SMED30014526

Overview
NameSMED30014526
Smed IDSMED30014526
Length (bp)1090
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30014526SMESG000032167.1 SMESG000032101.1 Contig32718newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014526SMESG000032167.1 SMESG000032101.1 Contig32718uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014526 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017720:6499..13711 +5109
Homology
BLAST of SMED30014526 vs. TrEMBL
Match: A0A2K2FFR9 (Uncharacterized protein OS=Pseudoclostridium thermosuccinogenes OX=84032 GN=CDQ84_13020 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.128e-6
Identity = 52/166 (31.33%), Postives = 76/166 (45.78%), Query Frame = 2
Query:   89 LYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGL--FGNFSEELEIVINKMPETPSITKIEV-ASKWIRISWNPFEEMGPEDGYEI------VMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEI 559
            L WT  N+ N +  I   +  ++     I ++    T      +     YF RVK  F+ +   G +SEELE+VI  +PE PS  +IEV +S  +R+ W   +    E G+EI      V  F K         ++    L P  +YC+ IR+FN  G S  S EI
Sbjct:  424 LTWT-DNSSNETGFIIERKTGMDGAWSVIATLGAGKTSFTHTGLAKNVHYFYRVKA-FNSVNNSGAYSEELEVVIGDIPEAPSGFRIEVLSSTEVRLIWT--DNSDDELGFEIERRQGSVRTFSKVGETGANAESYLDRGLKPGTRYCYRIRAFNKNGKSKYSREI 585          
BLAST of SMED30014526 vs. Planmine SMEST
Match: SMESG000032167.1 (SMESG000032167.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 314/320 (98.12%), Postives = 317/320 (99.06%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKKDIKWENKTISTFNITSSAPVTSTERIYTNHDHVPIVIINKMTMRNCEVE 1006
            VVLKPIESTQLPAVLYWTYQNTLNCS+IIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFA+VKP FDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWN FEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILE+FIKKDIKWE KTISTFNITSSAPVTSTERIYTNHDHVPIVIINKMTMRNCEVE
Sbjct:  632 VVLKPIESTQLPAVLYWTYQNTLNCSHIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFAKVKPEFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNSFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILELFIKKDIKWEKKTISTFNITSSAPVTSTERIYTNHDHVPIVIINKMTMRNCEVE 951          

HSP 2 Score: 337.806 bits (865), Expect = 7.806e-108
Identity = 174/272 (63.97%), Postives = 212/272 (77.94%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKI-EVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFA+VKP FDGLFGNFSEELEIVINKMP+ PS  K+  +++ +I ISW   +++   D YEIV++  +  TY+T +T F L+NLL CR+YCF I+ FN +G S LS EIC+ T + +FDEV L P+     PV L  +Y+NT NCS ILFIV+YYS+ +   +Y I TN+T +E++++E+N KY VK R +YE MF N+SK LEI I K
Sbjct:   85 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFAKVKPEFDGLFGNFSEELEIVINKMPDPPSNIKVTALSTTFIEISWESPKDIESTDKYEIVVIHSEKITYQTYKTKFKLDNLLTCRQYCFAIQVFNKLGKSELSKEICQNTKIASFDEVTLNPVNSQKLPVTLEVSYLNTLNCSNILFIVKYYSEIDSHPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITK 355          

HSP 3 Score: 249.595 bits (636), Expect = 7.518e-75
Identity = 128/272 (47.06%), Postives = 178/272 (65.44%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETP-SITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            V+L P+     P +L WTYQNTL CS+I F + YY    +  IY+  TN   ++L++I++   YFA+VKP +DG+FGNFS+E+ I++   P  P  I    V S   +I W    E+   + YEI++L P    Y+TKQT+FTL+NLLPC +YCF I +FN    S  S +IC+ TN+T FDEVVLKP++    P VL WTY NT NCS I+F +EYY +   K+IYSI+TN T  +LE+I++  KY  KV+P+++ +FGNFS+ LEI I K
Sbjct:  449 VILSPVVYNGFPVILEWTYQNTLGCSDIFFNVVYYPTYRENIIYTNRTNRKELQLDKIEHDLIYFAKVKPEYDGMFGNFSKEMLILVTSKPVKPIEIVVFNVTSTSFQIRWKMPPEVEFPNKYEIILLHPNKIIYKTKQTHFTLDNLLPCTEYCFQISTFNFFSESTKSKKICQNTNITLFDEVVLKPIESTQLPAVLYWTYQNTLNCSHIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFAKVKPEFDGLFGNFSEELEIVINK 720          

