Caspase-1

Overview
NameCaspase-1
Smed IDSMED30014519
Length (bp)1635
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Caspase-1 (SMED30014519) t-SNE clustered cells

Violin plots show distribution of expression levels for Caspase-1 (SMED30014519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Caspase-1 (SMED30014519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Caspase-1 (SMED30014519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Caspase-1 vs. Ensembl Human
Match: CASP14 (caspase 14 [Source:HGNC Symbol;Acc:HGNC:1502])

HSP 1 Score: 68.9366 bits (167), Expect = 1.872e-12
Identity = 55/210 (26.19%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  836 EESSADLKNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKE---KVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE--FKGIYIEN--LIYNKPKIFIYQCCLGDKFNGKDPSN--DGDRDILL--DSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFR-DDRGSLYIQQLLNAIKK 1429
            EE   D+   ++ LI+          K+R G++ED+D +  +F  L ++  M ++    + +E   K  Q +D  ED        +M+HG +      DG++   E  F+ +  +N   +  KPK++I Q C G++   +DP     GD  +++  DS          P+  P   +    +ST+ GY ++R D +GS +IQ L++   K
Sbjct:    8 EEEKYDMSGARLALILCVT-------KAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQ---RDPGETVGGDEIVMVIKDS----------PQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTK 197          
BLAST of Caspase-1 vs. Ensembl Human
Match: CASP9 (caspase 9 [Source:HGNC Symbol;Acc:HGNC:1511])

HSP 1 Score: 70.0922 bits (170), Expect = 2.135e-12
Identity = 62/256 (24.22%), Postives = 122/256 (47.66%), Query Frame = 2
Query:  872 CLIVTYDEYENED-LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL--IYN---------KPKIFIYQCCLGD-KFNGKDPSNDGDRDILLDSPWRSGDSEIYP---ELR-----------PKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            CLI+    +  E  L++RTG+  D +++   F+ L++ +E+  +L   ++   + +   +   + +  V  I+SHG QA    + G V   +   + +E +  I+N         KPK+F  Q C G+ K +G + ++    D   +SP  + + +  P    LR           P   +IF ++ST PG+ S+RD + GS Y++ L +  ++    E  + Q  L   +    ++G + Q+P  ++ L + ++F
Sbjct:   80 CLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPED---ESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSE--DLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFF 330          
BLAST of Caspase-1 vs. Ensembl Human
Match: CASP3 (caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504])

HSP 1 Score: 68.5514 bits (166), Expect = 3.939e-12
Identity = 64/248 (25.81%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNL---KTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + ++  + SR+G   D   + E F  L Y++    +L   + +EL   VS++      SF   V  ++SHG +   +  +G V+  +    F+G    +L   KPK+FI Q C G + +    ++ G             D ++     P   +   A+ST PGY S+R+ + GS +IQ L   +K+           T+  R+   E +  SFD        QIP     LT+ +YF+
Sbjct:   46 LCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSF---VCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLT-GKPKLFIIQACRGTELDCGIETDSG------------VDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. Ensembl Human
Match: CASP3 (caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504])

HSP 1 Score: 68.5514 bits (166), Expect = 3.939e-12
Identity = 64/248 (25.81%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNL---KTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + ++  + SR+G   D   + E F  L Y++    +L   + +EL   VS++      SF   V  ++SHG +   +  +G V+  +    F+G    +L   KPK+FI Q C G + +    ++ G             D ++     P   +   A+ST PGY S+R+ + GS +IQ L   +K+           T+  R+   E +  SFD        QIP     LT+ +YF+
Sbjct:   46 LCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSF---VCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLT-GKPKLFIIQACRGTELDCGIETDSG------------VDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. Ensembl Human
Match: CASP9 (caspase 9 [Source:HGNC Symbol;Acc:HGNC:1511])

HSP 1 Score: 68.9366 bits (167), Expect = 7.613e-12
Identity = 62/256 (24.22%), Postives = 122/256 (47.66%), Query Frame = 2
Query:  872 CLIVTYDEYENED-LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL--IYN---------KPKIFIYQCCLGD-KFNGKDPSNDGDRDILLDSPWRSGDSEIYP---ELR-----------PKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            CLI+    +  E  L++RTG+  D +++   F+ L++ +E+  +L   ++   + +   +   + +  V  I+SHG QA    + G V   +   + +E +  I+N         KPK+F  Q C G+ K +G + ++    D   +SP  + + +  P    LR           P   +IF ++ST PG+ S+RD + GS Y++ L +  ++    E  + Q  L   +    ++G + Q+P  ++ L + ++F
Sbjct:  163 CLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPED---ESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSE--DLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFF 413          
BLAST of Caspase-1 vs. Ensembl Celegans
Match: csp-1 (Caspase A Caspase A subunit p16 Caspase A subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:G5EBM1])

HSP 1 Score: 58.151 bits (139), Expect = 3.893e-9
Identity = 56/200 (28.00%), Postives = 93/200 (46.50%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAG--FYTYDGQVNFYEFKG--IYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDG-----DRDILLDSPWRSGDSEIYP-ELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKK 1429
            R   LI++ + ++N  ++ R G ++D   + ++F  L Y +   +NL+   + E + ++  E+  +  II+ F++SHG  AG  F   D  VN  E      Y +NL+  KPK      C G K N   P  DG     D+   +   W    S I P        ++  +FST  G+ S+RD+  G+ YI+ +     K
Sbjct:   24 RGTVLILSNENFKN--MERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAI-KEFAEMAHTDSIIL-FLLSHGDGAGSVFGIDDMPVNVMEVSTYLAYHQNLLL-KPKWVAVSACRGGKLNMGVPV-DGLPALEDKCAPISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNK 217          
BLAST of Caspase-1 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 56.9954 bits (136), Expect = 8.879e-9
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQ-VNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDS--PWRSGDSEIYPELRPKC--CNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAI 1423
            ++ R G+ +D  ++ ++F  L Y+   + NLK+ E+ E V Q   +      +I+T IMSHG Q   Y  DG  V   +   +     +  KPK  +  CC GD+ + +    DG  D   D    +       +P  +      ++  +FST PG+ SFRD+ +G+ YIQ+L   I
Sbjct:   39 MEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQ-FTQSNHGDSLIIT-IMSHGDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRID-RAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVI 212          
BLAST of Caspase-1 vs. Ensembl Celegans
Match: csp-1 (Caspase A Caspase A subunit p16 Caspase A subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:G5EBM1])

