Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit

Overview
NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
Smed IDSMED30014525
Length (bp)1429
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (SMED30014525) t-SNE clustered cells

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (SMED30014525) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (SMED30014525) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (SMED30014525) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014525

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30014525SMESG000010589.1 SmedASXL_018795SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014525SMESG000010589.1 dd_Smed_v4_948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014525SMESG000010589.1 Contig44406uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014525SMESG000010589.1 Contig44406newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30014525SMESG000010589.1 dd_Smed_v6_948_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014525SMESG000010589.1 dd_Smed_v6_948_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014525SMESG000010589.1 dd_Smed_v6_948_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30014525SMESG000010589.1 dd_Smed_v6_948_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Human
Match: DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:2728])

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 257/429 (59.91%), Postives = 324/429 (75.52%), Query Frame = 1
Query:   61 SLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I +L  +G W PF  DD+QLEF RIDPFVR  + +K GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   22 AVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIQQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK-EKEKSD 439          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Human
Match: DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:2728])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 257/429 (59.91%), Postives = 324/429 (75.52%), Query Frame = 1
Query:   61 SLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I +L  +G W PF  DD+QLEF RIDPFVR  + +K GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   39 AVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIQQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK-EKEKSD 456          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Human
Match: DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:2728])

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 257/429 (59.91%), Postives = 324/429 (75.52%), Query Frame = 1
Query:   61 SLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I +L  +G W PF  DD+QLEF RIDPFVR  + +K GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   39 AVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIQQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK-EKEKSD 456          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Human
Match: DDOST (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:2728])

HSP 1 Score: 155.221 bits (391), Expect = 8.790e-45
Identity = 83/165 (50.30%), Postives = 105/165 (63.64%), Query Frame = 1
Query:   61 SLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGV 552
            ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV                              G+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGV
Sbjct:   22 AVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVE-----------------------------GDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGV 154          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Celegans
Match: ostb-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P45971])

HSP 1 Score: 416.387 bits (1069), Expect = 1.687e-142
Identity = 212/434 (48.85%), Postives = 279/434 (64.29%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRK-DEGKHTLIISDAGNIAKIPIIVGKVNS--PILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKN 1338
            + L  S+     L    LVL ET A K+THS+F  S++ERGH+LT   ADDS L L K G+ ++ ++ + AP V+ FGG +  + ++ FVD GGNVLVAA + IG+A+RE  +E G EF+E  T VIDHHNYD+  D G HT ++     +    +IVG      P+LF+G+G+ A   N L ++++ AS  AYS++P       P+  G  T LV  LQ+RNNAR++F GS + FS+  F+A           ++SGN   A+AI++WV KE+GVLRV  V+H     +++  + PP   Y I EDV Y I I+EL+ +G W PF   DVQLEF RIDPFVR  +   NG+  + FKLPDV GVFKFLVDY RVGYTH+Y   QVSVRPL HTQYERFI++AYPYYAS+ SMM GLVLFS V+LY KD   K 
Sbjct:    7 LLLIASIGFHQSLADRVLVLGETAAVKDTHSVFLNSVKERGHELTVRAADDSQLALFKHGQLIFDHLFILAPGVQVFGGSLSPSEISKFVDAGGNVLVAAGSNIGDALREIAAEHGFEFEEAGTSVIDHHNYDQTLDSGDHTTLVVGKDQLISAELIVGNSAKLHPVLFKGIGLVAGKTNNLALSIVRASGTAYSYDPKAVRATNPSIAGSRTLLVGGLQSRNNARIVFTGSSELFSNTFFSAKTNSVNPSVQGAQSGNADFATAITRWVMKESGVLRVKTVNH-----HKKGETVPPVEGYFITEDVVYTIEIEELK-NGKWVPFQGKDVQLEFVRIDPFVRATLKNSNGRLSVAFKLPDVLGVFKFLVDYRRVGYTHLYDVQQVSVRPLWHTQYERFIRSAYPYYASSFSMMAGLVLFSIVYLYHKDTPVKG 434          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Celegans
Match: ostb-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P45971])

HSP 1 Score: 416.387 bits (1069), Expect = 1.687e-142
Identity = 212/434 (48.85%), Postives = 279/434 (64.29%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRK-DEGKHTLIISDAGNIAKIPIIVGKVNS--PILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKN 1338
            + L  S+     L    LVL ET A K+THS+F  S++ERGH+LT   ADDS L L K G+ ++ ++ + AP V+ FGG +  + ++ FVD GGNVLVAA + IG+A+RE  +E G EF+E  T VIDHHNYD+  D G HT ++     +    +IVG      P+LF+G+G+ A   N L ++++ AS  AYS++P       P+  G  T LV  LQ+RNNAR++F GS + FS+  F+A           ++SGN   A+AI++WV KE+GVLRV  V+H     +++  + PP   Y I EDV Y I I+EL+ +G W PF   DVQLEF RIDPFVR  +   NG+  + FKLPDV GVFKFLVDY RVGYTH+Y   QVSVRPL HTQYERFI++AYPYYAS+ SMM GLVLFS V+LY KD   K 
Sbjct:    7 LLLIASIGFHQSLADRVLVLGETAAVKDTHSVFLNSVKERGHELTVRAADDSQLALFKHGQLIFDHLFILAPGVQVFGGSLSPSEISKFVDAGGNVLVAAGSNIGDALREIAAEHGFEFEEAGTSVIDHHNYDQTLDSGDHTTLVVGKDQLISAELIVGNSAKLHPVLFKGIGLVAGKTNNLALSIVRASGTAYSYDPKAVRATNPSIAGSRTLLVGGLQSRNNARIVFTGSSELFSNTFFSAKTNSVNPSVQGAQSGNADFATAITRWVMKESGVLRVKTVNH-----HKKGETVPPVEGYFITEDVVYTIEIEELK-NGKWVPFQGKDVQLEFVRIDPFVRATLKNSNGRLSVAFKLPDVLGVFKFLVDYRRVGYTHLYDVQQVSVRPLWHTQYERFIRSAYPYYASSFSMMAGLVLFSIVYLYHKDTPVKG 434          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Fly
Match: Ost48 (gene:FBgn0014868 transcript:FBtr0071344)