HSP 4 Score: 234.958 bits (598), Expect = 1.514e-69
Identity = 129/291 (44.33%), Postives = 186/291 (63.92%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIE-VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFI-KKDIKWENKTISTFNITSSA 913
            V L P+ S +LP  L  +Y NTLNCSNI+F ++YY E +   +Y I TN+T  ++++++Y  KY+ + +  ++G+F N+S+ELEI+I K+P TPS  K+  V +  I I W P E++G  D +E V++ P  + YRTK+T+ T  NLLPCR YCF +R FN    S LS + C+ T +  FDEV+L P+  N FPV+L WTY NT  CS I F V YY    +  IY+  TN+ E +L+KIE +  Y  KV+P+Y+ MFGNFSK + I +  K +K     I  FN+TS++
Sbjct:  268 VTLNPVNSQKLPVTLEVSYLNTLNCSNILFIVKYYSEIDSHPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITKVPITPSQVKVSGVTTNMIEIYWRPEEKLGLADEFE-VLVIPIGAIYRTKETDLTFVNLLPCRTYCFQVRIFNFWTSSELSEKKCQSTKIAYFDEVILSPVVYNGFPVILEWTYQNTLGCSDIFFNVVYYPTYRENIIYTNRTNRKELQLDKIEHDLIYFAKVKPEYDGMFGNFSKEMLILVTSKPVK--PIEIVVFNVTSTS 554          

HSP 5 Score: 156.377 bits (394), Expect = 8.041e-42
Identity = 84/173 (48.55%), Postives = 111/173 (64.16%), Query Frame = 2
Query:  380 PFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTN-------------LTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            P E   P + YEI++  P    Y+TKQT+FTL+NLLPC +YCF I +FN  G S  S +I +KTN             L  FDEVVLKP++    P VL WTY NT NCS I+F +EYY +   K+IYSI+TN T  +LE+I++  KY  KV+P+++ +FGNFS+ LEI I K
Sbjct:    2 PLEVEYPNE-YEIILRHPNKIIYKTKQTHFTLDNLLPCTEYCFQISTFNFFGESKKSKKIYQKTNISIKTIQNIIYDNLVLFDEVVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFAKVKPEFDGLFGNFSEELEIVINK 173          
BLAST of SMED30014526 vs. Planmine SMEST
Match: SMESG000032101.1 (SMESG000032101.1)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 259/270 (95.93%), Postives = 264/270 (97.78%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIK 856
             VLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTL+NLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQD+SFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSI TNKTESELEKIEFNKKYAVKVRPKYEEMFGNF+ +   FI+
Sbjct:  335 AVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLQNLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDSSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSIITNKTESELEKIEFNKKYAVKVRPKYEEMFGNFNWVENPFIE 604          

HSP 2 Score: 196.823 bits (499), Expect = 1.090e-56
Identity = 113/271 (41.70%), Postives = 153/271 (56.46%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            V L  I++  LP +L W Y+NT NCS I F + YY E   +NI+S++T                   VKPI            EIV+             V S   +I W    E+   + YEI++L P    Y+TKQT+FTL+NLLPC +YCF I +FN    S  S +IC+ TN+T FDE VLKP++    P VL WTY NT NCS I+F +EYY +   K+IYSI+TN T  +LE+I++  KY  +V+P ++ +FGNFS+ LEI I K
Sbjct:  193 VTLSSIQTMTLPFILQWYYENTFNCSGISFLVHYYSEKEIENIFSVTTKP-----------------VKPI------------EIVV-----------FNVTSTSFQILWKMPPEVEFPNKYEIILLHPNKIIYKTKQTHFTLDNLLPCTEYCFQISTFNFFSESTKSKKICQNTNITLFDEAVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINK 423          

