 363          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 205.297 bits (521), Expect = 7.993e-60
Identity = 115/281 (40.93%), Postives = 162/281 (57.65%), Query Frame = 1
Query:  313 SFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLK 1155
            S +P KEDD   +++V PK    R  L  A++  LLF  L+E++   + DAMF      GE +I QGE+GDNFYVI+ GT D+ V    V T     +  GSFGELAL+Y TPRAAT+    D  +WA+ R T+R I++    +KR  Y+  L  V +L +L  +ER N+ADAL    +EP T +++QG+PG E + + EG   V  + +       V  +G   YFGE+ALL   PRAA+V      K   LD   FER++GP  +I++R +SNY   +K
Sbjct:   97 SAEPIKEDDTEYKKVVIPKDDATRRSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLT----INEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 113.235 bits (282), Expect = 7.428e-26
Identity = 71/248 (28.63%), Postives = 123/248 (49.60%), Query Frame = 1
Query:  361 YPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYC-VEKTKLAILDVGSFERLLG 1101
            Y KT   +  +  AVQ     + L +EQ++++++ M+E R   G+ VI +GE GD  +V+  G     ++++     +GK       GELA++YN  R A++Q + D  +W + R  F+ I  +   ++  +    L  V + + LS      +AD +    Y+    II+QGE G   + +  G V+VT +  G     E+  +  G +FGE ALL +  R A++       ++  LD  SF +L+G
Sbjct:  139 YNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGE----LQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG 382          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 113.235 bits (282), Expect = 7.428e-26
Identity = 71/248 (28.63%), Postives = 123/248 (49.60%), Query Frame = 1
Query:  361 YPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYC-VEKTKLAILDVGSFERLLG 1101
            Y KT   +  +  AVQ     + L +EQ++++++ M+E R   G+ VI +GE GD  +V+  G     ++++     +GK       GELA++YN  R A++Q + D  +W + R  F+ I  +   ++  +    L  V + + LS      +AD +    Y+    II+QGE G   + +  G V+VT +  G     E+  +  G +FGE ALL +  R A++       ++  LD  SF +L+G
Sbjct:  139 YNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGE----LQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG 382          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088437)

HSP 1 Score: 350.132 bits (897), Expect = 2.753e-115
Identity = 185/375 (49.33%), Postives = 253/375 (67.47%), Query Frame = 1
Query:   61 ISAMPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN----DDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEK-TKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            +S+   R + +P   KE+L  F++  L + P D+I + ++YF   +SE+   +H D  +++    + Q  +  P      RR+ V AE++DPE +DD +    V+PKT EQRARL  +V+N+LLFR L++EQM  V+DAMFER+V  G+ +I QG+DGDNFYVIESG Y + +     D  +  Y+ +G FGELAL+YN PRAAT+Q    G++WAM R+TFR I+LK AF+KR  YE LL +VP+LK L  YERMN+ADAL+++ Y+    IIKQG+    MYF+EEG   V+VR    D E E++++G G YFGELAL+T  PRAASVY      KLA LDV +FERLLGPC+DIM+R+I +YE QL  IFGS
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGT--VSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFGS 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088438)

HSP 1 Score: 350.132 bits (897), Expect = 2.753e-115
Identity = 185/375 (49.33%), Postives = 253/375 (67.47%), Query Frame = 1
Query:   61 ISAMPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN----DDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEK-TKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            +S+   R + +P   KE+L  F++  L + P D+I + ++YF   +SE+   +H D  +++    + Q  +  P      RR+ V AE++DPE +DD +    V+PKT EQRARL  +V+N+LLFR L++EQM  V+DAMFER+V  G+ +I QG+DGDNFYVIESG Y + +     D  +  Y+ +G FGELAL+YN PRAAT+Q    G++WAM R+TFR I+LK AF+KR  YE LL +VP+LK L  YERMN+ADAL+++ Y+    IIKQG+    MYF+EEG   V+VR    D E E++++G G YFGELAL+T  PRAASVY      KLA LDV +FERLLGPC+DIM+R+I +YE QL  IFGS
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGT--VSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFGS 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112902)

HSP 1 Score: 330.872 bits (847), Expect = 9.345e-108
Identity = 181/379 (47.76%), Postives = 249/379 (65.70%), Query Frame = 1
Query:   61 ISAMPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN----DDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEK-TKLAILDVGSFERLLGPCLDIMQRSISNY---EEQLKGIFGSL 1173
            +S+   R + +P   KE+L  F++  L + P D+I + ++YF   +SE+   +H D  +++    + Q  +  P      RR+ V AE++DPE +DD +    V+PKT EQRARL  +V+N+LLFR L++EQM  V+DAMFER+V  G+ +I QG+DGDNFYVIESG Y + +     D  +  Y+ +G FGELAL+YN PRAAT+Q    G++WAM R+TFR I+LK AF+KR  YE LL +VP+LK L  YERMN+ADAL+++ Y+    IIKQG+    MYF+EEG   V+VR    D E E++++G G YFGELAL+T  PRAASVY      KLA LDV  FERL+G C   +QRSIS Y   E+ L+  FG+L
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGT--VSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVICFERLMGKCSGGIQRSISGYRYLEQDLREYFGNL 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112901)

HSP 1 Score: 323.168 bits (827), Expect = 9.211e-105
Identity = 174/369 (47.15%), Postives = 243/369 (65.85%), Query Frame = 1
Query:   61 ISAMPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQME------ELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEK-TKLAILDVGSFERLLGPCLDIMQRSISNYEE 1146
            +S+   R + +P   KE+L  F++  L + P D+I + ++YF   +SE+   +H D  +  DDQ+       +  P      RR+ V AE++DPE +DD +    V+PKT EQRARL  +V+N+LLFR L++EQM  V+DAMFER+V  G+ +I QG+DGDNFYVIESG Y + +     D  +  Y+ +G FGELAL+YN PRAAT+Q    G++WAM R+TFR I+LK AF+KR  YE LL +VP+LK L  YERMN+ADAL+++ Y+    IIKQG+    MYF+EEG   V+VR    D E E++++G G YFGELAL+T  PRAASVY      KLA LD  +FER++G   D+++R+I  YE+
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQST--DDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGT--VSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAFERIMGFLTDVLKRNIVIYEQ 361          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300535)