HSP 1 Score: 501.516 bits (1290), Expect = 7.886e-176
Identity = 248/437 (56.75%), Postives = 316/437 (72.31%), Query Frame = 1
Query:   49 FLFVSLCVSSCLGI-----ETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-----SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKN-GKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD 1326
             L   L ++ C  +      TLVLL+  A +ETHSIFFKSL++RG KLT+ LADDSSL+L+K+GEYLYKNVI+FAPSV EFGG + V  L  FVDDGGNVLVA S K G+A+REF SECG E DEE   VIDH +YD  D G+HT I++ A N+ +   IVGK N     +P+L+RG G+ AD +NPL++ LL A S AYS+NP+  + DYP++VG+ T L+ ALQARNNARV+F GSL FFSD+ FT  V++A S   H  +GN  +A +ISKWVF ETG LRV +V H     +++    PP + YTI + V Y I I+EL + G W+ F A D+QLEF RIDPFVR  + + N G +   FK+PDVYGV++F VDY+RVGYTH+YS+TQVSVRPL HTQYERFI +A+PYY SA SMM+G+ +FSFVFL+FKD+
Sbjct:    6 LLIAVLAIAHCQAVLETDANTLVLLDNLAIRETHSIFFKSLQDRGFKLTYKLADDSSLLLSKYGEYLYKNVIIFAPSVEEFGGDVSVERLAQFVDDGGNVLVAGSEKSGDALREFASECGFELDEENAAVIDHLHYDVSDAGEHTTILTSAKNLIQADTIVGKANRQADAAPLLYRGTGLIADKENPLVLKLLTAESTAYSYNPEASVSDYPHAVGRGTLLIAALQARNNARVVFSGSLLFFSDESFTTAVQYAQSGVFHKLAGNRDVAESISKWVFGETGRLRVASVQH-----HKEGELLPPDQAYTITDPVVYTIGIEEL-VQGEWRAFKASDIQLEFVRIDPFVRTYLKQTNTGAYQAKFKIPDVYGVYQFKVDYNRVGYTHLYSTTQVSVRPLEHTQYERFIPSAFPYYTSAFSMMIGVFVFSFVFLHFKDE 436          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Zebrafish
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:406408])

HSP 1 Score: 498.819 bits (1283), Expect = 9.960e-175
Identity = 246/433 (56.81%), Postives = 321/433 (74.13%), Query Frame = 1
Query:   52 LFVSLCVSSCLG-IETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGK-VNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVS-KQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            L  +L + + LG  +TLVLL+    ++THSIFF+SL +RG  LTF  ADD  L L K+G++LY ++I+F+PSV +FGG I+V T+T F+D GGNVLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK  + P+LF+GVG+ AD  NPL++++L  SS +YS+ PD+PI  YP++VGKNT L+  LQARNNARV+F GSL FFSD  F + V+ A +  + + ++GN+ LA A+S+WVFKE GVLRVG+V+H     +       PP  YT+ + V Y I I+ L   G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +A+PYYASA SMM GL +FS VFL+ + +KEK++
Sbjct:   17 LSAALMLQAVLGDGKTLVLLDNPNIRDTHSIFFRSLADRGFDLTFKTADDPGLSLLKYGQFLYDHLILFSPSVEDFGGNINVETITAFIDGGGNVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDPGEHTLIVADPENLLKAPTIVGKPTDKPVLFKGVGMVADPDNPLVLDILTGSSTSYSYFPDRPITQYPHAVGKNTLLIAGLQARNNARVVFSGSLHFFSDAFFNSAVQKAATGSKRYEQTGNQDLAEALSRWVFKEAGVLRVGDVTHHPVGEST------PPAAYTVTDLVEYGIVIEMLS-GGKWVPFDGDDIQLEFVRIDPFVRTYLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAFPYYASAFSMMAGLFVFSVVFLHMR-EKEKSD 441          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:100145597])

HSP 1 Score: 476.478 bits (1225), Expect = 3.134e-166
Identity = 233/409 (56.97%), Postives = 303/409 (74.08%), Query Frame = 1
Query:  121 TKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVS-KQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            TK T +       +RG  L+F  ADD SL L K+GE+LY N+I+F+PSV +FGG I++ T+++F+D GG+VLVAAS+ IG+ +RE GSECGIEFDE+KT VIDHHNYD  D G+H+LI++D+ ++ K P IVGK   +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GS+DFFSD  F + V+ A      ++++GN  LA A+S+WVFKE GVLRVG VSH     +       PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YS+TQVSVRPL HTQYERFI +AYPYYASA S+M GL +FS VFL+ K +KEK++
Sbjct:   11 TKITTTSSLSRPPDRGFDLSFRTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINIETISSFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEDKTAVIDHHNYDISDPGQHSLIVADSESLLKAPTIVGKAPLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVVFSGSMDFFSDAFFNSAVQKAAGGSNRYAKTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESS------PPSAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK-EKEKSD 411          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:100145597])

HSP 1 Score: 477.248 bits (1227), Expect = 3.169e-166
Identity = 233/409 (56.97%), Postives = 303/409 (74.08%), Query Frame = 1
Query:  121 TKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQT-HSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            TK T +       +RG  L+F  ADD SL L K+GE+LY N+I+F+PSV +FGG I++ T+++F+D GG+VLVAAS+ IG+ +RE GSECGIEFDE+KT VIDHHNYD  D G+H+LI++D+ ++ K P IVGK   +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GS+DFFSD  F + V+ A      ++++GN  LA A+S+WVFKE GVLRVG VSH     +       PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YS+TQVSVRPL HTQYERFI +AYPYYASA S+M GL +FS VFL+ K +KEK++
Sbjct:   32 TKITTTSSLSRPPDRGFDLSFRTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINIETISSFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEDKTAVIDHHNYDISDPGQHSLIVADSESLLKAPTIVGKAPLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVVFSGSMDFFSDAFFNSAVQKAAGGSNRYAKTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESS------PPSAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK-EKEKSD 432          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:100145597])