HSP 3 Score: 169.088 bits (427), Expect = 1.272e-46
Identity = 90/212 (42.45%), Postives = 137/212 (64.62%), Query Frame = 2
Query:  143 EYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIE-VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFN 775
            +YY E +   +Y I TN+T  ++++++Y  KY+ + +  ++G+F N+S+ELEI+I K+P TPS  K+  V +  I I W P E++G  D +E V++ P  + YRTK+T+ T  NLLPCR YCF +R FN    S LS + C+ T + +F +V L  +Q  + P +L W Y NT NCSGI F+V YYS+KE ++I+S+TT K    +E + FN
Sbjct:   44 KYYSEIDSHPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITKVPITPSQVKVSGVTTNMIEIYWRPEEKLGLADEFE-VLVIPIGAIYRTKETDLTFVNLLPCRTYCFQVRIFNFWTSSELSEKKCQSTKIGSFGQVTLSSIQTMTLPFILQWYYENTFNCSGISFLVHYYSEKEIENIFSVTT-KPVKPIEIVVFN 252          

HSP 4 Score: 52.373 bits (124), Expect = 3.494e-7
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 2
Query:  689 EYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            +YYS+ +   +Y IT N+T +E++++E+N KY VK R +YE MF N+SK LEI I K
Sbjct:   44 KYYSEIDSHPVYFIT-NETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITK 99          
BLAST of SMED30014526 vs. Planmine SMEST
Match: SMESG000032101.1 (SMESG000032101.1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 254/258 (98.45%), Postives = 256/258 (99.22%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMF 820
             VLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTL+NLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQD+SFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSI TNKTESELEKIEFNKKYAVKVRPKYEEMF
Sbjct:  335 AVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLQNLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDSSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSIITNKTESELEKIEFNKKYAVKVRPKYEEMF 592          

HSP 2 Score: 196.823 bits (499), Expect = 7.125e-57
Identity = 113/271 (41.70%), Postives = 153/271 (56.46%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            V L  I++  LP +L W Y+NT NCS I F + YY E   +NI+S++T                   VKPI            EIV+             V S   +I W    E+   + YEI++L P    Y+TKQT+FTL+NLLPC +YCF I +FN    S  S +IC+ TN+T FDE VLKP++    P VL WTY NT NCS I+F +EYY +   K+IYSI+TN T  +LE+I++  KY  +V+P ++ +FGNFS+ LEI I K
Sbjct:  193 VTLSSIQTMTLPFILQWYYENTFNCSGISFLVHYYSEKEIENIFSVTTKP-----------------VKPI------------EIVV-----------FNVTSTSFQILWKMPPEVEFPNKYEIILLHPNKIIYKTKQTHFTLDNLLPCTEYCFQISTFNFFSESTKSKKICQNTNITLFDEAVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINK 423          

HSP 3 Score: 169.474 bits (428), Expect = 8.611e-47
Identity = 90/212 (42.45%), Postives = 137/212 (64.62%), Query Frame = 2
Query:  143 EYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIE-VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFN 775
            +YY E +   +Y I TN+T  ++++++Y  KY+ + +  ++G+F N+S+ELEI+I K+P TPS  K+  V +  I I W P E++G  D +E V++ P  + YRTK+T+ T  NLLPCR YCF +R FN    S LS + C+ T + +F +V L  +Q  + P +L W Y NT NCSGI F+V YYS+KE ++I+S+TT K    +E + FN
Sbjct:   44 KYYSEIDSHPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITKVPITPSQVKVSGVTTNMIEIYWRPEEKLGLADEFE-VLVIPIGAIYRTKETDLTFVNLLPCRTYCFQVRIFNFWTSSELSEKKCQSTKIGSFGQVTLSSIQTMTLPFILQWYYENTFNCSGISFLVHYYSEKEIENIFSVTT-KPVKPIEIVVFN 252          

HSP 4 Score: 79.7221 bits (195), Expect = 5.597e-16
Identity = 42/108 (38.89%), Postives = 68/108 (62.96%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRI 370
            VVLKP++ +  P VL WTY NT NCS I+F +EYY +   K+IYSI TN T  +LE+I++  KY  +V+P ++ +F    +  +I  +   ++  IT  ++ + W++I
Sbjct:  517 VVLKPLQDSSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSIITNKTESELEKIEFNKKYAVKVRPKYEEMF-EIEQFTDISCDLSLKSKLITSGDILNFWLQI 623          