HSP 1 Score: 56.9954 bits (136), Expect = 2.570e-8
Identity = 56/200 (28.00%), Postives = 93/200 (46.50%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAG--FYTYDGQVNFYEFKG--IYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDG-----DRDILLDSPWRSGDSEIYP-ELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKK 1429
            R   LI++ + ++N  ++ R G ++D   + ++F  L Y +   +NL+   + E + ++  E+  +  II+ F++SHG  AG  F   D  VN  E      Y +NL+  KPK      C G K N   P  DG     D+   +   W    S I P        ++  +FST  G+ S+RD+  G+ YI+ +     K
Sbjct:  292 RGTVLILSNENFKN--MERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAI-KEFAEMAHTDSIIL-FLLSHGDGAGSVFGIDDMPVNVMEVSTYLAYHQNLLL-KPKWVAVSACRGGKLNMGVPV-DGLPALEDKCAPISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNK 485          
BLAST of Caspase-1 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 56.225 bits (134), Expect = 4.404e-8
Identity = 52/186 (27.96%), Postives = 84/186 (45.16%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDG-QVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYP-------------ELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAI 1423
            ++ R G+ +D  ++ ++F  L Y+   + NLK+ E+ E V Q   +      +I+T IMSHG Q   Y  DG  V   +   +     +  KPK  +  CC GD+ + +    DG  D   D          +P             +      ++  +FST PG+ SFRD+ +G+ YIQ+L   I
Sbjct:  602 MEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQ-FTQSNHGDSLIIT-IMSHGDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRID-RAVRCDGFIDNFFDR---------FPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVI 775          
BLAST of Caspase-1 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 56.225 bits (134), Expect = 5.252e-8
Identity = 52/186 (27.96%), Postives = 84/186 (45.16%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDG-QVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYP-------------ELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAI 1423
            ++ R G+ +D  ++ ++F  L Y+   + NLK+ E+ E V Q   +      +I+T IMSHG Q   Y  DG  V   +   +     +  KPK  +  CC GD+ + +    DG  D   D          +P             +      ++  +FST PG+ SFRD+ +G+ YIQ+L   I
Sbjct:  503 MEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQ-FTQSNHGDSLIIT-IMSHGDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRID-RAVRCDGFIDNFFDR---------FPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVI 676          
BLAST of Caspase-1 vs. Ensembl Fly
Match: Drice (gene:FBgn0019972 transcript:FBtr0085482)

HSP 1 Score: 79.7221 bits (195), Expect = 6.268e-16
Identity = 51/189 (26.98%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  857 KNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN---LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQL 1411
            KNR M LI  ++ +E   LKSR G   D + +  V   L++++ ++K+ +  ++   +     +     + I+  I+SHG     Y  D Q         +  N    +  KPK+F  Q C GD+        DG   +        GDS +  ++ P   +   A+ST+PG+ S+R+  RGS ++Q L
Sbjct:   91 KNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRL-------DGGVTMQRSQTETDGDSSMSYKI-PVHADFLIAYSTVPGFYSWRNTTRGSWFMQSL 271          
BLAST of Caspase-1 vs. Ensembl Fly
Match: Dcp-1 (gene:FBgn0010501 transcript:FBtr0072062)

HSP 1 Score: 75.0998 bits (183), Expect = 2.026e-14
Identity = 53/201 (26.37%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  857 KNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVN----FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELR-PKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKKDPTK 1441
            K+R + LI  ++ ++   LKSRTG   D   + + F  L + + + K+ K  ++ + V +  +      + +   I+SHG     Y  D Q      ++ F   +  +L   KPK+F  Q C GD+ +G          I L+      D E     + P   +   ++STIPGY S+R+ + GS Y+Q L+  +  +  K
Sbjct:   76 KHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLA-GKPKLFFIQACQGDRLDG---------GITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKK 266          
BLAST of Caspase-1 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0340083)

HSP 1 Score: 72.0182 bits (175), Expect = 3.708e-13
Identity = 55/187 (29.41%), Postives = 85/187 (45.45%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDE--IEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL------IYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKE 1444
            L+ R G   D +R+ EVF+ + Y +E + N+  + + E++    D   + DS   +V FI+SHGF+   Y      N    K   IE+L      +Y KPK+ I Q C     + K P+     D+   SP    D  I         ++  A ST+ GY + R  + GS +I  L +AI +    E
Sbjct:  232 LRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS---LVVFILSHGFEEAVYAS----NSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSP----DQHI---------DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASE 398          
BLAST of Caspase-1 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0114559)

HSP 1 Score: 71.633 bits (174), Expect = 6.104e-13
Identity = 55/187 (29.41%), Postives = 85/187 (45.45%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDE--IEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL------IYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKE 1444
            L+ R G   D +R+ EVF+ + Y +E + N+  + + E++    D   + DS   +V FI+SHGF+   Y      N    K   IE+L      +Y KPK+ I Q C     + K P+     D+   SP    D  I         ++  A ST+ GY + R  + GS +I  L +AI +    E
Sbjct:  280 LRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS---LVVFILSHGFEEAVYAS----NSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSP----DQHI---------DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASE 446          
BLAST of Caspase-1 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0114560)

HSP 1 Score: 71.633 bits (174), Expect = 6.147e-13
Identity = 55/187 (29.41%), Postives = 85/187 (45.45%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDE--IEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL------IYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKE 1444
            L+ R G   D +R+ EVF+ + Y +E + N+  + + E++    D   + DS   +V FI+SHGF+   Y      N    K   IE+L      +Y KPK+ I Q C     + K P+     D+   SP    D  I         ++  A ST+ GY + R  + GS +I  L +AI +    E
Sbjct:  286 LRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS---LVVFILSHGFEEAVYAS----NSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSP----DQHI---------DMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASE 452          
BLAST of Caspase-1 vs. Ensembl Zebrafish
Match: casp6a (caspase 6, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-030825-4])