HSP 1 Score: 218.394 bits (555), Expect = 1.028e-64
Identity = 140/355 (39.44%), Postives = 203/355 (57.18%), Query Frame = 1
Query:  100 GFKELLQDFTV--CVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESE--NDDQMEELXXXXXXXX----XXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
            G + +L+D  V  CV R  PE+ +QF   YF+  + EQ++   LD+  +  + D  E+L PMP+       RR G++AE     +ED  N  + V PK  +    L+ A+   +LF  LDE +  D+ DAMF    + GE +I QG++GDNFYVI+ G  D+ V    V T        GSFGELAL+Y TPRAAT++   D  +W + R+++R I++    +KR  YE  L  V +L+ L  +ER+ +AD+L T  ++   TI+KQG  G + Y + EGC  V  + +  +  AEV R+G   YFGE+ALL   PRAA+V      K   LD   FER+LGPC DI++R+I+ Y
Sbjct:   25 GIQRVLKDCIVQLCVCR--PENPVQFLRQYFQKLEREQVK---LDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPV--TEEDATNYVKKVVPKDYKTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTT----ISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRNITQY 368          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 318.546 bits (815), Expect = 8.107e-103
Identity = 168/371 (45.28%), Postives = 232/371 (62.53%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN-----------DDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + +     +E  N           + + E+             + AE+++P+++++  + R+ YPKT EQR RL  A ++ILLF+ LD+EQM  V+DAMFE+ VV GE +I Q +DGDNFYVIE G ++I++K +G    VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +  +PLL  L   ERM + D L T++Y     II QG+     Y +E G VR+T++ +    E E+     G YFGELAL+T  PRAAS Y ++  K  ++DV +FERLLGPC+DIM+R+I+NYEEQL  +FGS
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPADLLEFALQYFTRLKENETRGGAFGNEPVNFIEEAMQIDSENGEEEDDDEEFVGNAFASALCAEAYNPDEDEEEREPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRS---KEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFGS 372          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 317.775 bits (813), Expect = 2.883e-102
Identity = 172/386 (44.56%), Postives = 235/386 (60.88%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSE---------------------SENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + +     +E                     SEN  + E+             + AE+++P+++++  + R+ YPKT EQR RL  A ++ILLF+ LD+EQM  V+DAMFE+ VV GE +I Q +DGDNFYVIE G ++I++K +G    VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +  +PLL  L   ERM + D L T++Y     II QG+     Y +E G VR+T++ + S     D E E+     G YFGELAL+T  PRAAS Y ++  K  ++DV +FERLLGPC+DIM+R+I+NYEEQL  +FGS
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPADLLEFALQYFTRLKENETRGGAFGNERNPATRAGKAVNFIEEAMQIDSENG-EEEDDDEEFVGNAFASALCAEAYNPDEDEEEREPRVTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKSKNDTEDEEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFGS 389          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 309.686 bits (792), Expect = 2.931e-99
Identity = 168/383 (43.86%), Postives = 226/383 (59.01%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSE---------------------SENDDQMEELXXXXXXXXXXXXVAA--ESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + +     +E                     SEN ++ ++          +  +A   + F    +       + YPKT EQR RL  A ++ILLF+ LD+EQM  V+DAMFE+ VV GE +I Q +DGDNFYVIE G ++I++K +G    VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +  +PLL  L   ERM + D L T++Y     II QG+     Y +E G VR+T++   S  E E+     G YFGELAL+T  PRAAS Y ++  K  ++DV +FERLLGPC+DIM+R+I+NYEEQL  +FGS
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPADLLEFALQYFTRLKENETRGGAFGNERNPATRAGKAVNFIEEAMQIDSENGEEEDDDEEFVDAAFAQLLLAGFPQCFAVCAQ-------VTYPKTDEQRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKR--SKVEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLITLFGS 378          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 308.145 bits (788), Expect = 1.247e-98
Identity = 167/387 (43.15%), Postives = 236/387 (60.98%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAH-----------------LDSESENDDQMEELXXXX-----XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-----EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ +TV VLR  P D+++F + YF   +  + Q                    + +ES  D+  E+              RR  V AE+F+P+ +++ ++ R+V+PKT EQR RL  A ++ILLF+ LD+EQ  +V+DAMFE  V   + VI QG+DGDNFYVIE G YDI+V+ +GV   VG+Y+  GSFGELALMYNTPRAATI   ++G +W + R TFR +++K   +KR  YE  +E++PLLK L   ERM I D L  + ++    II QG+     Y +E G V++ ++     +   + E E+ R   G YFGELAL+T  PRAAS Y +   K  ++D+ +FERLLGPC +IM+R+I++YEEQL  +FGS
Sbjct:    5 IPVGLTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRDTRSQDGSGAAAKTGGKGVMFDGEPMQTESNGDEDDEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDEEDSEPRVVHPKTDEQRCRLQEACKDILLFKALDQEQFSEVLDAMFEVLVQPQDHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYNNKGSFGELALMYNTPRAATIIAKDEGALWGLDRATFRRLIVKNNAKKRRMYECFIESIPLLKSLELSERMKIVDVLGVKTFQDGERIIMQGDKADCFYIVESGEVKIMMKSKTKADRQDNAEVEIARCSRGQYFGELALVTNKPRAASAYAIGDVKCLVIDIQAFERLLGPCKEIMKRNIAHYEEQLVALFGS 391          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 280.796 bits (717), Expect = 1.153e-87
Identity = 145/299 (48.49%), Postives = 201/299 (67.22%), Query Frame = 1
Query:  301 VAAESFDPEKEDDP----NQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDT-----EAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V AE ++P+++DD     +Q  +++ KT EQR RL  A ++ILLF+ L+E+Q+ +V+D+MFE  V  GE +I QG+DGDNFYVIE G Y+I+++ +G+   VG+YD  GSFGELALMYNTPRAATI+ + +G +WA+ R TF  +++K   +KR  YE+ +E VPLLK L   ERM I D L  R +     II+QG+     Y +E G VR+ +R           E EV R   G YFGELAL+TK PRAASVY V  T+  ++DV +FERLLG C  I++R+I++YE+QL  +FGS
Sbjct:  118 VCAEPYNPDEDDDDGDEGSQLTVLHQKTDEQRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVLVKPGECIINQGDDGDNFYVIERGVYEIVIQQDGLQHSVGRYDHKGSFGELALMYNTPRAATIRALQEGALWALDRATFHRLIVKNNAKKRRMYESFIECVPLLKSLQLSERMKIVDVLGMRSFSDGERIIQQGDSADCFYIVESGEVRIMIRSKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRAASVYAVGDTRCLVIDVQAFERLLGSCKQILKRNITHYEQQLVAVFGS 416          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 331.257 bits (848), Expect = 2.443e-107
Identity = 173/380 (45.53%), Postives = 232/380 (61.05%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLD---------------SESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-----EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR  PED+++F + YF   K  + Q   L                +E       E              V AE+++P++EDD  + +++YPKT +QR RL  A ++ILLF+ LD+EQM  V+DAMFE+ V  GE VI QG+DGDNFYVI+ GTYDI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +K+  YE  +E++P LK L   ER+ + D + T+ Y     II QG+     Y +E G VR+ ++     +A ++   E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC++IM+R+I+NYEEQL  +FG+
Sbjct:    5 IPEGLTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPFRLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVVCAEAYNPDEEDDDTETKVIYPKTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFGT 384          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 328.176 bits (840), Expect = 4.097e-106
Identity = 178/392 (45.41%), Postives = 243/392 (61.99%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLD---------------------SESENDDQMEE------LXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-----EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR  PED+++F + YF   K  + Q   L                      ++SEN ++ E+      + P+     RR  V AE+++P++EDD  + +++YPKT +QR RL  A ++ILLF+ LD+EQM  V+DAMFE+ V  GE VI QG+DGDNFYVI+ GTYDI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +K+  YE  +E++P LK L   ER+ + D + T+ Y     II QG+     Y +E G VR+ ++     +A ++   E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC++IM+R+I+NYEEQL  +FG+
Sbjct:    5 IPEGLTELLQSFTVEVLRKQPEDLLEFALQYFTQLKQSKSQGGPLSHGMELPFRLTKGVIFAEEPMQTDSENGEEEEDDDEEDFVAPVINRFSRRASVCAEAYNPDEEDDDTETKVIYPKTDDQRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAFERLLGPCMEIMKRNIANYEEQLVALFGT 396          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 327.405 bits (838), Expect = 1.009e-105
Identity = 181/391 (46.29%), Postives = 240/391 (61.38%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSA-------------HLDSE---SENDDQMEELXXXXXXX----------XXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAG-----SDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IPPG  +LLQ +TV VLR  P D+++F I YF   K +QLQ               + D E   +E++   EE                   RR  V AE+++P++ED+  + R+V PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE RV   E VI QG+DGDNFYV+E G YDI V+ +G    VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I+LK   +KR  YE  +E+VP+LK L   ERM I D +  R+Y+    II QG+     + +E G V++ ++        S+ E E+ R   G YFGELAL+T  PRAAS Y V   K  I+DV +FERLLGPC+DIM+R+I++YEEQL  +FGS
Sbjct:    5 IPPGLTDLLQGYTVEVLRQKPPDLVEFAIQYFTRLKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFEPPVINRYSRRVSVCAEAYNPDEEDEDTEPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFGS 395          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 325.094 bits (832), Expect = 9.572e-105
Identity = 180/396 (45.45%), Postives = 239/396 (60.35%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSA-------------HLDSE---SENDDQMEELXXXXXXXXXXXX---------------VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAG-----SDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IPPG  +LLQ +TV VLR  P D+++F I YF   K +QLQ               + D E   +E++   EE           R                V AE+++P++ED+  + R+V PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE RV   E VI QG+DGDNFYV+E G YDI V+ +G    VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I+LK   +KR  YE  +E+VP+LK L   ERM I D +  R+Y+    II QG+     + +E G V++ ++        S+ E E+ R   G YFGELAL+T  PRAAS Y V   K  I+DV +FERLLGPC+DIM+R+I++YEEQL  +FGS
Sbjct:    5 IPPGLTDLLQGYTVEVLRQKPPDLVEFAIQYFTRLKEKQLQDGAGAGSLRPHARVVNFDGEPMQTESNGDEEEDEEDDDDSDFERKRPHVLWAGLEFEKTGVCAEAYNPDEEDEDTEPRVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFGS 400          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 288.5 bits (737), Expect = 3.847e-92
Identity = 145/277 (52.35%), Postives = 187/277 (67.51%), Query Frame = 1
Query:  355 IVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAG-----SDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            +V PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE RV   E VI QG+DGDNFYV+E G YDI V+ +G    VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I+LK   +KR  YE  +E+VP+LK L   ERM I D +  R+Y+    II QG+     + +E G V++ ++        S+ E E+ R   G YFGELAL+T  PRAAS Y V   K  I+DV +FERLLGPC+DIM+R+I++YEEQL  +FGS
Sbjct:   18 VVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLLGPCMDIMKRNITHYEEQLVALFGS 294          

HSP 2 Score: 59.3066 bits (142), Expect = 6.360e-9
Identity = 32/132 (24.24%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  352 RIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKI-------NGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIV 726
            RI+     ++R    + ++++ + + L+  + + ++D +  R    G+++I QG+  D F+++ESG   I++K        +  + ++ +      FGELAL+ N PRAA+   V D     M  + F  ++
Sbjct:  139 RIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAFERLL 270          

HSP 3 Score: 56.225 bits (134), Expect = 5.609e-8
Identity = 38/138 (27.54%), Postives = 63/138 (45.65%), Query Frame = 1
Query:  685 VVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLL 1098
            +V A+       +V  K  ++R + +   +++ L K L   +   + DA+     +P   +I QG+ G   Y +E G   + V   G      V R    G FGELAL+   PRAA++    +  L  LD  +F R++
Sbjct:    6 IVCALAHLYTLGVVRPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSR--CVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRII 141          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 332.413 bits (851), Expect = 6.380e-108
Identity = 179/391 (45.78%), Postives = 240/391 (61.38%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF---------------------KTKKSEQLQSAHLDSESENDDQMEELXXXX-XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IP G  ELLQ +TV VLR  P D++ F ++YF                      T++S  +     D ES++D +  +L         RR  V AE+F+P++E++ N  R+V+PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE+ V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPL K L   ERM I D +  +IY+    II QGE     Y +E G V + +R      + G + E E+     G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPAGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 393          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 314.694 bits (805), Expect = 3.008e-101
Identity = 172/385 (44.68%), Postives = 231/385 (60.00%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF---------------------KTKKSEQLQSAHLDSESENDDQMEELXXXX-XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IP G  ELLQ +TV VLR  P D++ F ++YF                      T++S  +     D ES++D +  +L         RR  V AE+F+P++E++ N  R+V+PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE+ V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPL K L   ERM I D +  +IY+    II Q +                  + G + E E+     G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPAGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQTKSN----------------KNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 371          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 299.286 bits (765), Expect = 6.780e-95
Identity = 145/295 (49.15%), Postives = 201/295 (68.14%), Query Frame = 1
Query:  301 VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V AE+++P++E+D  + RI++PKT +QR RL  A ++ILLF+ LD EQM  V+DAMFE+ V +GE VI QG+DGDNFYVI+ GT+DI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YE+ +E++P LK L   ER+ + D + T++Y     II QG+     + +E G V++T++  G      +   E+ R   G YFGELAL+T  PRAAS + +   K   +DV +FERLLGPC++IM+R+I+ YEEQL  +FG+
Sbjct:  113 VCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGT 407          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 299.286 bits (765), Expect = 6.780e-95
Identity = 145/295 (49.15%), Postives = 201/295 (68.14%), Query Frame = 1
Query:  301 VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V AE+++P++E+D  + RI++PKT +QR RL  A ++ILLF+ LD EQM  V+DAMFE+ V +GE VI QG+DGDNFYVI+ GT+DI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YE+ +E++P LK L   ER+ + D + T++Y     II QG+     + +E G V++T++  G      +   E+ R   G YFGELAL+T  PRAAS + +   K   +DV +FERLLGPC++IM+R+I+ YEEQL  +FG+
Sbjct:  113 VCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGT 407          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 248.054 bits (632), Expect = 1.946e-77
Identity = 121/247 (48.99%), Postives = 164/247 (66.40%), Query Frame = 1
Query:  445 MVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGS-----DTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            M  V+DAMFE+ V +GE VI QG+DGDNFYVI+ GT+DI VK +GV   VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YE+ +E++P LK L   ER+ + D + T++Y     II QG+     + +E G V++T++  G      +   E+ R   G YFGELAL+T  PRAAS + +   K   +DV +FERLLGPC++IM+R+I+ YEEQL  +FG+
Sbjct:    1 MSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGT 247          