HSP 5 Score: 52.373 bits (124), Expect = 3.336e-7
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 2
Query:  689 EYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            +YYS+ +   +Y IT N+T +E++++E+N KY VK R +YE MF N+SK LEI I K
Sbjct:   44 KYYSEIDSHPVYFIT-NETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITK 99          
BLAST of SMED30014526 vs. Planmine SMEST
Match: SMESG000032101.1 (SMESG000032101.1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 259/285 (90.88%), Postives = 267/285 (93.68%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKKDIKWENKTISTFNI 901
             VLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTL+NLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQD+SFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSI TNKTESELEKIEFNKKYAVKVRPKYEEMF          I  D+  ++K I++ +I
Sbjct:  282 AVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLQNLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDSSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSIITNKTESELEKIEFNKKYAVKVRPKYEEMFD---------ISCDLSLKSKLITSGDI 557          

HSP 2 Score: 167.548 bits (423), Expect = 1.793e-46
Identity = 84/171 (49.12%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  347 VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            V S   +I W    E+   + YEI++L P    Y+TKQT+FTL+NLLPC +YCF I +FN    S  S +IC+ TN+T FDE VLKP++    P VL WTY NT NCS I+F +EYY +   K+IYSI+TN T  +LE+I++  KY  +V+P ++ +FGNFS+ LEI I K
Sbjct:  200 VTSTSFQILWKMPPEVEFPNKYEIILLHPNKIIYKTKQTHFTLDNLLPCTEYCFQISTFNFFSESTKSKKICQNTNITLFDEAVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINK 370          

HSP 3 Score: 116.316 bits (290), Expect = 3.003e-28
Identity = 64/167 (38.32%), Postives = 103/167 (61.68%), Query Frame = 2
Query:  143 EYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIE-VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFD--EVVLKPLQDNSFPVV 634
            +YY E +   +Y I TN+T  ++++++Y  KY+ + +  ++G+F N+S+ELEI+I K+P TPS  K+  V +  I I W P E++G  D +E V++ P  + YRTK+T+ T  NLLPCR YCF +R FN    S LS + C+ T +      E+V+  +   SF ++
Sbjct:   44 KYYSEIDSHPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITKVPITPSQVKVSGVTTNMIEIYWRPEEKLGLADEFE-VLVIPIGAIYRTKETDLTFVNLLPCRTYCFQVRIFNFWTSSELSEKKCQSTKIEPVKPIEIVVFNVTSTSFQIL 208          

HSP 4 Score: 52.373 bits (124), Expect = 3.679e-7
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 2
Query:  689 EYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            +YYS+ +   +Y IT N+T +E++++E+N KY VK R +YE MF N+SK LEI I K
Sbjct:   44 KYYSEIDSHPVYFIT-NETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITK 99          
BLAST of SMED30014526 vs. Planmine SMEST
Match: SMESG000032056.1 (SMESG000032056.1)

HSP 1 Score: 237.654 bits (605), Expect = 2.138e-70
Identity = 121/275 (44.00%), Postives = 185/275 (67.27%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIE-VASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKKDIK 868
            V L P++S +LP  L  TY NTLNCSNI+F ++YY + +   +Y I TN+T  ++++++Y  KY+ + +  ++G+F N+S+ELEI+I K+P TPS  K+  V +  I I W P E++G  D +E+++L P  + YRTK+T  T+ NLLPCR YCF +R FN    S LS + C+ T + +F +V L  +Q  + P +L W+Y NT NC GI F+V YYS+KE ++ +S+TT KTE  L+K+E+ +KY  KV+PK+    G FSK ++IFI +D++
Sbjct:  482 VTLNPVKSQKLPVTLEVTYLNTLNCSNILFKVKYYSDMDSDPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITKVPITPSQVKVSGVTTNMIEIYWMPEEKLGLADEFEVLVL-PIRAIYRTKETILTIGNLLPCRTYCFQVRIFNFWTSSELSEKKCQSTKIGSFGQVTLSAIQTMTLPFILEWSYENTFNCFGISFLVHYYSEKEIENFFSVTTKKTEILLKKVEYERKYFAKVKPKFGREDGQFSKEIKIFITRDLQ 754          