HSP 1 Score: 477.633 bits (1228), Expect = 9.771e-166
Identity = 238/429 (55.48%), Postives = 311/429 (72.49%), Query Frame = 1
Query:   64 LCVSSCLGIETLVLLETF-ATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVS-KQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            L VS    ++ L+L      TK T +       +RG  L+F  ADD SL L K+GE+LY N+I+F+PSV +FGG I++ T+++F+D GG+VLVAAS+ IG+ +RE GSECGIEFDE+KT VIDHHNYD  D G+H+LI++D+ ++ K P IVGK   +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GS+DFFSD  F + V+ A      ++++GN  LA A+S+WVFKE GVLRVG VSH     +       PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YS+TQVSVRPL HTQYERFI +AYPYYASA S+M GL +FS VFL+ K +KEK++
Sbjct:   53 LSVSPKPDLDFLLLSAILIPTKITTTSSLSRPPDRGFDLSFRTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINIETISSFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEDKTAVIDHHNYDISDPGQHSLIVADSESLLKAPTIVGKAPLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVVFSGSMDFFSDAFFNSAVQKAAGGSNRYAKTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESS------PPSAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK-EKEKSD 473          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:100145597])

HSP 1 Score: 476.863 bits (1226), Expect = 3.172e-165
Identity = 233/409 (56.97%), Postives = 303/409 (74.08%), Query Frame = 1
Query:  121 TKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVS-KQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            TK T +       +RG  L+F  ADD SL L K+GE+LY N+I+F+PSV +FGG I++ T+++F+D GG+VLVAAS+ IG+ +RE GSECGIEFDE+KT VIDHHNYD  D G+H+LI++D+ ++ K P IVGK   +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GS+DFFSD  F + V+ A      ++++GN  LA A+S+WVFKE GVLRVG VSH     +       PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YS+TQVSVRPL HTQYERFI +AYPYYASA S+M GL +FS VFL+ K +KEK++
Sbjct:   91 TKITTTSSLSRPPDRGFDLSFRTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINIETISSFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEDKTAVIDHHNYDISDPGQHSLIVADSESLLKAPTIVGKAPLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVVFSGSMDFFSDAFFNSAVQKAAGGSNRYAKTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESS------PPSAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK-EKEKSD 491          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:100145597])

HSP 1 Score: 421.009 bits (1081), Expect = 6.535e-144
Identity = 218/407 (53.56%), Postives = 281/407 (69.04%), Query Frame = 1
Query:  145 FKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQT-HSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVR----QNMLRKNGKFYLDFKLPDVYGVFKFLVDYH--RVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            F     RG  L+F  ADD SL L K+GE+LY N+I+F+PSV +FGG I++ T+++F+D GG+VLVAAS+ IG+ +RE GSECGIEFDE+KT VIDHHNYD  D G+H+LI++D+ ++ K P IVGK   +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GS+DFFSD  F + V+ A      ++++GN  LA A+S+WVFKE GVLRVG VSH     +       PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR    +N+ +   K YL   L   YG    L  YH     +T      QVSVRPL HTQYERFI +AYPYYASA S+M GL +FS VFL+ K +KEK++
Sbjct:   58 FHGSSNRGFDLSFRTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINIETISSFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEDKTAVIDHHNYDISDPGQHSLIVADSESLLKAPTIVGKAPLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVVFSGSMDFFSDAFFNSAVQKAAGGSNRYAKTGNYELAVALSRWVFKEEGVLRVGQVSHHRVGESS------PPSAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKNVKQVGSKLYL---LIGCYGFHNPLGVYHGDTACFTLFSPPLQVSVRPLQHTQYERFIPSAYPYYASAFSVMFGLFIFSIVFLHMK-EKEKSD 453          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Mouse
Match: Ddost (dolichyl-di-phosphooligosaccharide-protein glycotransferase [Source:MGI Symbol;Acc:MGI:1194508])

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 258/434 (59.45%), Postives = 326/434 (75.12%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            + L V  CV +  G  TLVLL+    ++THS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VG+NT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + RK GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM GL +FS VFL+ K +KEK++
Sbjct:   17 LLLAVLGCVCAS-GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGEMAPPNAYTVTDLVEYSIIIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMK-EKEKSD 441          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Match: sp|Q5R501|OST48_PONAB (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Pongo abelii OX=9601 GN=DDOST PE=2 SV=2)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 258/432 (59.72%), Postives = 325/432 (75.23%), Query Frame = 1
Query:   52 LFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            L  ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I +L  +G W PF  DD+QLEF RIDPFVR  + +K GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   19 LLGAVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIQQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK-EKEKSD 439          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Match: sp|A6QPY0|OST48_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Bos taurus OX=9913 GN=DDOST PE=2 SV=2)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 257/421 (61.05%), Postives = 320/421 (76.01%), Query Frame = 1
Query:   85 GIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            G  TLVLL+    +ETHS+FF+SL++RG  LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I++L  DG W PF  DD+QLEF RIDPFVR  + RK GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   27 GPRTLVLLDNLNLRETHSLFFRSLKDRGFVLTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIEQLS-DGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSVVFLHMK-EKEKSD 439          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Match: sp|P39656|OST48_HUMAN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4)