HSP 1 Score: 72.7886 bits (177), Expect = 1.289e-13
Identity = 62/214 (28.97%), Postives = 98/214 (45.79%), Query Frame = 2
Query:  821 VFSTEEESSADL--KNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSG---DSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK 1429
            +FS +     D+  K R M LI  ++ +     L  R+G   D + +   F  LN++++ F + K  E+  K+++         +  V   +SHG     Y  DGQ+   E    FKG    +L+  KPKIFI+Q C GDK +  DP    D   ++DS   +    D+ +   L P   +    +S   GY S R+   GS YIQ L   +++
Sbjct:   38 IFSMDPNQEYDMNHKRRGMALIFNHENFFWKLGLGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCFVCVFLSHGENGHVYANDGQIEIPEITDLFKGDKCRSLV-GKPKIFIWQACRGDKHD--DPVTPMD---VVDSQVTNDMVVDAGVLYTL-PAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRR 244          
BLAST of Caspase-1 vs. Ensembl Zebrafish
Match: casp6a (caspase 6, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-030825-4])

HSP 1 Score: 72.4034 bits (176), Expect = 1.440e-13
Identity = 62/214 (28.97%), Postives = 98/214 (45.79%), Query Frame = 2
Query:  821 VFSTEEESSADL--KNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSG---DSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK 1429
            +FS +     D+  K R M LI  ++ +     L  R+G   D + +   F  LN++++ F + K  E+  K+++         +  V   +SHG     Y  DGQ+   E    FKG    +L+  KPKIFI+Q C GDK +  DP    D   ++DS   +    D+ +   L P   +    +S   GY S R+   GS YIQ L   +++
Sbjct:   38 IFSMDPNQEYDMNHKRRGMALIFNHENFFWKLGLGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVDADCFVCVFLSHGENGHVYANDGQIEIPEITDLFKGDKCRSLV-GKPKIFIWQACRGDKHD--DPVTPMD---VVDSQVTNDMVVDAGVLYTL-PAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRR 244          
BLAST of Caspase-1 vs. Ensembl Zebrafish
Match: CU467905.1 (caspase 17, apoptosis-related cysteine peptidase [Source:NCBI gene;Acc:101886133])

HSP 1 Score: 71.633 bits (174), Expect = 2.434e-13
Identity = 64/242 (26.45%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  854 LKNRKMCLIVTYDE-YENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQ-VNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKD--PTKEIREYQKELQER-----SFDEPIEGTHFQIPSSYDCLTRNVY 1552
            +KNR   LIV+ +  Y +  L++R GA++D  R++++   L + +++  +++  E+ E   Q+ ++     E  V  I SHG +   +  DG+ VN  E    +   ++ +K K+F+ Q C G          DG   +  DS   S + +I  EL     +    ++T PGY +F    GS+ IQ L + ++ D  P  EI +    L  +          I G   Q+P      TR V+
Sbjct:   15 MKNR--ALIVSVENFYPDALLRNRPGAKKDTQRLHKILMKLGFSVDIRVDMEAGEIIEAFKQESEQTVK--ECFVGIISSHGEEGVVFGCDGRAVNLAEIYSCFRSPIMKDKSKLFLIQACRGGDL-------DGGVQVETDSSS-SEEQDILSELLSIPIDTAVTYATSPGYAAFMHPLGSVLIQTLCDLLESDGGPDLEITKLLTRLNHQVAYNFQARGKILGGKKQMPCFVTRFTREVF 244          
BLAST of Caspase-1 vs. Ensembl Zebrafish
Match: casp6b.2 (caspase 6b.2, apoptosis-related cysteine peptidase [Source:ZFIN;Acc:ZDB-GENE-060312-12])

HSP 1 Score: 70.8626 bits (172), Expect = 2.935e-13
Identity = 67/252 (26.59%), Postives = 115/252 (45.63%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEI----IVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDP-----SNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK-----DPTKEIREYQKELQERSFDEPIEGTHF-QIPSSYDCLTRNVYFH 1558
            R M LI    ++    LK+R G  +D D +   F  L+++++ + +      ++KV +++ E+  +  +     V   +SHG     Y  D ++   E    FKG    +L+  KPKIFI+Q C GDK +  DP     + D D ++ +D    +G S   P       +    +ST  G+ SFRD   GS YIQ L   + +     + T  +    +++  RS  + +  T   Q+P     LT+ ++F 
Sbjct:    6 RGMALIFNQKDFSLLGLKTRKGTDKDRDSLVSRFEELDFEVKAYNDYS----RDKVLREIKEVAAADHVDADCFVCIFLSHGEDGHVYARDKKIKIPEITDLFKGDKCRSLV-GKPKIFIWQACRGDKKD--DPVAPMSAEDSDDEMAVD----AGVSNTLPA----GADFIMCYSTTEGFCSFRDPLNGSWYIQDLCEIMGRYRSQLEFTNILTLVNRKVSLRSICDDLSATGTKQMPCFASMLTKRLFFR 242          
BLAST of Caspase-1 vs. Ensembl Zebrafish
Match: casp9 (caspase 9, apoptosis-related cysteine peptidase [Source:ZFIN;Acc:ZDB-GENE-030825-5])

HSP 1 Score: 71.2478 bits (173), Expect = 1.078e-12
Identity = 80/349 (22.92%), Postives = 147/349 (42.12%), Query Frame = 2
Query:  641 FPVKELSFSLKKEKIDL---RMLTIKCEEF--QKFYIP--ETFNKNIQERKMKEIDCQLTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYEN-EDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL-----------IYNKPKIFIYQCCLGDK--------FNGKDPSNDGDRDILLDSPW--------RSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQL-----LNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHKN 1564
             PV+ L+ + K +K D+   R++ ++ E     K Y P  ET  +  + R+   I C   +     V                 CLI+    +E   +L  R G+  D D++ + F  LN+++ + +NLK+  ++ +++    +   +++  V  I+SHG +A    + G V+  +   + I+ +           +  KPK+F  Q C G +         +   PS  G  D +   P          + D        P   +I  ++ST PGY S+RD + GS Y++ L      NAI  D    +      + + S     +G + Q+P S++ L + +YF  +
Sbjct:  108 LPVQNLNHTEKPDKPDIASPRLVPLRPESLPVHKTYSPPSETVVRPTRPRR-DSIQCYKMDASPCGV-----------------CLIINNINFEKASELNDRKGSNIDCDKLEKRFKALNFEVTVKRNLKSKRIRHEMASLAKKDHSTYDCCVVIILSHGTEASHNRFPGAVHGVDGPAVPIQIITNYLNGQNCPSLQGKPKLFFIQACGGGEKDIGFEVSPDDVQPSIGGIDDEMDAIPMSSSSDSLSTASDELDARASLPTPSDILVSYSTFPGYVSWRDTEAGSWYVENLDRVLEENAITDDLVTMLMLVNDAVSQIS----AKGLYKQMPGSFNFLRKLLYFQSS 434          
BLAST of Caspase-1 vs. Ensembl Xenopus
Match: calb2 (calbindin 2 [Source:Xenbase;Acc:XB-GENE-960001])