HSP 2 Score: 232.261 bits (591), Expect = 1.520e-68
Identity = 123/272 (45.22%), Postives = 180/272 (66.18%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKI-EVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIKK 859
            V++ PIE+ +LP +L WTYQNT NCS I F +EY+   +  N+++  TN T + L++I+    Y  RV+P +    G F+E++ I+  K+P+ PS  K+  +++ +I ISW   +++   D YEIV++  +  TY+T +T F L+NLL CR+YCF IR FN +G S LS EIC+ T + +FDEV L P++    PV L  TY+NT NCS ILF V+YYSD +   +Y I TN+T +E++++E+N KY VK R +YE MF N+SK LEI I K
Sbjct:  300 VLVGPIETKRLPVILRWTYQNTFNCSGIEFIVEYFSLRDNVNLFTYKTNKTEIILDKIQLNEIYNVRVRPTYGEELGPFTEDM-IIWVKVPDPPSNIKVTALSTTFIEISWESPKDIESTDKYEIVVIHQEKITYQTYETKFKLDNLLTCRQYCFAIRVFNKLGKSELSKEICQNTKIASFDEVTLNPVKSQKLPVTLEVTYLNTLNCSNILFKVKYYSDMDSDPVYFI-TNETATEIQEMEYNIKYYVKARCEYEGMFSNYSKELEILITK 569          

HSP 3 Score: 219.164 bits (557), Expect = 7.633e-64
Identity = 112/268 (41.79%), Postives = 167/268 (62.31%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETP-SITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEI 847
            V L  I++  LP +L W+Y+NT NC  I F + YY E   +N +S++T  T + L++++Y+ KYFA+VKP F    G FS+E++I I +  + P  +T +   S  I + W           YEI+M  P  + Y+  +T FT+ NL PCR+YCF IR+++    S LS EIC +T + +FD+V+   L  +  PV+L WTY NT NC GI F V YY   ++KDI+ + TN+T  +LEK+E+NK Y  KV+P+Y+E FG FS+++EI
Sbjct:  663 VTLSAIQTMTLPFILEWSYENTFNCFGISFLVHYYSEKEIENFFSVTTKKTEILLKKVEYERKYFAKVKPKFGREDGQFSKEIKIFITRDLQAPIELTVVNGTSNSIHLQWKQPRNFCLSYQYEIIMQ-PNGTKYKKNETQFTIRNLQPCRRYCFQIRAYSDFSKSELSKEICHETKIASFDKVIPSSLHYDKLPVILQWTYENTLNCFGISFQVVYYPKNDEKDIHYLKTNETRIKLEKVEYNKIYFAKVKPQYKEQFGEFSEVIEI 929          

HSP 4 Score: 150.214 bits (378), Expect = 1.268e-39
Identity = 81/202 (40.10%), Postives = 126/202 (62.38%), Query Frame = 2
Query:  254 PIFDGLFGNFSEELEIVINKMPETPS-ITKIEVASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRKYCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTYINTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVRPKYEEMFGNFSKILEIFIK 856
            PI    F  +  +L + +  +P TP+ I   + + K   +SW   + +G  +GYEI +       Y++ QTNF L+N+L C+KYCFGIR+FN  G S +S E C   N+ +  +V++ P++    PV+L WTY NT NCSGI FIVEY+S +++ ++++  TNKTE  L+KI+ N+ Y V+VRP Y E  G F++ + I++K
Sbjct:  187 PIKYNTFAGYVYKLPL-MTYVPTTPTEIIITQSSQKSFNVSWRKPDFIGLIEGYEINVFQATEVIYKSYQTNFNLDNVLLCKKYCFGIRAFNSWGKSEISKEKCGNINILSLGKVLVGPIETKRLPVILRWTYQNTFNCSGIEFIVEYFSLRDNVNLFTYKTNKTEIILDKIQLNEIYNVRVRPTYGEELGPFTEDMIIWVK 387          