HSP 1 Score: 520.39 bits (1339), Expect = 0.000e+0
Identity = 257/429 (59.91%), Postives = 324/429 (75.52%), Query Frame = 1
Query:   61 SLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            ++C S   G  TLVLL+    +ETHS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I +L  +G W PF  DD+QLEF RIDPFVR  + +K GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM+GL +FS VFL+ K +KEK++
Sbjct:   39 AVCAS---GPRTLVLLDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIQQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK-EKEKSD 456          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Match: sp|Q641Y0|OST48_RAT (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ddost PE=2 SV=1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 257/428 (60.05%), Postives = 323/428 (75.47%), Query Frame = 1
Query:   64 LCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            +C S   G  TLVLL+    ++THS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VG+NT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + RK GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM GL LFS VFL+ K +KEK++
Sbjct:   25 VCAS---GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKAAPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGETAPPNAYTVTDLVEYSIVIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFLFSVVFLHMK-EKEKSD 441          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Match: sp|O54734|OST48_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mus musculus OX=10090 GN=Ddost PE=1 SV=2)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 258/434 (59.45%), Postives = 326/434 (75.12%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVN-SPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            + L V  CV +  G  TLVLL+    ++THS+FF+SL++RG +LTF  ADD SL L K+GE+LY N+I+F+PSV +FGG I+V T++ F+D GG+VLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK + +PILFRGVG+ AD  NPL++++L  SS +YSF PDKPI  YP++VG+NT L+  LQARNNARV+F GSLDFFSD  F + V+ A    Q +S++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YT+ + V Y I I++L  +G W PF  DD+QLEF RIDPFVR  + RK GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +AYPYYASA SMM GL +FS VFL+ K +KEK++
Sbjct:   17 LLLAVLGCVCAS-GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSH------HRVGEMAPPNAYTVTDLVEYSIIIEQLS-NGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMK-EKEKSD 441          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Match: A0A1S3K3T6 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Lingula unguis OX=7574 GN=LOC106178335 PE=3 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 266/435 (61.15%), Postives = 339/435 (77.93%), Query Frame = 1
Query:   49 FLFVSLCVSS--CLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNS-PILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD-KEKNE 1341
            FL V  C+ S    G +TLVL++ ++ +ETHSIFF+SLRERG  LTF  ADD+SL L K+GE+LY N+++FAPSV EFGG +DV  +TNF+D GGNVLVAAS+ I + IRE GSECG+EFDEEKT VIDH NYD KDEGKHTLI++D  N+ +  ++VGK  S P+L+RGVG+ AD  NPL++N+LH SS AYSFNPD  + +YP++VGKNT L+ ALQARNNARV+FVGSLDFFSD+ FTA+V+HAV+ Q+H++S N+ +A+++S+WVFKE GVL+VG V H       ++    PP  YTIM+ V Y I I+E + +G W PF   DVQLEF RIDPFVR  +  KNGKF +DFKLPDVYGV++FLVDY+R+GYTH++S+TQVSVRPL HTQYERFI +A PYY SA SMM G+ +FS VFL++K+D K K E
Sbjct:   10 FLVVLACIFSVYATGKKTLVLVDNWSIRETHSIFFRSLRERGFDLTFKTADDASLALIKYGEFLYDNLVIFAPSVEEFGGSLDVTAITNFIDGGGNVLVAASSAITDPIRELGSECGVEFDEEKTAVIDHLNYDVKDEGKHTLIVTDPNNLLESELLVGKKTSVPMLYRGVGMVADVDNPLVLNVLHGSSTAYSFNPDDKVSEYPHAVGKNTLLIAALQARNNARVVFVGSLDFFSDEFFTASVQHAVTGQSHAQSANQQVATSLSQWVFKEKGVLKVGKVFHA------KKGEKSPPEAYTIMDQVTYSIEIEEYK-EGKWVPFDGKDVQLEFVRIDPFVRTFLKAKNGKFSVDFKLPDVYGVYQFLVDYNRIGYTHLFSTTQVSVRPLEHTQYERFISSANPYYFSAFSMMAGVFVFSIVFLHYKEDTKAKTE 437          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Match: A0A1S3JWQ2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Lingula unguis OX=7574 GN=LOC106176817 PE=3 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 266/435 (61.15%), Postives = 338/435 (77.70%), Query Frame = 1
Query:   49 FLFVSLCVSS--CLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNS-PILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD-KEKNE 1341
            FL V  C+ S    G +TLVL++ ++ +ETHSIFF+SLRERG  LTF  ADD+SL L K+GE+LY N+++FAPSV EFGG +DV  +TNF+D GGNVLVAAS+ I + IRE GSECG+EFDEEKT VIDH NYD KDEGKHTLI++D  N+ +  ++VGK  S P+L+RGVG+ AD  NPL++N+LH SS AYSFNPD  + +YP++VGKNT L+ ALQARNNARV+FVGSLDFFSD+ FTA+V+HAV+ Q+H++S N+ +A+++S+WVFKE GVL+VG V H       ++    PP  YTIM+ V Y I I+E +  G W PF   DVQLEF RIDPFVR  +  KNGKF +DFKLPDVYGV++FLVDY+R+GYTH++S+TQVSVRPL HTQYERFI +A PYY SA SMM G+ +FS VFL++K+D K K E
Sbjct:   10 FLVVLACIFSVYATGKKTLVLVDNWSIRETHSIFFRSLRERGFDLTFKTADDASLALIKYGEFLYDNLVIFAPSVEEFGGSLDVTAITNFIDGGGNVLVAASSAITDPIRELGSECGVEFDEEKTAVIDHLNYDVKDEGKHTLIVTDPNNLLESELLVGKKTSVPMLYRGVGMVADVDNPLVLNVLHGSSTAYSFNPDDKVSEYPHAVGKNTLLIAALQARNNARVVFVGSLDFFSDEFFTASVQHAVTGQSHAQSANQQVATSLSQWVFKEKGVLKVGKVFHA------KKGEKSPPEAYTIMDQVTYSIEIEEYK-GGKWVPFDGKDVQLEFVRIDPFVRTFLKAKNGKFSVDFKLPDVYGVYQFLVDYNRIGYTHLFSTTQVSVRPLEHTQYERFISSANPYYFSAFSMMAGVFVFSIVFLHYKEDTKAKTE 437          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Match: A0A210Q3Z9 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21802 PE=3 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 259/434 (59.68%), Postives = 332/434 (76.50%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVG-KVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD-KEKNE 1341
            + L  ++C S      TL+L++ ++ +ETHS+FFKSLR++G +LTF  ADD SL L KFGE+LY N+I+F+PSV EFGG +DVA +TNF+D GGNVLVA S+ IG+ +RE  +ECG+EFDEEK+ VIDH NYD  D+GKHTLI++D  N+   P+IVG K  SP+LFRGVG+ AD +NPL++N+LHASS AYSFNPD  I+DYP++VG +T LV ALQARNNARV+FVGSLDFFSD+ FT+ V HA++ +   +SGNE L+  +++WVFKE GVLRVG V H       ++  + PP  YT+ E+V Y I I+EL+  G WKPF   DVQLEF RIDPFVR  +  KNG F + FKLPDVYGV++F VDY+R+G+TH+YS+TQVSVRPL HTQYERFI +A+PYYASA SMM G+ +FS VFL+F D  KEK E
Sbjct:   11 LVLLAAIC-SVNANKRTLILVDNWSIRETHSVFFKSLRDQGFELTFKTADDGSLALVKFGEFLYDNLIIFSPSVEEFGGTMDVAAITNFIDGGGNVLVAGSSNIGDPLRELATECGLEFDEEKSTVIDHLNYDALDQGKHTLIVADPKNLLDAPMIVGTKATSPLLFRGVGMIADPENPLVLNVLHASSTAYSFNPDAKIEDYPHAVGSSTLLVAALQARNNARVMFVGSLDFFSDEFFTSAVHHAITNKKFEKSGNEQLSMNLAQWVFKEKGVLRVGTVKHN------KKGESQPPLAYTVFEEVEYSIGIEELK-GGQWKPFDHKDVQLEFVRIDPFVRTLLTSKNGLFGVTFKLPDVYGVYQFRVDYNRIGFTHLYSTTQVSVRPLEHTQYERFIPSAFPYYASAFSMMAGVFIFSLVFLHFNDSPKEKKE 436          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Match: R7UQJ1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_181863 PE=3 SV=1)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 259/434 (59.68%), Postives = 331/434 (76.27%), Query Frame = 1
Query:   46 IFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNS-PILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD-KEKNE 1341
            + + + L  S+    +TLVL++ ++ +ETHSIFF+SLR+ G  LTF  ADD SL L K+GE+LY N+I+F+PSV EFGG IDV  +TNF+D GGNV+VA S+ IGE IR+  SECG+EFDEE T VIDH NYD  D+GKHTL+++DA N+ K  ++VG  NS PILFRGVG+AAD QNPL++++LHASS AYSFNPD+ + +YP++VGKNT L+TALQARNNARVLF GSLD FSD+ F+ +V++A + +    SGN+ L  ++S+WVF+E GVLRVG V H L      +    PP  YTI +DV Y I I+E   +G W+PF ADDVQLEF RIDPFVR  +  KNGKF   FKLPDVYGV++F VDY+RVGYTH++S+TQVSVRPL HTQYERFI +AYPYY SA SMM G+ +FS VFL+FK++ K+K E
Sbjct:    6 LLIVLGLAASAFAAQKTLVLVDNWSIRETHSIFFRSLRDSGFDLTFKQADDGSLALVKYGEHLYDNLILFSPSVEEFGGSIDVQAITNFIDGGGNVMVAGSSLIGEPIRDLASECGVEFDEEGTSVIDHLNYDVSDQGKHTLLVADAANLIKSSMLVGDTNSAPILFRGVGMAADSQNPLLLSVLHASSTAYSFNPDEAVTEYPHAVGKNTLLITALQARNNARVLFFGSLDMFSDEFFSMSVQNANAGKQFPVSGNQQLVKSLSQWVFREKGVLRVGAVKHHL------QGKKTPPAAYTITDDVEYSIEIEEYS-EGKWQPFKADDVQLEFVRIDPFVRTFLKGKNGKFVAKFKLPDVYGVYQFRVDYNRVGYTHLFSTTQVSVRPLEHTQYERFIPSAYPYYFSAFSMMGGVFVFSLVFLHFKEETKDKTE 432          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Match: A0A0B7A8D1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF102626 PE=3 SV=1)