HSP 1 Score: 79.337 bits (194), Expect = 1.034e-15
Identity = 65/247 (26.32%), Postives = 111/247 (44.94%), Query Frame = 2
Query:  857 KNRKMCLIVTYDE-YENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDP-----TKEIREYQKELQERSF---DEPIEGTHFQIPSSYDCLTRNVYF 1555
            K R + LI  +++ Y    L SR G   D   +  + T L + ++ + NL+TL++ EK+ +       + +  +   +SHG     Y+YD  ++  E    FKG   E+L+  KPKIFI+Q C G+K +      D    + L +      + +Y    P   +    +S   GY S R+   GS YIQ L   +K        T+ +    +++ +RS    ++P      QIP     LT+ ++ 
Sbjct:   56 KRRGLALIFNHEDFYWQLRLGSRRGTNTDSMNLNRILTDLGFDVQNYYNLRTLDILEKIQEASTADHSNADCFLCVFLSHGEDRHIYSYDSLIDIQELTNSFKGDKCESLV-GKPKIFIFQACRGEKHDNPVLPTDETDSVTLTNITEVDAASLYT--LPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEVLKAHAASLEFTEILTLVNRKVSQRSVAFCNDPKAIGKKQIPCFSSMLTKKLFL 299          
BLAST of Caspase-1 vs. Ensembl Xenopus
Match: casp3.2 (caspase 3, gene 2 [Source:NCBI gene;Acc:100151728])

HSP 1 Score: 68.9366 bits (167), Expect = 2.526e-12
Identity = 62/210 (29.52%), Postives = 97/210 (46.19%), Query Frame = 2
Query:  824 FSTEEESSADLKNRKMCLIVTYDEYENE-DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKT---LELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIK 1426
            F+   +   D     +CLI+    +++  ++  R G   D  +++E FT L YK+++  + K+     L +K+S++      SF   V  I+SHG     Y  DG +        F+G   + L+  KPK+F  Q C G          D D  I  DS    G+ EI  +  P   +   A+ST+PGY S+R+   GS +IQ L   IK
Sbjct:   42 FAHLHKYRTDYPEMGICLIINNKNFQSSTNMGVRNGTDVDARKLHETFTGLGYKVKVCNDQKSNDIFTLLKKMSEEDHSKRSSF---VCAILSHGEDGLVYGVDGPIQIKNLTDLFRGDRCKTLV-GKPKLFFIQACRG---------TDLDSGIETDSGSEPGE-EI--QRIPVEADFLYAYSTVPGYYSWRNTMNGSWFIQSLCEMIK 235          
BLAST of Caspase-1 vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:Xenbase;Acc:XB-GENE-980812])

HSP 1 Score: 65.855 bits (159), Expect = 6.836e-11
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQ-KLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL----IYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRS--GDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK 1429
            R   LI++   +E +DL  R G + DV  + ++F+ L +++E+ +NL    +  ++          + +  V  ++SHG     Y  DG++   +     ++N     + NKPK+F  Q C G++ +      DG          +S  G  +I   L P   ++  A++ + G  S R+  RGS ++Q L++   +
Sbjct:  160 RGRALIISNVAFETQDLDHRYGGEVDVTSLEKLFSSLGFQVEVRRNLNAQNMMSQLGAFSALPAHSALDSCVVAVLSHGLDGAVYGTDGKLVQLQDVFTAMDNAHCPQLQNKPKMFFIQACRGEEADRGVDQRDGREQSASPGCEQSDAGREDIKVRL-PTQSDMICAYACLKGTVSLRNTKRGSWFVQDLVSVFSQ 355          
BLAST of Caspase-1 vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:Xenbase;Acc:XB-GENE-980812])

HSP 1 Score: 65.855 bits (159), Expect = 6.879e-11
Identity = 47/197 (23.86%), Postives = 91/197 (46.19%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQ-KLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL----IYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRS--GDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK 1429
            R   LI++   +E +DL  R G + DV  + ++F+ L +++E+ +NL    +  ++          + +  V  ++SHG     Y  DG++   +     ++N     + NKPK+F  Q C G++ +      DG          +S  G  +I   L P   ++  A++ + G  S R+  RGS ++Q L++   +
Sbjct:  169 RGRALIISNVAFETQDLDHRYGGEVDVTSLEKLFSSLGFQVEVRRNLNAQNMMSQLGAFSALPAHSALDSCVVAVLSHGLDGAVYGTDGKLVQLQDVFTAMDNAHCPQLQNKPKMFFIQACRGEEADRGVDQRDGREQSASPGCEQSDAGREDIKVRL-PTQSDMICAYACLKGTVSLRNTKRGSWFVQDLVSVFSQ 364          
BLAST of Caspase-1 vs. Ensembl Xenopus
Match: lrrc38 (leucine rich repeat containing 38 [Source:Xenbase;Acc:XB-GENE-955337])

HSP 1 Score: 62.7734 bits (151), Expect = 3.718e-10
Identity = 60/252 (23.81%), Postives = 98/252 (38.89%), Query Frame = 2
Query:  872 CLIVTYDEYEN-EDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFN-----GKDPSNDGDRDILLDSPWRSGDSEIYPELR-PKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKKDPTKEIREYQKELQ----------------ERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            C+I+    +++   +  R G   D   +   F  L + + +F N    E++  +    ++            +SHG +   Y  DG +             I  KPK+F  Q C G +F+        PSND            S +++  P  + P   +   A+ST+PGY S+R+  RGS ++Q L N         + E+ KEL+                E   D+P      QIP     LT+ +YF
Sbjct:   72 CIIINNKNFDDITGMSPRNGTDIDARDLLRCFKGLGFDVTVFNNKSCTEMETLLRSVAEQDHKDSACFACIFLSHGEEGLIYGTDGAMP------------IKGKPKLFFIQACRGCEFDDGLETDAGPSND------------SLETDANPRHKIPVEADFLYAYSTVPGYYSWRNPGRGSWFVQALCNV--------LNEHGKELEVMQILTRVNYLVATQFESYCDDPQFNKKKQIPCVVSMLTKELYF 291          
BLAST of Caspase-1 vs. Ensembl Mouse
Match: Casp3 (caspase 3 [Source:MGI Symbol;Acc:MGI:107739])