HSP 5 Score: 95.1301 bits (235), Expect = 4.402e-21
Identity = 47/111 (42.34%), Postives = 75/111 (67.57%), Query Frame = 2
Query:   47 VVLKPIESTQLPAVLYWTYQNTLNCSNIIFYIEYYLENNKKNIYSISTNDTMVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETP-SITKIEVASKWIRISW 376
            V+   +   +LP +L WTY+NTLNC  I F + YY +N++K+I+ + TN+T +KLE+++Y   YFA+VKP +   FG FSE +EI+  K P+ P +I  +++ + +I ISW
Sbjct:  845 VIPSSLHYDKLPVILQWTYENTLNCFGISFQVVYYPKNDEKDIHYLKTNETRIKLEKVEYNKIYFAKVKPQYKEQFGEFSEVIEIITIKRPDPPLNIEVLDLFTTFIEISW 955          
The following BLAST results are available for this feature:
BLAST of SMED30014526 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A2K2FFR91.128e-631.33Uncharacterized protein OS=Pseudoclostridium therm... [more]
back to top
BLAST of SMED30014526 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014526 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032167.17.806e-10898.13SMESG000032167.1[more]
SMESG000032101.11.090e-5695.93SMESG000032101.1[more]
SMESG000032101.17.125e-5798.45SMESG000032101.1[more]
SMESG000032101.11.793e-4690.88SMESG000032101.1[more]
SMESG000032056.12.138e-7044.00SMESG000032056.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014526 ID=SMED30014526|Name=SMED30014526|organism=Schmidtea mediterranea sexual|type=transcript|length=1090bp
GGAGAATCAAAAAAATCAAAGAAGATATACCAAAAAACAAATATAAGTCG
TCCTGAAACCAATCGAATCCACTCAGCTGCCGGCTGTGCTATATTGGACC
TATCAGAATACTTTGAATTGTTCCAATATCATTTTCTACATTGAATATTA
TCTAGAGAATAACAAAAAGAATATTTATTCTATCTCAACAAATGACACAA
TGGTAAAGCTAGAACAAATTAAATATAAAACAAAATATTTCGCTAGAGTT
AAACCTATATTTGACGGTCTGTTTGGTAATTTTTCCGAAGAACTTGAAAT
AGTTATTAACAAAATGCCTGAAACACCGTCGATAACTAAGATTGAAGTGG
CATCAAAATGGATTCGAATTTCCTGGAATCCCTTCGAAGAAATGGGCCCC
GAAGACGGATACGAAATAGTTATGCTCTTTCCTAAAACCTCTACATATCG
AACAAAACAAACTAATTTTACTTTGGAAAATTTGTTACCGTGTAGAAAAT
ATTGTTTTGGAATTCGGAGCTTTAACCTAGTTGGGATTTCAAACCTATCA
ATGGAAATATGTGAAAAAACAAATCTAACTGCCTTTGACGAAGTCGTTCT
GAAGCCCTTGCAAGACAATAGTTTTCCTGTTGTTTTATCCTGGACATACA
TAAATACTTCAAATTGTTCTGGTATTTTGTTCATAGTGGAATATTATTCC
GATAAAGAGGATAAAGATATTTATTCTATTACTACAAATAAAACAGAATC
AGAGCTAGAGAAAATTGAGTTCAATAAAAAGTACGCTGTCAAAGTCAGAC
CTAAATATGAAGAAATGTTTGGTAATTTTTCCAAAATATTAGAAATATTT
ATTAAAAAAGATATCAAATGGGAAAATAAAACAATATCTACATTTAATAT
AACGAGTAGCGCGCCTGTTACGTCAACGGAAAGAATATATACGAACCATG
ATCATGTCCCTATTGTTATAATAAATAAAATGACAATGCGAAACTGCGAA
GTTGAACTACTTTTAATTTTACTGTGTCTCATGTATTTGTGTTTAATATA
ACAAAATTATTAAATTAATAAATTTTTGGTTCTAAAAAAA
back to top

protein sequence of SMED30014526-orf-1

>SMED30014526-orf-1 ID=SMED30014526-orf-1|Name=SMED30014526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MVKLEQIKYKTKYFARVKPIFDGLFGNFSEELEIVINKMPETPSITKIEV
ASKWIRISWNPFEEMGPEDGYEIVMLFPKTSTYRTKQTNFTLENLLPCRK
YCFGIRSFNLVGISNLSMEICEKTNLTAFDEVVLKPLQDNSFPVVLSWTY
INTSNCSGILFIVEYYSDKEDKDIYSITTNKTESELEKIEFNKKYAVKVR
PKYEEMFGNFSKILEIFIKKDIKWENKTISTFNITSSAPVTSTERIYTNH
DHVPIVIINKMTMRNCEVELLLILLCLMYLCLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR003961FN3_dom
IPR013783Ig-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 40..114
e-value: 3.1E-4
score: 30.1
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 128..221
score: 7.63
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 39..127
score: 12.505
IPR003961Fibronectin type IIICDDcd00063FN3coord: 40..124
e-value: 5.34458E-6
score: 42.0983
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 36..126
e-value: 3.8E-9
score: 38.6
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 43..218