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 252/431 (58.47%), Postives = 330/431 (76.57%), Query Frame = 1
Query:   55 FVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVG-KVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD-KEKNE 1341
             +++C +S  G  TLVL++ ++ +ETHSIFF+SLR++G+ LTF  ADD+SL L K+GE+LY N+++F+PSV EFGG IDV+ +T+F+D GGN+LVAAS+ IG+ +RE  +ECG+EFDEE + VIDH NYD  D GKHTLI++DA N+ K P+IVG K  +P+LFRGVG+ +D  NPL+++LL ASS AYS+ PD+ ID++P +VG +T LV ALQARNNAR +FVGSLDFFSD  F A+V+ A   +   RS NEALA  +++W FK+ GVLRVG V+H L    E      PP+ YT+++ V Y I ++EL + G WK F A+DVQL+F RIDPFVR  +  K+GKF   FKLPDVYGV++F VDY+RVGYTH+YS+TQVSVRPL HTQYERFI +AYPYYASA SMM G+ L S VFL++KDD K+K E
Sbjct:   10 LLAICSASVPGKRTLVLVDNWSVRETHSIFFRSLRDQGYDLTFKTADDASLALVKYGEFLYDNLVLFSPSVEEFGGSIDVSAITSFIDGGGNILVAASSDIGDPVRELATECGVEFDEEGSAVIDHLNYDVADNGKHTLIVADADNLMKAPMIVGDKATAPVLFRGVGMVSDPDNPLVLSLLRASSTAYSYKPDEKIDEFPMAVGSSTLLVAALQARNNARAVFVGSLDFFSDQFFQASVQKANGGKKFERSNNEALAENLARWAFKDKGVLRVGKVAHHLQGEKE------PPQAYTVLQQVEYSIVLEEL-VAGEWKHFKAEDVQLDFVRIDPFVRTTLKAKDGKFSTSFKLPDVYGVYQFKVDYNRVGYTHLYSATQVSVRPLEHTQYERFILSAYPYYASAFSMMAGVFLLSIVFLHYKDDTKDKKE 433          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Cavefish
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:NCBI gene;Acc:103027807])