HSP 2 Score: 55.0694 bits (131), Expect = 8.346e-8
Identity = 33/132 (25.00%), Postives = 64/132 (48.48%), Query Frame = 1
Query:  352 RIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVD-------TKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIV 726
            RI+     ++R      ++++   + L+  + + V+D +  +    GE++I QG+  D+F+++ESG   I +K  G          ++ +      FGELAL+ N PRAA+   +      AM  + F  ++
Sbjct:   92 RIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLL 223          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|Q26619|KAPR_STRPU (cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.021e-120
Identity = 195/371 (52.56%), Postives = 246/371 (66.31%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQ---------SAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDT---EAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFG 1167
            IP G  +LLQDFTV VLR+ P D+++F   YF   +   +          +A  D+ES+ DD+  ELP     + +   V AE +DPE ++D + +++VYPK+ EQRARL  AV+NILLFR LDE+QM +VIDAMFE++   G+ VI QG+DGDNFYVI+ G YDI V     D KVG Y  SGSFGELALMYNTPRAATI    DG++WA+ R +FR IVLK A +KR  YE LLE V + K L PYERMN+ADAL+TR YE    II QG+     YF+E G  R+ ++   SD    E EV     G YFGELALLT  PRAASVY VE     +LDV +FERLLGPC+DIM+R+I +YE++   +FG
Sbjct:    5 IPEGLTDLLQDFTVAVLREKPSDLVEFASSYFAKLQENNISLGGKRGVTFTAPEDAESDIDDEPPELPKNRYARRKS--VCAEKYDPEADNDTDTQKLVYPKSDEQRARLTEAVKNILLFRALDEKQMQEVIDAMFEKKTTPGDHVIDQGDDGDNFYVIDRGEYDIFVN----DNKVGAYKDSGSFGELALMYNTPRAATIAATTDGILWALDRVSFRRIVLKNAAKKRRIYEELLEKVSIFKSLEPYERMNLADALVTRTYEDGDCIIAQGDGADGCYFIEAGQCRIAMKSERSDNPDEEKEVAIYNQGQYFGELALLTNKPRAASVYAVEDVD-CLLDVNAFERLLGPCMDIMKRNIEHYEQETSRLFG 368          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P81900|KAPR2_DROME (cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 2.760e-114
Identity = 185/375 (49.33%), Postives = 253/375 (67.47%), Query Frame = 1
Query:   61 ISAMPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN----DDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEK-TKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            +S+   R + +P   KE+L  F++  L + P D+I + ++YF   +SE+   +H D  +++    + Q  +  P      RR+ V AE++DPE +DD +    V+PKT EQRARL  +V+N+LLFR L++EQM  V+DAMFER+V  G+ +I QG+DGDNFYVIESG Y + +     D  +  Y+ +G FGELAL+YN PRAAT+Q    G++WAM R+TFR I+LK AF+KR  YE LL +VP+LK L  YERMN+ADAL+++ Y+    IIKQG+    MYF+EEG   V+VR    D E E++++G G YFGELAL+T  PRAASVY      KLA LDV +FERLLGPC+DIM+R+I +YE QL  IFGS
Sbjct:    1 MSSDSSRRIQVPEELKEVLLQFSISFLVEQPPDVIDYAVEYFTKLQSERPSVSHTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGT--VSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAFERLLGPCMDIMKRNIDDYESQLVKIFGS 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P00515|KAP2_BOVIN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 330.872 bits (847), Expect = 1.881e-106
Identity = 179/392 (45.66%), Postives = 244/392 (62.24%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQS-----------------------AHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREA------GSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV VLR  P D++ F +DYF   +  + ++                       A  DSESE+++ ++   P+P    RR  V AE+++P++E++    R+++PKT +QR RL  A ++ILLF+ LD EQ+  V+DAMFER V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPLLK L   ERM I D +  ++Y+    II QGE     Y +E G V + ++        G + E E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVLRQRPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQDFDPGAGLVADAVADSESEDEEDLD--VPIPGRFDRRVSVCAETYNPDEEEEDTDPRVIHPKTDQQRCRLQEACKDILLFKNLDPEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKVYKDGERIITQGEKADSFYIIESGEVSILIKSKTKVNKDGENQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 392          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P12367|KAP2_MOUSE (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 2.509e-104
Identity = 178/391 (45.52%), Postives = 240/391 (61.38%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF---------------------KTKKSEQLQSAHLDSESENDDQMEELXXXX-XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV V +  P D++ F ++YF                      T++S  +     D ES++D +  +L         RR  V AE+F+P++E++ N  R+V+PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFE+ V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPL K L   ERM I D +  +IY+    II QGE     Y +E G V + +R      + G + E E+     G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVGQ-QPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYGVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 392          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Match: sp|P13861|KAP2_HUMAN (cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 2.789e-104
Identity = 175/393 (44.53%), Postives = 240/393 (61.07%), Query Frame = 1
Query:   82 EVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEND-----------DQMEELXXXX-------------XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
             + IPPG  ELLQ +TV VLR  P D+++F ++YF   +  +  ++ L + +              D++ +                      RR  V AE+++P++E++    R+++PKT EQR RL  A ++ILLF+ LD+EQ+  V+DAMFER V   E VI QG+DGDNFYVIE GTYDI+V  +     VG+YD  GSFGELALMYNTPRAATI   ++G +W + R TFR I++K   +KR  +E+ +E+VPLLK L   ERM I D +  +IY+    II QGE     Y +E G V + +R      + G + E E+ R   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+IS+YEEQL  +FGS
Sbjct:    3 HIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGS 395          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A0R3VUE8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS943 PE=4 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 1.619e-162
Identity = 241/373 (64.61%), Postives = 292/373 (78.28%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            M K+ V +P G +E+LQDFTV VLR+ P +II F  +YF+ KK++Q ++  ++S+       EE+   P    RR+GVAAES+DPEKED    E++V+ KT EQR RL  A + ILLFRCLDE+QM DVIDAMFER+V  GEKVI  GEDGDNFYVIE G YDIIVK++GV+ KVG+YD +GSFGELALMYNTPRAATIQ    G++WAMTRE FRSIVLK AF+KR  YE LL  VP+L+ LS YERM+IADAL T+IYE  T II QG+ G EMYF+E+G VR+T++++GSD E E+TRI  GGYFGELALLTKHPRAASVY V +TKLA+LDVGSFERLLGPCLDI+QR+I NYE QLK +FGSL  +PE
Sbjct:    1 MSKKTVDVPAGLREILQDFTVAVLRNRPSNIINFAAEYFEMKKNQQKENEDVESD-------EEVMAPPIRARRRQGVAAESYDPEKED--KFEKVVHEKTEEQRQRLTNATKGILLFRCLDEDQMRDVIDAMFERKVEVGEKVITLGEDGDNFYVIEKGVYDIIVKVDGVEKKVGQYDNNGSFGELALMYNTPRAATIQATTPGILWAMTREVFRSIVLKSAFKKRQMYEELLNQVPILQSLSAYERMSIADALHTQIYEEGTKIISQGQEGDEMYFVEDGEVRITMKKSGSDEETELTRIKKGGYFGELALLTKHPRAASVYAVTRTKLAVLDVGSFERLLGPCLDILQRNIDNYENQLKSVFGSLDNVPE 364          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A0R3WJX8 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1001 PE=4 SV=1)