HSP 1 Score: 75.485 bits (184), Expect = 1.122e-14
Identity = 68/248 (27.42%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLK---TLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + ++  + SR+G   D   + E F  L Y++    +L     LEL + VS++      SF   V  I+SHG +   Y  +G V   +    F+G Y  +L   KPK+FI Q C G + +    ++ G             D E+  +  P   +   A+ST PGY S+R+ + GS +IQ L + +K            T+  R+   E +  S D        QIP     LT+ +YF+
Sbjct:   46 ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSF---VCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLT-GKPKLFIIQACRGTELDCGIETDSGT------------DEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. Ensembl Mouse
Match: Casp3 (caspase 3 [Source:MGI Symbol;Acc:MGI:107739])

HSP 1 Score: 75.485 bits (184), Expect = 1.122e-14
Identity = 68/248 (27.42%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLK---TLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + ++  + SR+G   D   + E F  L Y++    +L     LEL + VS++      SF   V  I+SHG +   Y  +G V   +    F+G Y  +L   KPK+FI Q C G + +    ++ G             D E+  +  P   +   A+ST PGY S+R+ + GS +IQ L + +K            T+  R+   E +  S D        QIP     LT+ +YF+
Sbjct:   46 ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSF---VCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLT-GKPKLFIIQACRGTELDCGIETDSGT------------DEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. Ensembl Mouse
Match: Casp9 (caspase 9 [Source:MGI Symbol;Acc:MGI:1277950])

HSP 1 Score: 69.707 bits (169), Expect = 3.281e-12
Identity = 65/253 (25.69%), Postives = 115/253 (45.45%), Query Frame = 2
Query:  872 CLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL--IYN---------KPKIFIYQCCLGD-KFNGKDPSNDGDRDILLDS-------PWRSG----DSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            CLI+    +  +  L +RTG+  D D++   F  L + +E+  +L   ++   + +       + +  V  I+SHG QA    + G V   +   + IE +  I+N         KPK+F  Q C G+ K +G + +    +   LDS       P++ G    D        P   +I  ++ST PG+ S+RD + GS YI+ L   +++    E  + Q  L   +     +GT+ QIP  ++ L + ++F
Sbjct:  201 CLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSE--DLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFF 451          
BLAST of Caspase-1 vs. Ensembl Mouse
Match: Casp6 (caspase 6 [Source:MGI Symbol;Acc:MGI:1312921])

HSP 1 Score: 66.6254 bits (161), Expect = 1.023e-11
Identity = 65/266 (24.44%), Postives = 112/266 (42.11%), Query Frame = 2
Query:  821 VFSTEEESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDK-------FNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK-----DPTKEIREYQKELQERSFD---EPIEGTHFQIPSSYDCLTRNVYF 1555
            VF   E+   D K R + LI  ++ +  +  L  R G   D D +   F+ L ++++ F +L+  EL  K+ +         +  +   +SHG     Y YD ++        FKG   ++L+  KPKIFI Q C G +        +  D   D      LD+  +   + +Y    P   +    +S   GY S R+   GS YIQ L   + +     + T+ +    +++ +R  D   +P      Q+P     LT+ ++F
Sbjct:   13 VFDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRRFSDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDAKIEIQTLTGLFKGDKCQSLV-GKPKIFIIQACRGSQHDVPVVPLDMVDHQTDK-----LDNVTQVDAASVYT--LPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQRRVDFCKDPDAIGKKQVPCFASMLTKKLHF 270          
BLAST of Caspase-1 vs. Ensembl Mouse
Match: Casp7 (caspase 7 [Source:MGI Symbol;Acc:MGI:109383])