HSP 1 Score: 501.516 bits (1290), Expect = 1.053e-175
Identity = 247/419 (58.95%), Postives = 314/419 (74.94%), Query Frame = 1
Query:   91 ETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGK-VNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            +TLVLL+    ++THSIFF+SL +RG  LTF  ADD SL L K+G++LY ++I+F+P+V +FGG I+V T+T F+D GGNVLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK    PILF+GVG+ AD  NPL++++L  SS +YS+ PD+PI  YP++VGKNT L+  LQARNNARV+F GSL FFSD  F + V+ AV   +  S++GN+ LA A+S+WVFKE GVLRVG V+H     +       PP  YTI + V Y I I+ L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +A+PYYAS  SMM GL +FSFVFL+ K +KEK++
Sbjct:   48 KTLVLLDNPNIRDTHSIFFRSLADRGFDLTFKTADDPSLSLIKYGQFLYDHLIIFSPTVEDFGGNINVETITAFIDGGGNVLVAASSDIGDPLRELGSECGIEFDEEKTGVIDHHNYDVSDPGEHTLIVADPENLLKAPTIVGKPTEKPILFKGVGMVADPDNPLVLDILTGSSTSYSYFPDRPITQYPHAVGKNTLLIAGLQARNNARVVFSGSLHFFSDAFFNSAVQKAVPGSKRFSQTGNQDLAEALSRWVFKEAGVLRVGAVTHHPVGEST------PPAAYTITDLVEYSIVIEMLS-EGRWVPFDGDDIQLEFVRIDPFVRTYLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAFPYYASVFSMMAGLFVFSFVFLHMK-EKEKSD 458          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Cavefish
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:NCBI gene;Acc:103027807])

HSP 1 Score: 500.745 bits (1288), Expect = 2.060e-175
Identity = 247/419 (58.95%), Postives = 314/419 (74.94%), Query Frame = 1
Query:   91 ETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGK-VNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            +TLVLL+    ++THSIFF+SL +RG  LTF  ADD SL L K+G++LY ++I+F+P+V +FGG I+V T+T F+D GGNVLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVGK    PILF+GVG+ AD  NPL++++L  SS +YS+ PD+PI  YP++VGKNT L+  LQARNNARV+F GSL FFSD  F + V+ AV   +  S++GN+ LA A+S+WVFKE GVLRVG V+H     +       PP  YTI + V Y I I+ L  +G W PF  DD+QLEF RIDPFVR  + +  GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +A+PYYAS  SMM GL +FSFVFL+ K +KEK++
Sbjct:   40 KTLVLLDNPNIRDTHSIFFRSLADRGFDLTFKTADDPSLSLIKYGQFLYDHLIIFSPTVEDFGGNINVETITAFIDGGGNVLVAASSDIGDPLRELGSECGIEFDEEKTGVIDHHNYDVSDPGEHTLIVADPENLLKAPTIVGKPTEKPILFKGVGMVADPDNPLVLDILTGSSTSYSYFPDRPITQYPHAVGKNTLLIAGLQARNNARVVFSGSLHFFSDAFFNSAVQKAVPGSKRFSQTGNQDLAEALSRWVFKEAGVLRVGAVTHHPVGEST------PPAAYTITDLVEYSIVIEMLS-EGRWVPFDGDDIQLEFVRIDPFVRTYLKKNGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAFPYYASVFSMMAGLFVFSFVFLHMK-EKEKSD 450          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Sea Lamprey
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic) [Source:NCBI gene;Acc:406408])

HSP 1 Score: 481.871 bits (1239), Expect = 1.224e-168
Identity = 235/422 (55.69%), Postives = 314/422 (74.41%), Query Frame = 1
Query:   85 GIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVG-KVNSPILFR-GVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            G +TLVLL+  A K+THS+F  SL +RG +LT+  ADD SL L K+GE+LY ++I+F+PSV +FGG I+V T+T+F+D GGNVLVAAS+ IG+ IR+ GSECGIEFDEEKT VIDHH+YD  DEG+HTL+++DA N+ K+P++VG    +PILFR    + AD +N L++++L  SS  YSF PDKP+  YP++VGKNT L+  LQ RNNARV+F GSLDFFS+  F + V+ +    +  S++GNE LA A+S+WVFKE GVLRVG+  H      +      PP  YT+ + V + I I++L+ +G W P+   DVQLEF RIDPFVR  + R   ++   F LPDVYGVF+F +DY+R+GYTH+YS+TQVSVRPL HTQYERFI +AYPYYAS+ SMM+G+ LFS VFL+++ +KEK+E
Sbjct:   39 GGKTLVLLDNHAIKDTHSVFLSSLADRGFELTYKTADDPSLSLIKYGEFLYDHLIIFSPSVEDFGGNINVETITSFIDGGGNVLVAASSDIGDPIRDLGSECGIEFDEEKTAVIDHHSYDISDEGEHTLVVADADNLIKVPMVVGVPSGNPILFRIASSMVADPENALVLDILTGSSTTYSFFPDKPVTQYPHAVGKNTLLIAGLQGRNNARVIFSGSLDFFSNAAFNSPVQKSTPGSKRFSKAGNEELAIALSRWVFKEEGVLRVGDAKHHRVGEAD------PPAAYTVTDLVEFSIVIEKLE-EGKWVPYNGKDVQLEFVRIDPFVRTFLKRSGNRYSTQFTLPDVYGVFQFKIDYNRLGYTHLYSTTQVSVRPLQHTQYERFIPSAYPYYASSFSMMLGVFLFSLVFLHYR-EKEKSE 452          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Yeast
Match: WBP1 (Beta subunit of the oligosaccharyl transferase glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum; human homolog DDOST can complement yeast growth defect during down-regulation of yeast gene [Source:SGD;Acc:S000000728])

HSP 1 Score: 113.62 bits (283), Expect = 5.828e-28
Identity = 108/438 (24.66%), Postives = 195/438 (44.52%), Query Frame = 1
Query:   43 FIFLFVSLCVSSCLGIETLVLL-ETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFG--EYLYKNVIVF-APSVREFGGKIDVATLTNFVDDGGNVLVAAST-KIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQ--LVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNG----KFYL--DFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERF--IQAAYPYYASAISMMVGLVLFSFVFL 1311
            F  L  ++ V       TLVL  ++    E +S++ K L +R +KL +   + +S  ++ +   + L+ N+IVF     +    +I V  L  F ++ GN+L  +S   +   IR F +E GI +   K  VI  +     +E    L++S    + K  +   + +   +F     A  +    I+ +L+A   +++ +  K      NS    +Q  LV   Q  NNAR++++GS DF                +  ++  N+  A  + KW F E  V++  +  H  A     + ++     Y I + V Y +   E   +  W P IADD+Q E  ++DP+ R  +         ++Y   +F LPD +GVF FL DY ++G +        ++R L + +Y R   I  ++ Y ++   ++V  + F   F+
Sbjct:    9 FCILLQAIFVVGTQTSRTLVLYDQSTEPLEEYSVYLKDLEQRNYKLEYLDINSTSTTVDLYDKEQRLFDNIIVFPTKGGKNLARQIPVKQLIKFFENEGNILCMSSPGAVPNTIRLFLNELGI-YPSPKGHVIRDYFSPSSEE----LVVSSNHLLNKY-VYNARKSEDFVFGESSAALLENREQIVPILNAPRTSFTESKGKC-----NSWTSGSQGFLVVGFQNLNNARLVWIGSSDFL---------------KNKNQDSNQEFAKELLKWTFNEKSVIKSVHAVHSHA-----DGTSYDEEPYKIKDKVIYSVGFSEWNGE-EWLPHIADDIQFELRQVDPYYRLTLSPSGNDSETQYYTTGEFILPDRHGVFTFLTDYRKIGLSFTTDKDVKAIRHLANDEYPRSWEISNSWVYISAICGVIVAWIFFVVSFV 414          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Nematostella
Match: EDO40875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5W3])