HSP 1 Score: 474.552 bits (1220), Expect = 1.449e-160
Identity = 239/373 (64.08%), Postives = 291/373 (78.02%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            M K+ V +P G +E+LQDFTV VLR+ P +II F  +YF+ KK++Q ++   +S+ E      E+   P    RR+GVAAES+DPEKED    E++V+ KT EQR RL  A + ILLFRCLDE+QM DVIDAMFER+V  GEKVI  GEDGDNFYVIE G YDIIVK++GV+ KVG+YD +GSFGELALMYNTPRAATIQ    G++WAMTRE FRSIVLK AF+KR  YE LL  VP+L+ LS YERM+IADAL T+IYE  T II QG+ G EMYF+E+G VR+T++++GSD E E+TRI  GGYFGELALLTKHPRAASVY + +TKLA+LDVGSFERLLGPCLDI++R+I NYE QLK +FGSL  +PE
Sbjct:    1 MSKKTVDVPEGLREILQDFTVAVLRNRPSNIINFAAEYFEMKKNQQKENEGAESDEE------EVIAPPIRARRRQGVAAESYDPEKED--KFEKVVHEKTEEQRQRLTNATKGILLFRCLDEDQMRDVIDAMFERKVDVGEKVITLGEDGDNFYVIEKGIYDIIVKVDGVEKKVGQYDNNGSFGELALMYNTPRAATIQATTPGILWAMTREVFRSIVLKSAFKKRQMYEELLNQVPILQSLSAYERMSIADALHTQIYEEGTKIISQGQEGDEMYFVEDGEVRITMKKSGSDEETELTRIKKGGYFGELALLTKHPRAASVYAITRTKLAVLDVGSFERLLGPCLDILRRNIDNYENQLKSVFGSLDNVPE 365          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A3S5CG55 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS11856 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 5.210e-159
Identity = 245/373 (65.68%), Postives = 297/373 (79.62%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            M K  +V+P G +ELLQDFTV VLRD+P D+++F I YF  KKS Q   A + S+ E   + E +P  PR   RR GVAAES+DPEKE+  + E++V+PKT EQR+RL  A ++ILLFRCLD++QM DVIDAMFERRV  GEKVI  GEDGDNFYVIE G +DIIVK+NGV+TKVG+Y+  GSFGELALMYNTPRAATI     GV+WAMTRETFRSIVLKKAF+KR  YE LL+ VP+L+ LS YERM+IADAL TRIY+    II QGEPG EMYF+EEG VR+T+++ G   E E+TR+  GGYFGELALLTK PRAASVY V +TKLA+LDV SFERLLGPC++I++R+ISNYEE+LK IFGS++K+PE
Sbjct:    1 MAKGGIVVPAGLRELLQDFTVAVLRDHPPDLVEFAIQYFTMKKS-QANKAPVGSDEE---EEEPMPAPPRRGARRAGVAAESYDPEKEE--SVEKVVFPKTEEQRSRLQHATRDILLFRCLDDDQMKDVIDAMFERRVEVGEKVISLGEDGDNFYVIEKGLFDIIVKVNGVETKVGQYEDKGSFGELALMYNTPRAATILAQTSGVLWAMTRETFRSIVLKKAFEKRRMYEELLDKVPMLESLSNYERMSIADALRTRIYDEGVRIIIQGEPGAEMYFVEEGQVRITMKKEGDANETELTRLEKGGYFGELALLTKQPRAASVYAVTRTKLAVLDVDSFERLLGPCVEILKRNISNYEEELKKIFGSMEKIPE 367          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: A0A068Y6M8 (cAMP dependent protein kinase regulatory OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000775600 PE=4 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.887e-157
Identity = 241/373 (64.61%), Postives = 290/373 (77.75%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            M K+ V +P G +E+LQDFTV VLR+ P +II F  +YF+ KK++Q        E+E+ +  EE+   P    RR+GVAAES+DPEKED    E++VY KT EQR RL  A + ILLFRCLDE+QM DVIDAMFER+V  GEKVI  GEDGDNFYVIE G YDIIVK++GV+ KVG+YD +GSFGELALMYNTPRAATIQ    G++WAMTRE FRSIVLK AF+KR  YE LL  VP+L+ LS YERM+IADAL T+IYE  T II QG+ G EMYF+E+G VR+T++++GSD E E+TRI  GGYFGELALLTKHPRAAS Y V +TKLA+LDVGSFERLLGPCLDI++R+I NYE QLK +FGSL  +PE
Sbjct:    1 MSKKTVDVPAGLREILQDFTVAVLRNRPSNIINFAAEYFEMKKNQQ-------KENEDAESEEEIMAPPIRARRRQGVAAESYDPEKED--KFEKVVYEKTDEQRQRLANATKGILLFRCLDEDQMRDVIDAMFERKVDVGEKVITLGEDGDNFYVIEKGVYDIIVKVDGVEKKVGQYDNNGSFGELALMYNTPRAATIQATTPGILWAMTREVFRSIVLKSAFKKRQMYEELLNQVPILQSLSAYERMSIADALHTQIYEGGTKIISQGQEGDEMYFVEDGEVRITMKKSGSDEETELTRIKKGGYFGELALLTKHPRAASAYAVTRTKLALLDVGSFERLLGPCLDILRRNIDNYENQLKSVFGSLDNVPE 364          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Match: U6IUI1 (cAMP dependent protein kinase regulatory OS=Echinococcus granulosus OX=6210 GN=EGR_00342 PE=4 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.887e-157
Identity = 241/373 (64.61%), Postives = 290/373 (77.75%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            M K+ V +P G +E+LQDFTV VLR+ P +II F  +YF+ KK++Q        E+E+ +  EE+   P    RR+GVAAES+DPEKED    E++VY KT EQR RL  A + ILLFRCLDE+QM DVIDAMFER+V  GEKVI  GEDGDNFYVIE G YDIIVK++GV+ KVG+YD +GSFGELALMYNTPRAATIQ    G++WAMTRE FRSIVLK AF+KR  YE LL  VP+L+ LS YERM+IADAL T+IYE  T II QG+ G EMYF+E+G VR+T++++GSD E E+TRI  GGYFGELALLTKHPRAAS Y V +TKLA+LDVGSFERLLGPCLDI++R+I NYE QLK +FGSL  +PE
Sbjct:    1 MSKKTVDVPAGLREILQDFTVAVLRNRPSNIINFAAEYFEMKKNQQ-------KENEDAESEEEIMAPPIRARRRQGVAAESYDPEKED--KFEKVVYEKTDEQRQRLANATKGILLFRCLDEDQMRDVIDAMFERKVDVGEKVITLGEDGDNFYVIEKGVYDIIVKVDGVEKKVGQYDNNGSFGELALMYNTPRAATIQATTPGILWAMTREVFRSIVLKSAFKKRQMYEELLNQVPILQSLSAYERMSIADALHTQIYEGGTKIISQGQEGDEMYFVEDGEVRITMKKSGSDEETELTRIKKGGYFGELALLTKHPRAASAYAVTRTKLALLDVGSFERLLGPCLDILRRNIDNYENQLKSVFGSLDNVPE 364          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:103029925])

HSP 1 Score: 331.643 bits (849), Expect = 1.109e-107
Identity = 177/396 (44.70%), Postives = 242/396 (61.11%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEND-------DQMEE------------------LXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAE-----VTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + +     +E  +        + +EE                  + P+     RR  V AE+F+P+++D+  + R+ +PKT EQR RL  A ++ILLF+ LD+EQM  V+DAMF++ V  GE +I Q +DGDNFYVIE GT+DI+VK +G    VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +E +PLL  L   ERM + D L +++Y     II QG+     Y +E G VR+T++     T++E     +     G YFGELAL+T  PRAAS Y VE  K  ++DV +FERLLGPC+DIM+R+I+NYEEQL  +FGS  ++ E
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPRDLLEFALQYFTQLKENESRGGAFGNEQNSAVRAGKAVNFIEEAMQIDSENEEDEDDDEEFVAPVINRFIRRASVCAEAFNPDEDDEDKEPRVTHPKTDEQRHRLQEACKDILLFKNLDQEQMSQVLDAMFDKAVTSGEHIIDQDDDGDNFYVIERGTFDILVKSDGTSRTVGSYDNRGSFGELALMYNTPRAATIVATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSSKVYSKGEQIIAQGDLADSFYIVESGEVRITMKRNRLKTDSEEEEVDIATCTRGQYFGELALVTNKPRAASAYAVENVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLVTLFGSQTEIEE 400          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 300.056 bits (767), Expect = 6.723e-96
Identity = 164/368 (44.57%), Postives = 221/368 (60.05%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAH----------LDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-----EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQ 1149
            IP G  ELLQ +TV VLR  P D+++F + YF   +  + Q              D E    +                 + AE  +P+ +D+ ++ R+V+PKT EQR RL  A ++ILLF+ LD+EQ  +V+DAMFE  V   E VI QG+DGDNFYVIE G YDI+V+ +GV   VG+YD  GSFGELALMYNTPRAATI    +G +W + R TFR +++K   +KR  YE  +E+VPLLK L   ERM I D L  +I+     II QG+     Y +E G V++ ++     +   + E E+TR   G YFGELAL+T  PRA S Y V   K  ++DV +FERLLGPC +IM+R+I++YEEQ
Sbjct:    5 IPVGLTELLQGYTVEVLRQRPPDLVEFAVQYFTRLRDTRSQDGSGAAAKGKGVMFDGEPMQTES--NGDEDDEDDDSDFELCAEPLNPDDDDEDSEPRVVHPKTDEQRCRLQEACKDILLFKALDQEQFSEVLDAMFEVIVQPQEHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYDNKGSFGELALMYNTPRAATIIAKQEGALWGLDRATFRRLIVKNNAKKRRMYECFIESVPLLKSLEISERMKIVDVLGVKIFHDGERIIMQGDMADCFYIVESGEVKIMMKSKTKADRQDNAEVEITRCTRGQYFGELALVTNKPRAGSAYAVGDIKCLVIDVQAFERLLGPCKEIMKRNIAHYEEQ 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 283.493 bits (724), Expect = 1.582e-89
Identity = 162/377 (42.97%), Postives = 224/377 (59.42%), Query Frame = 1
Query:   85 VVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXX--------------XXXVAAESFDPEKEDDPNQE-RIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            V IP G  +LL+ +TV VL+  P D++ F + YF   K ++      D ++   +  EE     + +                   + AE+++P+ +DD + E ++++PKT +QR+RL  A ++ILLF+ L  E+  +V+DAMFE  V   E +I QG+DGDNFYVIE G YDI+V  +GV   VGKYD  GSFGELALMYNTPRAATI     G +WA+ R TF  ++++   +KR  YEA +E VPLLK L   ERM I D L  + ++    IIKQ + G                    + E EV R   G YFGELAL+T  PRAASVY V +TK  ++DV +FERLLGPC +IM+R+I++Y+EQL  +FGS
Sbjct:    3 VEIPAGLTDLLKGYTVEVLKQRPSDLLDFAVQYFTRLKEQRSADVAFDKDTTPTESSEEDEEEEKEEEDEEEKEEDDDFPDDFTFKLCAEAYNPDDDDDDDSEPKVIHPKTDQQRSRLQEACKDILLFKTL--EKFSEVLDAMFEVLVKPQEHIIDQGDDGDNFYVIERGVYDIVVGKDGVSRCVGKYDNKGSFGELALMYNTPRAATIIATQSGALWALDRATFHRLIVRNNAKKRRMYEAFIECVPLLKSLELSERMKIVDVLGAKSFKNGELIIKQTKAGQR-----------------DNAEVEVARCSRGQYFGELALVTNKPRAASVYAVGETKCLVIDVQAFERLLGPCKEIMKRNIASYKEQLVALFGS 360          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 222.246 bits (565), Expect = 5.161e-66
Identity = 134/352 (38.07%), Postives = 200/352 (56.82%), Query Frame = 1
Query:  103 FKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQL------QSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
             ++LL+D  V +    PE  + F  +YF+  + E+       Q     S+S  D+    + P+ + + RR  ++AE +   +ED  +  R V PK  +  A L  A++  +LF  LD+ +  D+ DAMF    + GE VI QG++GDNFYVI+ G  D+ V  N   T +G+    GSFGELAL+Y TPRAAT++   +  +W + R+++R I++    +KR  YE  L  V +L+ L  +ER+ +ADAL    +E +  I+ QGEPG E + + EGC  V  R + ++   EV R+GP  YFGE+ALL   PRAA+V      K   LD   FER+LGPC DI++R+I  Y
Sbjct:   26 IQQLLKDCIVQLCTSRPERPMVFLREYFERLEKEEAKQLLSQQKTSSRSDSREDEVSPPMNPVVKGRRRRGAISAEVYT--EEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVN-NEWATSIGE---GGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVVQGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQY 371          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Match: prkar1aa (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103047413])