HSP 1 Score: 60.8474 bits (146), Expect = 1.137e-9
Identity = 57/253 (22.53%), Postives = 110/253 (43.48%), Query Frame = 2
Query:  851 DLKNRKMCLIVTYDEYENE-DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQL---LNAIKKDPTKEIREYQKELQER-------SFDEPIEGTHFQIPSSYDCLTRNVYFHK 1561
            D +    C+I+    ++    +  R G  +D   +++ F  L +++ +  +    ++++ + +  +E   +       ++SHG +   Y  DG     +    F+G   + L+  KPK+F  Q C G + +    ++ G        P    D+    ++ P   +   A+ST+PGY S+R+  +GS ++Q L   LN   KD   EI +    + +R         D+P      QIP     LT+ +YF +
Sbjct:   63 DFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLL-EKPKLFFIQACRGTELDDGIQADSG--------PINDIDANPRNKI-PVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKD--LEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR 303          
BLAST of Caspase-1 vs. UniProt/SwissProt
Match: sp|P89116|CASP1_SPOFR (Caspase-1 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.466e-17
Identity = 63/249 (25.30%), Postives = 110/249 (44.18%), Query Frame = 2
Query:  857 KNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVN----FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKKDPTKE---------IREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHK 1561
            K+R M +I  ++ ++   LKSRTG   D D + +V   L +K+ +F NLK+ E+ + + Q  +      + ++  +++HG     Y  D        +Y F       L   KPK+F  Q C GD+ +G    +  + D    + +R           P   +   AFST+PGY S+R+  RGS ++Q L   ++   T+           ++   + +  + D  +     Q+P     LTR + F K
Sbjct:   58 KHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLA-GKPKLFFIQACQGDRLDGGITLSRTETDGSPSTSYRI----------PVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK 295          
BLAST of Caspase-1 vs. UniProt/SwissProt
Match: sp|Q08DY9|CASP3_BOVIN (Caspase-3 OS=Bos taurus OX=9913 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.120e-15
Identity = 68/258 (26.36%), Postives = 110/258 (42.64%), Query Frame = 2
Query:  827 STEEESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            S EE    D     +C+I+    + EN  +  R+G   D   + E F  L Y++ +  +L   E+ E +S    E        +  ++SHG +   +  +G VN  +    F+G Y  +L   KPK+FI Q C G + +    ++ G  D            ++  +  P   +   A+ST PGY S+R+ + GS +IQ L   +KK           T+  R+   E +  S D        QIP     LT+ +YF
Sbjct:   32 SLEESYKMDYPEMGLCIIINNKNFHENTGMACRSGTDVDAANLRETFMNLKYEVRIKNDLTCKEMLELMSNVSKEDHSKRSSFICVLLSHGEEGIIFGTNGPVNLKKLASFFRGDYCRSLT-GKPKLFIIQACRGTELDCGIETDSGAED------------DMACQKIPVEADFLYAYSTAPGYFSWRNAKNGSWFIQALCEMLKKHAHRLELMHILTRVNRKVAIEYESFSTDSAFHAKK-QIPCIMSMLTKELYF 275          
BLAST of Caspase-1 vs. UniProt/SwissProt
Match: sp|O01382|DRICE_DROME (Caspase OS=Drosophila melanogaster OX=7227 GN=Drice PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 6.283e-15
Identity = 51/189 (26.98%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  857 KNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN---LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQL 1411
            KNR M LI  ++ +E   LKSR G   D + +  V   L++++ ++K+ +  ++   +     +     + I+  I+SHG     Y  D Q         +  N    +  KPK+F  Q C GD+        DG   +        GDS +  ++ P   +   A+ST+PG+ S+R+  RGS ++Q L
Sbjct:   91 KNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRL-------DGGVTMQRSQTETDGDSSMSYKI-PVHADFLIAYSTVPGFYSWRNTTRGSWFMQSL 271          
BLAST of Caspase-1 vs. UniProt/SwissProt
Match: sp|Q8MJU1|CASP3_FELCA (Caspase-3 OS=Felis catus OX=9685 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 5.557e-14
Identity = 66/248 (26.61%), Postives = 113/248 (45.56%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNL---KTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + E+  + SR+G   D   + E FT L Y++    +L   + + L + VS++      SF   +  ++SHG +   Y  +G V+  +    F+G Y  +L   KPK+FI Q C G + +    ++ G  D            +I  +  P   +   A+ST PGY S+R+ + GS +IQ L + ++            T+  R+   E +  S D    G   QIP     LT+ +YF+
Sbjct:   46 LCIIINNKNFHESTGMPSRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIVALLDSVSREDHSKRSSF---ICVLLSHGEEGIIYGTNGPVDLKKLTGFFRGDYCRSLT-GKPKLFIIQACRGTELDCGIETDSGTED------------DIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHELEFMHILTRVNRKVATEFESFSLDSAFHGKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. UniProt/SwissProt
Match: sp|P70677|CASP3_MOUSE (Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.849e-14
Identity = 68/248 (27.42%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  869 MCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLK---TLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDP---------TKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            +C+I+    + ++  + SR+G   D   + E F  L Y++    +L     LEL + VS++      SF   V  I+SHG +   Y  +G V   +    F+G Y  +L   KPK+FI Q C G + +    ++ G             D E+  +  P   +   A+ST PGY S+R+ + GS +IQ L + +K            T+  R+   E +  S D        QIP     LT+ +YF+
Sbjct:   46 ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSF---VCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLT-GKPKLFIIQACRGTELDCGIETDSGT------------DEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKK-QIPCIVSMLTKELYFY 276          
BLAST of Caspase-1 vs. TrEMBL
Match: A0A4Y6I2B1 (Caspase-1 OS=Dugesia japonica OX=6161 GN=cas-1 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.330e-52
Identity = 158/493 (32.05%), Postives = 256/493 (51.93%), Query Frame = 2
Query:  137 IKFQEHHLNQVSVIHIWDPINESLHNKLELVLELVSDDKLESKPLIYKDTVVFEIKN--LEVKLDFIGIRFLVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFEISPEILVSGVKKSNNNG---IITLKHYIPYFPFEIQV-FSPTNKKFMPRNLGGFPVKELSFSL-KKEKIDLRMLTIKCEEFQKFYIPETFNKNIQERKMKEIDCQL-------TEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYENEDLKSR-TGAQEDVDRIYEVFT-PLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIE---NLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKDPTKEIREYQKELQER-SFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            I+F++  +N    I +  P  +  H+KL+LVL       + ++ +I+   ++F I    L++ LDF GI+F  D  +  D   +Y+ +TARL ++  D     + +  S I+RNKN   F++S +I +  +K+   +    I+ L   +PYFP E+ +     +   +P    GFP+ +L  S+ +K K  L    I C+ FQK  IP    K I++    EI  +        TE   TN     +E        ++MCL++    +++E +KSR   ++ ++  I  VF+  LNY + +FKNL T ELK+K++ KLD  E+  + IV F+ SHG    F+T DG + + +F  +++      I +KPK+F   CCLG K N  D S    + I  ++     +   Y  L P+  NIF  FST+P Y SFR +  + YIQ LL+ I+++PT E+R  Q   Q R ++ E +      IPS + CL R+V+F
Sbjct:   78 IEFKKEDINNNVSIELIKPDKDEKHDKLKLVL-------VNNQYMIHNGEIIFNINQEPLKLNLDFFGIKFTDDHENNLDTDKVYNRNTARLSLKKYDNSENLITSYKSKIIRNKN---FDVSEDISILQIKRQEKHPTKYILKLDFKVPYFPHEMIIEIDGYDTNCIPTTTKGFPISDLLISVHEKIKCTLSNTRIICKIFQKESIP----KQIKQNTAIEIRKKKNKKKKGETETSQTNSSALVQESKET----KEMCLVINQTIFDDESIKSRELHSESEILEIKNVFSKTLNYDVYIFKNLGTQELKDKINNKLDNFENYHDHIVVFVFSHGDNNMFHTRDGFITYNDFVKLFLPINCQKISDKPKLFFISCCLGKKVNTIDKSY-IPQGITENTSASCENLFKYKNL-PEYSNIFMGFSTVPDYYSFRVNNFTPYIQTLLDVIRENPTLEVRNIQNITQSRINWKESL-----TIPSVFHCLNRDVFF 545          
BLAST of Caspase-1 vs. TrEMBL
Match: A0A221C9L0 (Caspase 10-like protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.183e-41
Identity = 157/504 (31.15%), Postives = 245/504 (48.61%), Query Frame = 2
Query:  113 LFPDEINSIKFQEHHLNQVSVIHIWDPINESLHNKLELV-LELVSDDKLESKPLIYKDTVVFEIKNLEVKLDFIGIRFLVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFEISPEILVSGVKKSNNNGI------ITLKHYIPYFPFEIQV-FSPTNKKFMPRNLGGFPVKELSF----SLKKEKIDLRMLTIKCEEFQKF------YIPETFNKNIQERKMKEIDCQLTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYENEDLKSR-TGAQEDVDRIYEVFTP-LNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN---LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            LF +E     F   +LN  + I +  P +E+ H+ L LV LE    +  E    +  D V       + KLDF  I    D    TD  D Y+++TARL I I D + +     TS I+RNKN     I  +I +S +K+  N         I LK  +PYF  E+++      KK  P+  G FP KEL      ++K   ++ R+L  K E    F      +   +   +I+ERK K    ++T   L       +E S    + ++MC I+    +++++L SR + +++++  I EVF+  LNY +    + KT ELKEK+  KLD+ +D  + IV F+ SHG    F+T DG + + EF  +++        +KPK+F + CC G K N  D SN    D + +  +   ++    +  P+  NIF   ST+P Y +FR    + +IQ LL+ IK++PT E+ E Q   Q R   +  +     I S + CLT  V+F
Sbjct:   68 LFSNENPIWIFPPIYLNYNAKISLIKPNSEAKHDNLRLVPLEKYPINNGEINFKVTADIVK------DFKLDFFEIHCTADNADETD-EDAYNINTARLLITIYDNYEQVAKKYTSAIIRNKNFRDSVIG-DISISEIKRGKNQKSYNTKYKIILKDRVPYFQDELEMKIDGLGKKLFPKTEGKFPFKELIVYVPRNIKCTLVNTRVLCKKFEHLNLFPADKLSHCITSQTISIEERKKK---IEVTIDKLFEPSCPIQESSK---RTKEMCFIINQITFDDKNLNSRDSHSKKEIIDIEEVFSKILNYDVHKIIDRKTQELKEKIMNKLDQFKDYHKHIVVFVFSHGDNNRFHTRDGSIKYDEFVNLFLPRNCPQTLDKPKLFYFACCQGGKINKIDKSNP---DNITEKSFEKWENFFKIKHLPEYSNIFMGLSTVPDYYNFRVKHVNPFIQTLLDVIKENPTLELTEIQNITQRRMRIKWKDC--LTIASVFHCLTEEVFF 552          
BLAST of Caspase-1 vs. TrEMBL
Match: C3ZY21 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_138180 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.987e-18
Identity = 63/227 (27.75%), Postives = 111/227 (48.90%), Query Frame = 2
Query:  911 LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYD-GQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLN-----AIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            L  R G  +D   +  +F  L +  E  KNLKT ++ EK+    ++  +++E  V  ++SHG Q G +  D G ++F E    F G     LI  KPK+F  Q C GD     D    G     +     +   +++    P   + F A++T+PG+ S+R+ +RGS ++  L+      A  KD  + + +   E+ +R+       ++ Q+P+  + LT+N+YF+
Sbjct:   23 LPLRDGTNKDAQNLQNLFQELFFITETHKNLKTADIHEKLKDFAEKDHENYECCVVVLLSHGGQGGIFGTDSGVIHFTEILQKFDGQNCPGLI-GKPKLFFVQACRGDTGTSPDSDTPGSTHQSMPDATVAAPQQVFAPNVPNIADTFLAYATVPGFVSWRNSERGSWFVCALVEVFLMYAATKDINQLMTDVNHEVSQRT---GASTSYRQMPAPVNMLTKNLYFN 245          
BLAST of Caspase-1 vs. TrEMBL
Match: A0A493QY72 (Caspase-7 OS=Dugesia japonica OX=6161 GN=CASP-7 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.165e-16
Identity = 65/203 (32.02%), Postives = 108/203 (53.20%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENE-DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELK---EKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVN----FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKKDPTKE 1444
            +K+C I+  +E++   +L  R+G Q D +++  +F  LN+ +E  KN    E++   E++S++ D ++D + + V FI+SHG +   Y  D  V+       FKG   + L+  KPK+F  Q C GDKF         D+ +L DS   +   +I     P   ++   +ST+PGY S+R+   GS YIQ L + I+K+   E
Sbjct:   17 KKLCYIINNEEFDRGLNLSPRSGTQRDFEKLKTLFKKLNFVVENHKNCTAYEMRKNLEEISKRKD-LKD-YSMFVCFILSHGDEGIIYGRDAHVSIDTMLNYFKGDKCKGLV-GKPKLFFIQACRGDKF---------DKGVLADSVGSNNLDKI-----PIEADVLIGYSTVPGYFSWRNSSNGSWYIQALCSEIEKNAKTE 202          
BLAST of Caspase-1 vs. TrEMBL
Match: A0A4Y6I1I1 (Caspase-3A OS=Dugesia japonica OX=6161 GN=cas-3A PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.761e-16
Identity = 70/243 (28.81%), Postives = 117/243 (48.15%), Query Frame = 2
Query:  851 DLKNRKMCLIVTYDE-YENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFE-----IIVTFIMSHGFQAGFYTYDGQVN----FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRN 1546
            D+   K+C I+  +E Y   +L +R+G  ED   + +VFT L +K+E +KN K    K+++   L E+ +  E     I+V  I++HG     Y  DG +     F  FKG     LI  KPK+F++Q C G+KF         D+ ++ D  +++   +I     P   +    +ST+ GY S+R+ R GS YIQ L            RE ++  Q     + +   +  + ++Y  +T+N
Sbjct:   21 DVSKIKLCYIINNEEFYPKLNLPTRSGTDEDFKSLKQVFTKLGFKVENYKNFK----KDEICSNLRELSERKELKDVSILVCIILTHGADGIIYGIDGPIELDRIFGYFKGDKCRKLI-GKPKVFLFQACRGEKF---------DKGVVADGFFQTSLEKI-----PVEADFLIGYSTVAGYFSWRNGRNGSWYIQALC-----------RELERSAQSMELIQLLVNVNNYVATNYFSMTKN 233          
BLAST of Caspase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000010543.2 (caspase-6-like [Source:NCBI gene;Acc:103035747])