HSP 1 Score: 472.241 bits (1214), Expect = 9.271e-165
Identity = 231/418 (55.26%), Postives = 312/418 (74.64%), Query Frame = 1
Query:   85 GIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGK-VNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHA-VSKQTHSRSGNEALASAISKWVFKETGVLRVGNVS-HKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLR-KNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDD 1326
            G  TLVLL+   TKETHSIFF SL+ +G++LTF  ADD+SL L K+GE+LY N+++F+PSV EFGG ++V  +T+F+D GGNVLVAAS+ IG+ +RE GSECG+EFDEEKT VIDH ++D  D  +HTL++++  N+ K   + GK V SP+LF+GVG+  D  NPL++ ++ ASS AYS+ PD  I +YP++VGK+T LV ALQARNNARV+F GSLDFFSD+ F  +V+ +    +   +SGN+ LA A++ WVFK+ GVLRVG V  HK+  +N       PP  YTI ++V Y I I+E+ +   W+P+ A DVQ+EF+RIDPF+R  + R ++G F   FKLPDVYGVF+F V+Y+RVGY+++ S TQVSVRP  HTQYERFI +AYPYYASA SMM+G+ +F+ VFL+ +DD
Sbjct:   27 GQRTLVLLDNANTKETHSIFFSSLKAKGYELTFRTADDASLALVKYGEFLYDNLVIFSPSVEEFGGSLNVRAITDFIDGGGNVLVAASSAIGDPLRELGSECGVEFDEEKTAVIDHISHDVSDLDQHTLVVAEPSNVIKADTVTGKTVTSPLLFKGVGMTTDVDNPLVLEVVTASSTAYSYYPDVKITEYPHAVGKSTVLVAALQARNNARVVFSGSLDFFSDEFFQRSVQSSKAGSKKFDKSGNQDLALAVTDWVFKQRGVLRVGEVKHHKVGEDN-------PPAAYTIEDNVFYSIQIEEM-IGNKWQPYQASDVQMEFFRIDPFIRTTLNRTRDGLFTAHFKLPDVYGVFQFKVEYNRVGYSYLSSKTQVSVRPKQHTQYERFIPSAYPYYASAFSMMLGVFVFAIVFLHHRDD 436          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Medaka
Match: ddost (dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit [Source:NCBI gene;Acc:101169166])