HSP 1 Score: 213.386 bits (542), Expect = 8.685e-63
Identity = 134/351 (38.18%), Postives = 200/351 (56.98%), Query Frame = 1
Query:  106 KELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQL------QSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
            ++LL+D  V +    PE  + F  DYF+  + E+       Q +   S+S  D+    + P+ + + RR  ++AE +   +ED  +  R V PK  +  A L  A++  +LF  LD+ +  D+ DAMF    + GE VI QG++GDNFYVI+ G  D+ V  N   T +G+    GSFGELAL+Y TPRAAT++   +  +W + R+++R I++    +KR  YE  L  V +L+ L  +ER+ +ADAL T  +E    I+ QG+PG E + + EG   V  R + ++   EV R+GP  YFGE+ALL   PRAA+V      K   LD   FER+LGPC DI++R+I  Y
Sbjct:   27 QQLLKDCIVQLCTSRPERPMAFLRDYFERLEKEEAKQMVGQQKSSSRSDSREDEISPPMNPVVKGRRRRGAISAEVYT--EEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVNYIAGETVIQQGDEGDNFYVIDQGEMDVYVN-NAWVTSIGE---GGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALETVQFEDGQKIVVQGQPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARSPLKCVKLDRPRFERVLGPCSDILKRNIQQY 371          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 223.787 bits (569), Expect = 3.011e-69
Identity = 113/221 (51.13%), Postives = 142/221 (64.25%), Query Frame = 1
Query:  547 GTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-------EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            G +DI VKI+G   KVG YD  GSFGELALMYNTPRAATI    +G +WAM R TFR I+LK A QKR  YEA +E+VPLLK L   ERM + D + T+ YE    II QG      + +E G VR+ ++       E   + E E+ R   G YFGEL+L+T  PRAAS Y V   K A++ V  FERLLGPC+DIM+R+I++YEEQL  +FG+   + E
Sbjct:    2 GVFDIFVKIDGAPKKVGCYDNRGSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCTRGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPFERLLGPCMDIMKRNITHYEEQLVALFGTSMDISE 222          

HSP 2 Score: 55.8398 bits (133), Expect = 5.336e-9
Identity = 31/125 (24.80%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  334 DDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGV---------DTKVGKYDGSGSFGELALMYNTPRAATIQTVND 681
            D     RI+     ++R      ++++ L + LD  + + V+D +  +    GE++I QG   D F+++E+G   I++K             + ++ +      FGEL+L+ N PRAA+   V +
Sbjct:   53 DRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCTRGQYFGELSLVTNKPRAASAYAVGN 177          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 226.868 bits (577), Expect = 4.165e-69
Identity = 131/321 (40.81%), Postives = 177/321 (55.14%), Query Frame = 1
Query:   85 VVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKK----------SEQLQSAHLDSESENDDQMEELXXXX---------------------------XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR 936
            V +P G  ELLQ FTV VLR  P D++ F   YF   +          ++QL     D+     +  EE                                    RR  V AE+++P++E++  + R+++PKT EQR RL  A ++IL+F+ LD+EQM  V+DAMFE+ V  GE VI QG DGDNFYVIE G YDI V  N V   VG Y+  GSFGELALMYNT RAATI   ++G +W + R TFR I++K A +KR  YE  +E VPLLK L   ER+ + D + ++ ++ +  II QGE     Y +E G VR+ +R
Sbjct:    3 VEVPAGLTELLQAFTVEVLRSRPADLLDFAAAYFAEMRQRARERCGAPAQQLADGFDDAHGRGVNFSEENVAGHSSNSDNNGDDDRDDDDDDESDFEAPVISRFTRRASVCAEAYNPDEEEEDTETRVIHPKTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESGEVRIAMR 323          

HSP 2 Score: 48.1358 bits (113), Expect = 3.165e-6
Identity = 32/126 (25.40%), Postives = 57/126 (45.24%), Query Frame = 1
Query:  721 IVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLL 1098
            ++  K  ++R + +   +++ + K L   +   + DA+  +  E    +I QG  G   Y +E G   + V    +D    V      G FGELAL+    RAA++    +  L  LD  +F R++
Sbjct:  130 VIHPKTDEQRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYV--TTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRII 253          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 2.110e-15
Identity = 65/246 (26.42%), Postives = 107/246 (43.50%), Query Frame = 1
Query:  400 AVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISN 1137
            AV++  L + +   Q V + D M E    +GE +I +G+      V   G  D+  +   + T          FGELA++Y+  R AT++ + D  +  ++R  FRS++++++  +R      L+    LK L   +   + D +    +     I+ +GE G   Y +  G VRV+    GS     V  + PG +FGELAL+    R A+   V                   CL +  RSI N
Sbjct:    6 AVRSNELLKRMQPGQTVLLGDCMSETTRARGETIIAEGDSSRRLKVDVEGLLDVSKQGESLCT----LQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFDCMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQEVEGSPRLIRV--LEPGDHFGELALIRNMRRTATCTAVGAV---------------TCLTLHTRSILN 230          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.461e-12
Identity = 36/122 (29.51%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  367 KTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLK 732
            K P  +  +  A+      R L++ ++  +++ M+ER     + VI +GE G++ YV+ + + D   +     T +G       FGELA++YN  R AT++ V    VW + R TF++IV++
Sbjct:  163 KNPCSQRLIKAALAKNEFLRRLEDGRVARMVECMYERAYSPEQAVIREGEAGNHLYVLAAASLDCQQR----GTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQAIVIR 280          

HSP 2 Score: 51.2174 bits (121), Expect = 3.346e-7
Identity = 46/163 (28.22%), Postives = 67/163 (41.10%), Query Frame = 1
Query:  610 SGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIG---PGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFE 1089
            +G   E A   + PR    Q V     WA         V K    +RL   AL +N   L+ L       + + +  R Y P   +I++GE G  +Y L           A  D +   T +G   PG  FGELA+L    R A+V  V   ++ +LD  +F+
Sbjct:  135 AGVSAEPASSSSLPR----QQVGGTACWAR--------VHKNPCSQRLIKAALAKN-EFLRRLEDGRVARMVECMYERAYSPEQAVIREGEAGNHLYVLAA---------ASLDCQQRGTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQ 275          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.645e-12
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:  613 GSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLL 789
            GSFGELAL+Y TPRAAT++   D  +W + R+++R I++    +KR  YE  L  V +L
Sbjct:   37 GSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 214.157 bits (544), Expect = 1.835e-63
Identity = 114/276 (41.30%), Postives = 169/276 (61.23%), Query Frame = 1
Query:  301 VAAESFDPEKEDD--PNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQ 1122
            V+ E+  P   DD  P+  +    K+ +Q  RL  +++N  LF  LD +    VI+ + E+ V +G  +I QG+ GD FYV+E GT D  V     D KV       SFGELALMYN+PRAAT+   +D ++WA+ R TFR I+L  +F+KRL Y+ LL+++P+LK L+ Y+R  +ADAL T+IY+P  TII++G+ G   Y +E G V V+ +  G      + ++    YFGE+ALL   PR A+V   ++TK+A L    F+RLLGP +D+++
Sbjct:  146 VSGETLQPNNFDDWTPDHYK---EKSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVN----DNKVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGV-----INKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVDVLK 409          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO38262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH8])

HSP 1 Score: 359.762 bits (922), Expect = 3.802e-119
Identity = 191/376 (50.80%), Postives = 260/376 (69.15%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF-----KTKKSEQLQS------------AHLDSESENDDQMEELXXX-XXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGI 1161
            IP G  +LLQDFTV VLR+ PEDI+ F  +YF     K K+S++ +              + + ++ N+D+ +E+P        RR+ V AE F P+ ED+ +++ IVYPKT EQR RLN A++NILLF+ L +EQ+ +V+DAMFER+   G+ +I QG+DGDNFYVI+ G YDI V+I+G +  VG YD  GSFGELALMYNTPRAATI + ++GV+W + R TFR I+LK A +KR  +EALLE VPLL+E++ YERMN+ADAL++R ++    IIKQG+    MYF+E G V + +  ++   TE E+ +   GGYFGELAL+T + RAASVY V     A LDV +FERLLGPC+DIM+R+I  YEEQL+ +
Sbjct:    5 IPSGLSDLLQDFTVHVLREKPEDIVDFAANYFMKLKLKEKRSQKGKKKNKEKGVSFGPPGNDEDDTYNEDEDDEMPEPPKNRYARRQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKEQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVIDRGQYDIYVRIDGQEKMVGSYDNKGSFGELALMYNTPRAATIVSTSEGVIWGLDRMTFRRILLKAAAKKRKVHEALLETVPLLQEITEYERMNLADALVSRQFKDGECIIKQGDEADFMYFVESGTVSIRMHNKSDPTTEVEIAQCTKGGYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLLGPCMDIMKRNIDGYEEQLQKL 380          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO49534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ3])