HSP 1 Score: 73.559 bits (179), Expect = 3.828e-14
Identity = 69/254 (27.17%), Postives = 109/254 (42.91%), Query Frame = 2
Query:  821 VFSTE--EESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIK-KDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            VF+T+  EE   + K R   LI  ++ +     L++RTG   D   + E FT L + +E   NL   ++ +K+ Q+ D  +   +  V   +SHG     + +D  VN  E    F+G    +L+  KPKIFI+Q C GD  +  DP      +           + +Y    P   +    +S   G+ +FR  + GS YIQ L   ++ +  T E  E    L              Q+P     LT+ +YF
Sbjct:   26 VFNTDLPEEYQMNFKRRGSALIFNHEHFFWMLRLQARTGTATDKRNLTERFTELGFNVESCDNLNENDMMDKIRQEADHTDS--DCFVCVFLSHGRDGHIFAFDKMVNIKEITDLFRGDKCRSLV-GKPKIFIFQACRGDITD--DPVTPVAGEDEEIEEVEEDTAMVYT--LPAGADFLMCYSVAEGFAAFRHTKLGSAYIQDLCETLEHQGSTLEFTELLT-LVNLKVSRRTHNNKKQMPCFTSMLTKKLYF 271          
BLAST of Caspase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000030336.1 (caspase-6-like [Source:NCBI gene;Acc:103035747])