HSP 1 Score: 506.523 bits (1303), Expect = 1.810e-177
Identity = 246/419 (58.71%), Postives = 313/419 (74.70%), Query Frame = 1
Query:   91 ETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGK-VNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAV-SKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            +TLVLL+    ++THS+FF+SL +RG  LTF  ADD SL L K+G++LY ++++F+PSV +FGG I+V T+T+F+D GGNVLVAAS+ IG+ +RE GSECGIEFDEEKT VIDHHNYD  D G+HTLI++D  N+ K P IVG   + P+LF+GVG+ AD  NPL++++L  SS +YS+ PD+ +  YP++VGKNT L+  LQARNNARV+F GSLDFFSD  FT+ V+ A    Q H ++GN  LA A+S+WVFKE GVLRVG VSH       +     PP  YTI + V Y I ++ L   G W PF  DD+QLEF RIDPFVR  + RK GK+ + FKLPDVYGVF+F VDY+R+GYTH+YSSTQVSVRPL HTQYERFI +A+PYYASA SMM GL +FS VFL+ K +KEK +
Sbjct:   54 KTLVLLDNLNIRDTHSVFFRSLADRGFDLTFKTADDPSLSLIKYGQFLYDHLVLFSPSVEDFGGSINVETITSFIDGGGNVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDPGEHTLIVADPQNMLKAPTIVGTPTDKPVLFKGVGMVADPDNPLVLDILTGSSTSYSYFPDRAVSQYPHAVGKNTLLIAGLQARNNARVVFSGSLDFFSDAFFTSAVQKATPGSQRHEQTGNMELAMALSRWVFKEAGVLRVGAVSH------HRVGETTPPTAYTITDLVEYSIVVEMLS-GGRWVPFDGDDIQLEFVRIDPFVRTFLQRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLEHTQYERFIPSAFPYYASAFSMMAGLFVFSVVFLHMK-EKEKTD 464          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Planmine SMEST
Match: SMESG000010589.1 (SMESG000010589.1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 1
Query:   37 MKFIFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 1341
            MKFIFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE
Sbjct:    1 MKFIFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFHLADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVLVAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDAGNIAKIPIIVGKVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDKPIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVSKQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPREYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKNGKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFIQAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE 435          
The following BLAST results are available for this feature:
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DDOST0.000e+059.91dolichyl-diphosphooligosaccharide--protein glycosy... [more]
DDOST0.000e+059.91dolichyl-diphosphooligosaccharide--protein glycosy... [more]
DDOST0.000e+059.91dolichyl-diphosphooligosaccharide--protein glycosy... [more]
DDOST8.790e-4550.30dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ostb-11.687e-14248.85Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ostb-11.687e-14248.85Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ost487.886e-17656.75gene:FBgn0014868 transcript:FBtr0071344[more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddost9.960e-17556.81dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddost3.134e-16656.97dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ddost3.169e-16656.97dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ddost9.771e-16655.48dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ddost3.172e-16556.97dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ddost6.535e-14453.56dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ddost0.000e+059.45dolichyl-di-phosphooligosaccharide-protein glycotr... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R501|OST48_PONAB0.000e+059.72Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|A6QPY0|OST48_BOVIN0.000e+061.05Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P39656|OST48_HUMAN0.000e+059.91Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q641Y0|OST48_RAT0.000e+060.05Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|O54734|OST48_MOUSE0.000e+059.45Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K3T60.000e+061.15Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A1S3JWQ20.000e+061.15Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A210Q3Z90.000e+059.68Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
R7UQJ10.000e+059.68Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A0B7A8D10.000e+058.47Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ddost1.053e-17558.95dolichyl-diphosphooligosaccharide--protein glycosy... [more]
ddost2.060e-17558.95dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddost1.224e-16855.69dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
WBP15.828e-2824.66Beta subunit of the oligosaccharyl transferase gly... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO408759.271e-16555.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ddost1.810e-17758.71dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010589.10.000e+0100.00SMESG000010589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014525 ID=SMED30014525|Name=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1429bp
TTACACGTCTACTTATTTAGCAGAATTTTAATTTAGATGAAGTTTATATT
TCTTTTTGTCAGTTTGTGTGTTTCCTCATGTTTAGGAATAGAAACATTGG
TATTACTCGAGACCTTTGCTACCAAAGAAACACATTCTATATTTTTCAAA
TCTCTTCGAGAACGAGGACATAAATTAACTTTCCATTTGGCTGATGATTC
TTCACTAATTTTAAATAAATTTGGAGAATATTTGTATAAAAATGTCATTG
TATTCGCTCCTTCTGTAAGAGAATTCGGTGGTAAAATCGATGTTGCGACT
TTAACAAATTTTGTTGATGATGGTGGCAATGTTTTGGTTGCTGCCAGCAC
TAAAATAGGCGAAGCGATAAGAGAATTTGGTAGTGAATGTGGAATTGAAT
TTGACGAAGAAAAGACCGAAGTTATTGATCATCATAATTATGATAGAAAA
GATGAAGGAAAACACACATTGATTATATCCGATGCTGGAAATATCGCTAA
AATTCCGATAATAGTCGGGAAAGTAAATTCACCGATCCTATTTAGAGGTG
TCGGAATCGCAGCAGATGATCAAAATCCTTTGATAATCAATTTGCTCCAC
GCTTCCTCGAATGCGTATTCCTTCAATCCAGACAAGCCAATCGATGATTA
TCCCAACAGTGTCGGCAAAAACACTCAACTGGTTACCGCGTTGCAAGCAA
GAAACAACGCCAGAGTTCTCTTTGTTGGATCTCTGGATTTCTTTTCCGAT
GATTTGTTTACCGCAAATGTAGAGCACGCAGTCAGCAAGCAAACGCATTC
CCGCAGCGGCAACGAGGCGCTGGCTAGCGCAATCAGCAAATGGGTATTCA
AGGAAACCGGCGTGTTGCGAGTCGGCAATGTCAGCCATAAATTGGCAGCC
AATAACGAGCAGGAGGCCTCCAATCCGCCGCCACGTGAATATACAATCAT
GGAGGATGTCCACTATGAAATCGCCATTGACGAGTTGCAACTCGACGGAA
CCTGGAAACCGTTTATTGCCGATGATGTCCAATTGGAGTTCTATCGGATC
GATCCGTTTGTCCGCCAGAATATGCTCAGGAAAAATGGAAAATTCTATCT
CGATTTCAAGCTTCCTGACGTCTACGGCGTATTCAAGTTCCTGGTGGATT
ACCACCGGGTTGGCTATACTCACGTCTACAGCTCGACCCAGGTGTCTGTG
CGCCCGCTGATGCACACTCAGTACGAGCGCTTCATCCAGGCTGCATATCC
GTACTATGCCAGTGCCATTTCCATGATGGTCGGCCTCGTCCTGTTCAGCT
TCGTTTTCCTCTATTTCAAGGATGACAAGGAGAAAAACGAATAATTTTTA
CATGTTTTTATTTGCAATGTGTGTCTGTGTGTATGTATTGGAATAGTTGT
AATGAATTTCTATTGTTTTGAAAAAAAAA
back to top

protein sequence of SMED30014525-orf-1

>SMED30014525-orf-1 ID=SMED30014525-orf-1|Name=SMED30014525-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=436bp
MKFIFLFVSLCVSSCLGIETLVLLETFATKETHSIFFKSLRERGHKLTFH
LADDSSLILNKFGEYLYKNVIVFAPSVREFGGKIDVATLTNFVDDGGNVL
VAASTKIGEAIREFGSECGIEFDEEKTEVIDHHNYDRKDEGKHTLIISDA
GNIAKIPIIVGKVNSPILFRGVGIAADDQNPLIINLLHASSNAYSFNPDK
PIDDYPNSVGKNTQLVTALQARNNARVLFVGSLDFFSDDLFTANVEHAVS
KQTHSRSGNEALASAISKWVFKETGVLRVGNVSHKLAANNEQEASNPPPR
EYTIMEDVHYEIAIDELQLDGTWKPFIADDVQLEFYRIDPFVRQNMLRKN
GKFYLDFKLPDVYGVFKFLVDYHRVGYTHVYSSTQVSVRPLMHTQYERFI
QAAYPYYASAISMMVGLVLFSFVFLYFKDDKEKNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005013DDOST_48_kDa_subunit
Vocabulary: biological process
TermDefinition
GO:0018279protein N-linked glycosylation via asparagine
GO:0006486protein glycosylation
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0005783endoplasmic reticulum
GO:0008250oligosaccharyltransferase complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005013Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48kDa subunitPFAMPF03345DDOST_48kDcoord: 20..433
e-value: 4.3E-145
score: 483.7
IPR005013Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48kDa subunitPANTHERPTHR10830DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE 48 KDA SUBUNITcoord: 4..433
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..17
score: 0.695
NoneNo IPR availableTMHMMTMhelixcoord: 405..427