HSP 1 Score: 267.314 bits (682), Expect = 1.945e-83
Identity = 144/379 (37.99%), Postives = 225/379 (59.37%), Query Frame = 1
Query:  103 FKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQ--LQSAHLDSESENDD--------------QMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEV-TRIGPGGYFGELALLTKHPRAASVYCV-EKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMP 1185
              +LLQ F + V  + P+D++ F   YF    + +  + S+   S  E DD              +        R   RR  VA E ++P   +  + +R  YPK+ + R RL   + NI +F+   ++Q+  ++DAM+ER V Q E +I QG+ GDNFY+I+ G ++++ + NG   K+G+  G GSFGELALMYN PR+ATI+    GV+W + R++FR I++    +KR  YE LLE +P+L +L+ YER ++ADAL T +Y     II+Q +P   +YF+E G V +++R++   ++ +V +  GPG YFGELAL+ K  R ASV+    +   A+L+V +FERLLGPC  +MQR++  YEE+ K +   +++MP
Sbjct:   10 LHKLLQSFILDVFTEQPDDLVDFAASYFSKLNTSRKPIHSSSTPSTQEEDDFYCSESLSLPSDRFKRPSYQQNHRLYLRRDSVAGEVYEPVNSNCVSAQRF-YPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETNGAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSFRRILVDTTERKRRHYETLLERIPVLSQLTAYERTSLADALTTSVYRDEECIIRQDDPADCLYFIESGIVEISIRDSKDRSKVKVISTAGPGEYFGELALVNKTKRGASVHAKGGQVTCAVLEVNAFERLLGPCKGLMQRNMKTYEEERKCL--GIREMP 385          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO41163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S513])

HSP 1 Score: 244.202 bits (622), Expect = 6.928e-75
Identity = 147/367 (40.05%), Postives = 216/367 (58.86%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF------KTKKSEQLQSAHLDSESENDDQMEELXX-XXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIV--KINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQG-EPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGI 1161
            IPPG   LL++F V  +++NPEDI++F  DYF      K KK+   Q+A    ESE+ D +      + + + RR  V+AE ++P +  D   +   +PK+ EQR  L   +  + LF     E +  ++D+MFE++V   E +I  G++GDNFYVI +G YD+       G   KV  ++G+G FGELALM+N+ R ATI    +G +WA+ R TF  +V+  A ++R +   LL++V +LKEL P E   ++DAL  + ++    +I++G E    MYF+E+G VRVTV+    D E E T      YFGELAL+   PR+ASVY V + K A L    FERL+GPC +IM+R+   YEEQ K +
Sbjct:    9 IPPGLSSLLEEFVVKCIQENPEDIVEFAADYFNMLKRFKEKKAASKQAAQSKKESEDKDDLAPAEQPIIKGRSRRAAVSAEPYNPNENADFKAK--FHPKSEEQRNHLKKKLLELWLFEKFHREDLDVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVTVK----DGEVEKTVEFDKNYFGELALVMNQPRSASVYAVGECKFASLKKDDFERLMGPCKEIMKRNAKEYEEQKKKL 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 215.698 bits (548), Expect = 4.802e-64
Identity = 130/343 (37.90%), Postives = 203/343 (59.18%), Query Frame = 1
Query:  112 LLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
            +L+D  V +    PE+  +F  +YF+ K  ++ ++A L++E E   ++EE PP  +P  R+R  A  +    +++  +  + V PK  +  A L+ A+   +LF  LDE +  D+ DAM   +   GE +I QG++GDNFY+++SG  D+ V   G+ + +G+    GSFGELAL+Y TPRAATI+   D  +WA+ R T+R I++    +KR  YE  LE V +L+ L  +ER+ +ADAL    ++    ++ QGE G E + + EG   V  R + ++   EV+R+GP  YFGE+AL+   PRAA+V      K   LD   FER+LGPC+DI++R+I  Y
Sbjct:   29 VLKDCIVQLCISKPENPYKFFREYFE-KLEKKEETARLEAEPEQRAEVEEHPPPSKPFQRQRRGAVSAAPITEDEATSYVKKVVPKDYKTMAALSKAITKNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVNNVGLVSTIGE---GGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVEGTAVVLQRRSANEDFIEVSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRFERVLGPCIDILKRNIQQY 367          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 119.013 bits (297), Expect = 4.580e-28
Identity = 80/290 (27.59%), Postives = 144/290 (49.66%), Query Frame = 1
Query:  301 VAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVE---KTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGI 1161
            ++AE    ++  D ++    +PK    +  +  A+ +    + L+  Q+ +V++ M ER   + E +I + E G + YV+E G      ++    T +G      +FGELA++YN  R A+++    G +WA+ R+TF++I++K    +  ++   L +V LLK+L+    + IAD +    YE    II+QG  G   + ++ G V +T R         V  +  G YFGE AL  +  R A+  C+         +LD  +F + +G  LD +QR    Y++  +G+
Sbjct:   49 ISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGK----CQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKALKGEDLRTAN--CIAGKGGVTCLVLDREAFVQFIGN-LDDIQR--DQYDDSQRGV 329          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 328.946 bits (842), Expect = 1.678e-106
Identity = 175/396 (44.19%), Postives = 243/396 (61.36%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN-----------DDQME-------------------ELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREA------GSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + + A   ++  +           D+ M+                    + P+     RR  V AE+F+P+++++  + R+ YPKT EQR RL  A ++ILLF+ LD E++  V+DAMFE+   +GE +I Q +DGDNFYVIESGT++I VK++G++  VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +E +PLL  L   ERM + D L TR+Y  +  II QG+     Y +E G VR+T++ +        + E E+     G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+I+NYEEQL+ +FGS
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPRDLLEFALQYFTQLKDNETKEAAFGNDQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNPDEDEEDKEPRVTYPKTDEQRQRLQEACRDILLFKNLDPEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSLFGS 400          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 303.523 bits (776), Expect = 5.579e-97
Identity = 174/385 (45.19%), Postives = 229/385 (59.48%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF----------------KTKKSEQLQSAHLDSESENDDQMEELXXXX----XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVR-----EAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ +TV VLR  P D+++F + YF                K  K        + +ES  DD+ ++             RR  V AE+F+P+ +D+  + R+V+PKT EQR RL  A ++ILLF+ LD+EQ   V+DAMFE +V   E VI QG DGDNFYVIE G YDI+V        VG+Y+  GSFGELALMYNTPRAATI    +G +W + R TFR +++K   +KR  YE  +E+VPLLK L P ERM I D L  + +     II QGE     Y +E G V++ ++     +   + E E+TR   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLG C +IM+R+IS+YEEQL  +FGS
Sbjct:    5 IPVGLTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDTEPRVVHPKTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVS----GKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFGS 385          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 289.271 bits (739), Expect = 1.113e-91
Identity = 168/380 (44.21%), Postives = 220/380 (57.89%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF----------------KTKKSEQLQSAHLDSESENDDQMEELXXXX----XXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ +TV VLR  P D+++F + YF                K  K        + +ES  DD+ ++             RR  V AE+F+P+ +D+  + R+V+PKT EQR RL  A ++ILLF+ LD+EQ   V+DAMFE +V   E VI QG DGDNFYVIE G YDI+V        VG+Y+  GSFGELALMYNTPRAATI    +G +W + R TFR +++K   +KR  YE  +E+VPLLK L P ERM I D L                 G++ +   E  +  T  +   + E E+TR   G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLG C +IM+R+IS+YEEQL  +FGS
Sbjct:    5 IPVGLTELLQGYTVEVLRQRPSDLVEFAVQYFTRLRDSRGQDGAGTGAKQGKGVMFDGEPMQTESNGDDEEDDDSDFEPPPPSRFNRRVSVCAEAFNPDDDDEDTEPRVVHPKTDEQRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVS----GKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVL-----------------GMKQFLDGERIIAQTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAFERLLGSCKEIMKRNISHYEEQLVALFGS 363          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 287.345 bits (734), Expect = 1.412e-90
Identity = 162/398 (40.70%), Postives = 234/398 (58.79%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESEN-----------DDQME-------------------ELXXXXXXXXXXXXVAAESFDPEKEDDPNQER--IVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREA------GSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            IP G  ELLQ FTV VLR+ P D+++F + YF   K  + + A   ++  +           D+ M+                    + P+     RR  V AE+F+P+++++  + R    +  +P+ +      + +IL    + +E++  V+DAMFE+   +GE +I Q +DGDNFYVIESGT++I VK++G++  VG YD  GSFGELALMYNTPRAATI   + G +W + R TFR I++K   +KR  YEA +E +PLL  L   ERM + D L TR+Y  +  II QG+     Y +E G VR+T++ +        + E E+     G YFGELAL+T  PRAAS Y V   K  ++DV +FERLLGPC+DIM+R+I+NYEEQL+ +FGS
Sbjct:    5 IPEGLTELLQSFTVEVLRNQPRDLLEFALQYFTQLKDNETKEAAFGNDQNSAPRSGKAVNFIDEAMQIDSENGEEEEDDDDDDDEEFIAPVINRFIRRASVCAEAFNPDEDEEDKEPRRGFKFVSSPQPK------MFDILF---IFQEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAFERLLGPCMDIMKRNIANYEEQLQSLFGS 393          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Match: prkar1ab (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:101156203])

HSP 1 Score: 218.009 bits (554), Expect = 2.008e-64
Identity = 133/352 (37.78%), Postives = 202/352 (57.39%), Query Frame = 1
Query:  106 KELLQDFTVCVLRDNPEDIIQFGIDYFK---TKKSEQLQSAHLDSESENDDQMEE----LXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
            ++LL+D  V +    P+  + F  +YF+    ++++Q+Q+      S +D + EE    + P+ + + RR   +AE +   +ED  +  R V PK  +  A L  A++  +LF  LD+ +  D+ DAMF    + GE VI+QG++GDNFYVI+ G  D+ V    V T +G+    GSFGELAL+Y TPRAAT++   +  +W + R+++R I++    +KR  YE  L  V +L+ L  +ER+ +ADAL    +E    I+ QGEPG E + + EG   V  R +  +   EV R+GP  YFGE+ALL   PRAA+V      K   LD   FER+LGPC DI++R+I  Y
Sbjct:   27 QQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEEAKQIQNQQKAGSSRSDSRDEEVSPPMNPVVKGRRRRGAFSAEVYT--EEDAASYVRKVIPKDYKTMAALAKAIEKNVLFAHLDDNERSDIFDAMFPVTYIAGETVILQGDEGDNFYVIDQGEMDVYVNNEWV-TSIGE---GGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLRKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSEHEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQY 372          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000019065.1 (SMESG000019065.1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 372/373 (99.73%), Postives = 372/373 (99.73%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLQKMPE 1188
            MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELPPMPRPQGRRRGVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSL KMPE
Sbjct:    1 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELPPMPRPQGRRRGVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGSLHKMPE 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000017499.1 (SMESG000017499.1)

HSP 1 Score: 362.844 bits (930), Expect = 2.425e-120
Identity = 191/372 (51.34%), Postives = 260/372 (69.89%), Query Frame = 1
Query:   70 MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFK--TKKSEQLQSA--HLDSE-SENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            M   ++ +P G  ELLQ+F + VLR  P +++ +  +YFK  + K E++ ++  H  SE S+NDD +++       +GRR+ VAAESFDPEKEDD +   ++Y KT  QR+RL  A++ I LFR LD+EQ   VID+M E  V   +KVI+QG+ GD+FYVIE G +DI V  NG  +K+G Y  +GSFGELALMYNTPRAATI +V +G++WAM R+TFR IVLK AF+KR  YE LL++V LL ELS Y+R N+ADAL++R YE +  I++QG+PG+EM+F+E G VRV           EV R+  G YFGE+ALL K PR ASVY V KT +A+LD+ SFERLLGPC+++M++++  Y  QL+ I GS
Sbjct:    1 MSSNKIEVPEGLTELLQNFAISVLRHKPHNLVHYAFEYFKDLSSKHEEINNSGNHTHSEDSDNDDNIKK----QVQRGRRQSVAAESFDPEKEDDEDLP-VIYSKTDAQRSRLVEAIKPIFLFRSLDDEQRGKVIDSMREVVVESDQKVIVQGDGGDDFYVIEKGMFDIFV--NG--SKIGNYSDTGSFGELALMYNTPRAATIISVTNGILWAMDRKTFRHIVLKNAFKKRQMYEGLLQSVDLLDELSSYDRTNVADALVSRTYEDSEMILEQGKPGMEMFFIENGEVRVIRDTNDGSPPKEVNRLHKGDYFGEVALLIKEPRLASVYAVGKTTVAVLDIKSFERLLGPCINLMKKNLPKYRNQLREILGS 363          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000025330.1 (SMESG000025330.1)

HSP 1 Score: 322.013 bits (824), Expect = 8.855e-101
Identity = 155/260 (59.62%), Postives = 193/260 (74.23%), Query Frame = 1
Query:  361 YPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNY 1140
            Y KT EQR RL    ++ILLFRCLD EQ+  VI+AMF++ V  G+ VI +GE+GDNFYVI++G YDII+ +NG D  V +YD  GSFGELALMYNTPR+ATI    +G++WAM+R+ FR IVLKKAFQKRL Y+ LL  VP LKELS +ER NIADAL TRIYEP  TIIKQGE GLEMYF+EEG   + ++     T  EV ++  G YFGE+AL+ K PRAA++    K K+A LD  SFERLLGPC++IM+R++  Y
Sbjct:  399 YTKTDEQRNRLREVCKHILLFRCLDTEQLEVVINAMFKKIVAPGDVVITRGENGDNFYVIDNGLYDIIIPVNGEDKVVAQYDNKGSFGELALMYNTPRSATITAKTNGLLWAMSRDMFRKIVLKKAFQKRLLYDNLLAQVPFLKELSSFERNNIADALRTRIYEPGDTIIKQGEEGLEMYFIEEGTAAILIKFTNDSTPEEVGKLEKGSYFGEMALINKKPRAATIIAKTKCKIAALDTESFERLLGPCVEIMKRNMLGY 658          

HSP 2 Score: 117.857 bits (294), Expect = 2.579e-27
Identity = 90/360 (25.00%), Postives = 167/360 (46.39%), Query Frame = 1
Query:   79 REVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARL----NMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKV-IIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGP-CLDIMQRSISNY 1140
            +++V+P GF+ELLQD TV VLR  P DI+ F I +  T+K           +S N ++M+                 E+   E  + P +++    K   +        +  +++  LF  +++  + ++I+    + V  GE   I + E  D  +++++G +++  ++     K+ +    G FG+      T  +        G    + R      + ++  +KR +Y   L ++ + ++LS YE+  + D+L+ + Y  +  II +     EMY + EG   V+V++ G     EV  +  GGYFGE+ LL   PR AS+  +  TKL ++    F+ ++ P C D M  +I  Y
Sbjct:   20 KQIVVPDGFRELLQDLTVEVLRTQPTDILDFCIQWLMTRK-----------KSANRNEMD-----------------ENLSTEMSEAPGKKKFGISKMGSKDCPTTKPPHEVIEDCRLFTGIEKGLVQNLINNFNIKSVEAGETFKISEEEQSDKIFIVQAGNFELFSQLPFGKVKIAELKDYGYFGD------TVESIICTAKTAGKFVVINRSDVDQQIWEEINKKREEYSDYLNDLEIFEKLSSYEKRILVDSLIFKAYPADKEIITENTEANEMYLIYEGF--VSVKKDGK----EVATVNEGGYFGEVGLLDDQPRIASIVSITDTKLLVIKKDIFKSIIEPKCSDYMDAAIKKY 339          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000059969.1 (SMESG000059969.1)

HSP 1 Score: 291.582 bits (745), Expect = 8.768e-93
Identity = 153/366 (41.80%), Postives = 230/366 (62.84%), Query Frame = 1
Query:   85 VVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYF-----KTKKSEQLQSAHLDSESENDD--------QMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYE 1143
            VV P G  ++L+DF V V+R  P+DI +F  D+F     K +         +D E E  +        +++++        RRR +AAE +DPE   D  ++ I+YPK+PEQ+ RL   +++ +LF   D +Q+  ++D MF R V  G+K+I +G+ GDNFYVI++G +D+      +   V  Y+ +G FGELALM+N  R+AT+     G +W +    F+ +V+K  F+KR  YE+++++VP+L +L   ERM+++DAL+T+ +E N  IIK+G+    MYF+E G VRVT+++   D EAEV+RI  G YFGE+AL+ K PR+ASVY V   KLA L V SFERLLGPC D+M+R++S YE
Sbjct:    4 VVFPDGLGDMLRDFVVAVIRQKPQDIYEFAADFFVYIRDKHRMKNVPMYVFVDDEEEACEPDPAFFHPKIQKI-DGSLRAQRRRSIAAEKYDPES--DVEEQLIIYPKSPEQKERLIQGLKHTILFHDFDSDQLQVIVDCMFSRTVEAGQKIINEGDVGDNFYVIDNGIFDVQTNKANIQKLVHTYNNNGCFGELALMHNQSRSATVTARTSGCLWVLEGRHFKELVMKITFKKRKMYESIIKSVPILNDLDENERMDLSDALVTQKFEDNECIIKEGDEAEGMYFIESGLVRVTIKKG--DYEAEVSRISAGKYFGEMALVEKKPRSASVYAVGLVKLAFLKVDSFERLLGPCFDVMKRAMSKYE 364          
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Match: SMESG000057377.1 (SMESG000057377.1)

HSP 1 Score: 291.582 bits (745), Expect = 9.023e-93
Identity = 153/371 (41.24%), Postives = 226/371 (60.92%), Query Frame = 1
Query:   91 IPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQ--------LQSAHLDSESENDDQMEELXXXXXXXXXXXXVAAESFDPEKEDDPNQERIVYPKTPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGEDGDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQTVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMNIADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCV---RVTVREAGSDTEAEVTRIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIMQRSISNYEEQLKGIFGS 1170
            +PP +  +L  FT  V+   P + I F   YF   ++ Q          S  L SE+ ++D ++ L        R+  VAAE F+PE  +  + +  V+ K+ EQR+RL    + + +F+ L    +  +IDAM+E +V  G+++I++G+ GDNFY+IESG YD  + +NG   K+  YD  G+FGELALMYN  RAA+I     G++WA+TR+ FRS+VL KA ++R  Y  LLE VP+L  LS +ER NIADAL  +       II +G+PG  MYF+  G V   R TV E     +  +  +GPG YFGELALL+  PRAA+V  +E T LA+LDV SFERL+GPC+++M+R++ +Y++ +  +F +
Sbjct:    7 LPPHYVSILHQFTYAVMERKPTNYIHFASKYFTRLQNNQSLDRITSSFGSVSL-SEASDNDSVDTLDSKQYANRRKS-VAAERFNPEDLNSLDIQMEVHEKSEEQRSRLRKVCEKVSIFKSLSNADVTSIIDAMYEIKVKPGQEIIVEGDSGDNFYIIESGIYDAFITVNGEKKKIKTYDNEGNFGELALMYNALRAASIIASTSGIIWAVTRQVFRSVVLVKAHRQREMYNKLLEQVPMLAPLSDFERANIADALTPKECISKELIIVEGDPGYHMYFIISGKVEIYRTTVEE-----KVVINELGPGKYFGELALLSNQPRAANVKALEDTVLAVLDVKSFERLMGPCIEVMKRNMDDYKKNVVDLFNA 370          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR2A5.808e-10544.53protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A5.808e-10544.53protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A2.326e-9843.41protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B3.649e-9549.15protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B3.649e-9549.15protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-23.924e-6040.93cAMP-dependent protein kinase regulatory subunit ... [more]
kin-25.749e-6040.93cAMP-dependent protein kinase regulatory subunit ... [more]
kin-27.993e-6040.93cAMP-dependent protein kinase regulatory subunit ... [more]
egl-47.428e-2628.63cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-47.428e-2628.63cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R22.753e-11549.33gene:FBgn0022382 transcript:FBtr0088437[more]
Pka-R22.753e-11549.33gene:FBgn0022382 transcript:FBtr0088438[more]
Pka-R29.345e-10847.76gene:FBgn0022382 transcript:FBtr0112902[more]
Pka-R29.211e-10547.15gene:FBgn0022382 transcript:FBtr0112901[more]
Pka-R11.028e-6439.44gene:FBgn0259243 transcript:FBtr0300535[more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR2B8.107e-10345.28si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B2.883e-10244.56si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B2.931e-9943.86si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
prkar2aa1.247e-9843.15protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar2ab1.153e-8748.49protein kinase, cAMP-dependent, regulatory, type I... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ednrb22.443e-10745.53endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
ednrb24.097e-10645.41endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
fgf11.009e-10546.29fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf19.572e-10545.45fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf13.847e-9252.35fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkar2a6.380e-10845.78protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2a3.008e-10144.68protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b6.780e-9549.15protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b6.780e-9549.15protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b1.946e-7748.99protein kinase, cAMP dependent regulatory, type II... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26619|KAPR_STRPU1.021e-12052.56cAMP-dependent protein kinase type II regulatory s... [more]
sp|P81900|KAPR2_DROME2.760e-11449.33cAMP-dependent protein kinase type II regulatory s... [more]
sp|P00515|KAP2_BOVIN1.881e-10645.66cAMP-dependent protein kinase type II-alpha regula... [more]
sp|P12367|KAP2_MOUSE2.509e-10445.52cAMP-dependent protein kinase type II-alpha regula... [more]
sp|P13861|KAP2_HUMAN2.789e-10444.53cAMP-dependent protein kinase type II-alpha regula... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3VUE81.619e-16264.61Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3WJX81.449e-16064.08Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A3S5CG555.210e-15965.68Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A068Y6M81.887e-15764.61cAMP dependent protein kinase regulatory OS=Echino... [more]
U6IUI11.887e-15764.61cAMP dependent protein kinase regulatory OS=Echino... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.71.109e-10744.70protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa6.723e-9644.57protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar2ab1.582e-8942.97protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1ab5.161e-6638.07cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1aa8.685e-6338.18cAMP-dependent protein kinase type I-alpha regulat... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa3.011e-6951.13protein kinase, cAMP-dependent, regulatory, type I... [more]
si:ch211-272n13.74.165e-6940.81protein kinase cAMP-dependent type II regulatory s... [more]
ENSPMAT00000001198.12.110e-1526.42pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
ENSPMAT00000001825.11.461e-1229.51pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
ENSPMAT00000005026.11.645e-1245.76pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY11.835e-6341.30Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382623.802e-11950.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495341.945e-8337.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411636.928e-7540.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484394.802e-6437.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384074.580e-2827.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.71.678e-10644.19protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa5.579e-9745.19cAMP-dependent protein kinase type II-alpha regula... [more]
prkar2aa1.113e-9144.21cAMP-dependent protein kinase type II-alpha regula... [more]
si:ch211-272n13.71.412e-9040.70protein kinase cAMP-dependent type II regulatory s... [more]
prkar1ab2.008e-6437.78protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019065.10.000e+099.73SMESG000019065.1[more]
SMESG000017499.12.425e-12051.34SMESG000017499.1[more]
SMESG000025330.18.855e-10159.62SMESG000025330.1[more]
SMESG000059969.18.768e-9341.80SMESG000059969.1[more]
SMESG000057377.19.023e-9341.24SMESG000057377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014539 ID=SMED30014539|Name=cAMP-dependent protein kinase type II regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1923bp
AACTATGAATAATTGCATTATTTACTATTTTCAATAAAATATCTTACGAT
TTTAATTCAAATATCAGCTATGCCAAAACGAGAAGTCGTAATTCCACCAG
GATTTAAAGAGCTATTACAGGATTTTACTGTTTGCGTTTTACGGGATAAT
CCTGAGGACATTATCCAATTTGGAATAGATTATTTTAAAACGAAAAAATC
GGAACAGTTGCAATCAGCTCATCTAGATTCAGAAAGCGAAAATGATGATC
AAATGGAGGAATTGCCACCAATGCCTCGACCACAAGGTCGAAGACGAGGA
GTCGCTGCAGAAAGTTTCGATCCTGAAAAGGAAGATGATCCCAATCAGGA
ACGAATTGTTTACCCAAAAACACCAGAACAGAGAGCTCGATTGAATATGG
CGGTTCAAAATATTCTCTTGTTTCGTTGTCTTGATGAAGAACAAATGGTT
GATGTTATTGACGCTATGTTTGAAAGACGAGTTGTCCAAGGAGAGAAAGT
GATCATTCAAGGAGAAGATGGGGACAATTTTTATGTTATTGAATCTGGAA
CTTATGATATAATTGTTAAAATAAACGGAGTTGATACTAAAGTTGGAAAA
TACGATGGAAGCGGATCGTTTGGAGAGTTGGCACTTATGTACAACACCCC
TAGAGCAGCGACAATTCAAACTGTTAATGACGGGGTAGTTTGGGCCATGA
CTAGAGAAACATTTCGCTCTATTGTTCTAAAGAAAGCATTTCAAAAGCGT
CTTAAGTATGAAGCTTTATTGGAAAATGTTCCACTGCTTAAAGAACTTAG
TCCATACGAAAGAATGAATATCGCTGATGCATTACTTACTAGAATTTATG
AGCCAAATACAACTATTATTAAGCAAGGTGAGCCAGGCTTGGAAATGTAT
TTCCTTGAGGAGGGCTGCGTTCGAGTCACTGTAAGAGAAGCAGGCAGTGA
CACTGAAGCAGAAGTTACTAGAATCGGTCCTGGAGGATATTTTGGTGAGC
TTGCATTGTTAACAAAACATCCTCGAGCTGCTTCAGTTTATTGCGTTGAA
AAGACCAAACTCGCAATATTAGATGTTGGAAGTTTTGAAAGATTATTAGG
TCCTTGTTTAGATATAATGCAAAGGAGTATTTCAAATTATGAAGAGCAAT
TAAAAGGAATTTTTGGAAGTCTTCAAAAAATGCCCGAATTGAGACGATAA
AATTTATTATTTTTGAGCAATTCTTTTCGGTTTTTAATGTAGACATTATG
TGATTACATTGAGAAAAAAACACAAAATAGAGAATCTAATTGCCATAAAA
TCTGTAAAATCTTGATATTTTAATAATTTATCTGTTTTCTGGTTGACATT
AATTCGTGAGTGTTTGCGTCTGCGTTTGTTTGCGCGTTTGTTATTGTTTC
GAATGTGAATGCGTGGTTAATGATTTATTATAGAGAAATGTATTTTATTG
TTAGTTTATTATTGTGTAGTAAAATTTATTCGATATAAAAACTCTTTCTT
AAAATGCAATCTGCTTGATTTTGCAACGGAAGTTTTTGGACTGAGAAATC
ATTTAATTTAGTTTTGTTTGAATCTTAATTTATGTATATTGATTAGTGAT
ATTTACAATAAACAAATTCAATCACTTATTGACATTGAAATAAACATAAA
TATTTTTTATGAAATGTGTTATCGATTTGTTTTTGTGCTGCACTTGTTTT
ATCAAAACAGAGATTCTGTTGACAGAAAAAAAACCATTCTTAGAAAAGTA
TTTATAATTCCGTGGCTTTTCTAAGGAATTAAATGCCATTTGAAGATGGA
AGTCATGGAAATATATCTTTAATTTCTTTACAGTTCTTGTGCGCTAGTCA
TTTTCAGCAAATGTTATTGTTGGAACAATAATGTGTTATTGTTCACTTAA
AAGCAAAATTTATAATATTGTTT
back to top

protein sequence of SMED30014539-orf-1

>SMED30014539-orf-1 ID=SMED30014539-orf-1|Name=SMED30014539-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MPKREVVIPPGFKELLQDFTVCVLRDNPEDIIQFGIDYFKTKKSEQLQSA
HLDSESENDDQMEELPPMPRPQGRRRGVAAESFDPEKEDDPNQERIVYPK
TPEQRARLNMAVQNILLFRCLDEEQMVDVIDAMFERRVVQGEKVIIQGED
GDNFYVIESGTYDIIVKINGVDTKVGKYDGSGSFGELALMYNTPRAATIQ
TVNDGVVWAMTRETFRSIVLKKAFQKRLKYEALLENVPLLKELSPYERMN
IADALLTRIYEPNTTIIKQGEPGLEMYFLEEGCVRVTVREAGSDTEAEVT
RIGPGGYFGELALLTKHPRAASVYCVEKTKLAILDVGSFERLLGPCLDIM
QRSISNYEEQLKGIFGSLQKMPELRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:2000479regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0016310phosphorylation
GO:0045859regulation of protein kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR012198cAMP_dep_PK_reg_su
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0030552cAMP binding
Vocabulary: cellular component
TermDefinition
GO:0005952cAMP-dependent protein kinase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 155..169
score: 55.11
coord: 341..353
score: 65.13
coord: 308..317
score: 74.0
coord: 140..154
score: 52.89
coord: 320..331
score: 46.67
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 6..48
e-value: 2.4E-13
score: 51.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..103
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..98
NoneNo IPR availablePANTHERPTHR11635:SF162CAMP-DEPENDENT PROTEIN KINASE TYPE II REGULATORY SUBUNITcoord: 12..370
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 12..370
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 6..44
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainSMARTSM00394akam_3coord: 12..50
e-value: 3.8E-7
score: 39.7
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainPFAMPF02197RIIacoord: 13..44
e-value: 1.3E-10
score: 40.7
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 241..360
e-value: 3.0E-27
score: 106.5
coord: 119..236
e-value: 3.5E-17
score: 73.1
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 138..221
e-value: 3.6E-15
score: 55.8
coord: 260..345
e-value: 3.5E-19
score: 68.7
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 241..362
score: 35.609
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 119..238
score: 35.454
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 241..354
e-value: 2.24977E-30
score: 110.493
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 119..221
e-value: 2.8607E-23
score: 91.6185
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 79..222
e-value: 6.3E-51
score: 173.7
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 223..369
e-value: 1.4E-48
score: 166.2
IPR012198cAMP-dependent protein kinase regulatory subunitPIRSFPIRSF000548PK_regulatorycoord: 20..373
e-value: 2.2E-119
score: 397.0
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 310..327
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 146..162
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 186..203
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 101..222
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 235..367