HSP 1 Score: 73.9442 bits (180), Expect = 3.846e-14
Identity = 68/254 (26.77%), Postives = 107/254 (42.13%), Query Frame = 2
Query:  821 VFSTE--EESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIK-KDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            VF+T+  EE   + K R   LI  ++ +     L++RTG   D   + E FT L + +E   NL   ++ +K+ Q  +      +  V   +SHG     + +D  VN  E    F+G    +L+  KPKIFI+Q C GD  +  DP      +           + +Y    P   +    +S   G+ +FR  + GS YIQ L   ++ +  T E  E    L              Q+P     LT+ +YF
Sbjct:   36 VFNTDLPEEYQMNFKRRGSALIFNHEHFFWMLRLQARTGTATDKRNLTERFTELGFNVESCDNLNENDMMDKIRQAAEADHTDSDCFVCVFLSHGRDGHIFAFDKMVNIKEITDLFRGDKCRSLV-GKPKIFIFQACRGDITD--DPVTPVAGEDEEIEEVEEDTAMVYT--LPAGADFLMCYSVAEGFAAFRHTKLGSAYIQDLCETLEHQGSTLEFTELLT-LVNLKVSRRTHNNKKQMPCFTSMLTKKLYF 283          
BLAST of Caspase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000051450.1 (caspase-6-like [Source:NCBI gene;Acc:103035747])

HSP 1 Score: 73.9442 bits (180), Expect = 4.206e-14
Identity = 68/254 (26.77%), Postives = 107/254 (42.13%), Query Frame = 2
Query:  821 VFSTE--EESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIK-KDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            VF+T+  EE   + K R   LI  ++ +     L++RTG   D   + E FT L + +E   NL   ++ +K+ Q  +      +  V   +SHG     + +D  VN  E    F+G    +L+  KPKIFI+Q C GD  +  DP      +           + +Y    P   +    +S   G+ +FR  + GS YIQ L   ++ +  T E  E    L              Q+P     LT+ +YF
Sbjct:   38 VFNTDLPEEYQMNFKRRGSALIFNHEHFFWMLRLQARTGTATDKRNLTERFTELGFNVESCDNLNENDMMDKIRQAAEADHTDSDCFVCVFLSHGRDGHIFAFDKMVNIKEITDLFRGDKCRSLV-GKPKIFIFQACRGDITD--DPVTPVAGEDEEIEEVEEDTAMVYT--LPAGADFLMCYSVAEGFAAFRHTKLGSAYIQDLCETLEHQGSTLEFTELLT-LVNLKVSRRTHNNKKQMPCFTSMLTKKLYF 285          
BLAST of Caspase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000042915.1 (caspase-6-like [Source:NCBI gene;Acc:103035747])

HSP 1 Score: 72.4034 bits (176), Expect = 8.776e-14
Identity = 65/247 (26.32%), Postives = 102/247 (41.30%), Query Frame = 2
Query:  836 EESSADLKNRKMCLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIK-KDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            EE   + K R   LI  ++ +     L++RTG   D   + E FT L + +E   NL   ++ +K+ Q  +      +  V   +SHG     + +D  VN  E    F+G    +L+  KPKIFI+Q C GD  +  DP      +           + +Y    P   +    +S   G+ +FR  + GS YIQ L   ++ +  T E  E    L              Q+P     LT+ +YF
Sbjct:   12 EEYQMNFKRRGSALIFNHEHFFWMLRLQARTGTATDKRNLTERFTELGFNVESCDNLNENDMMDKIRQAAEADHTDSDCFVCVFLSHGRDGHIFAFDKMVNIKEITDLFRGDKCRSLV-GKPKIFIFQACRGDITD--DPVTPVAGEDEEIEEVEEDTAMVYT--LPAGADFLMCYSVAEGFAAFRHTKLGSAYIQDLCETLEHQGSTLEFTELLT-LVNLKVSRRTHNNKKQMPCFTSMLTKKLYF 252          
BLAST of Caspase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000039856.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001829.1:7264:16104:-1 gene:ENSAMXG00000030411.1 transcript:ENSAMXT00000039856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 6.599e-13
Identity = 62/250 (24.80%), Postives = 102/250 (40.80%), Query Frame = 2
Query:  872 CLIVTYDEYE-NEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPTKEIREYQKELQ----------------ERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            C+I+    +  +  +  R G   D     + F  L YK+++F +    ++K+ ++    E       +V  ++SHG +  F+  DG +        F+G    +L+  KPK+F  Q C G          D D  I +DSP      +  P   P   +   A+ST PGY S+R+   GS ++Q L   + K        Y +EL+                E + + P      QIP     LT+ +YF
Sbjct:   52 CIIINNKNFHRSTGMNQRNGTDVDAGNAMKAFGKLGYKVKVFNDQTVDQIKQVLTAVAREDHSRCASLVCVLLSHGDEGVFFGTDGALELKSLTSLFRGDRCTSLV-GKPKLFFIQACRG---------TDLDAGIEMDSP-----PDGSPVKIPVEADFLYAYSTAPGYYSWRNTMTGSWFMQSLCEMVSK--------YGRELELMQIMTRVNYKVAMDFESASNAPGFDAKKQIPCIVSMLTKEMYF 278          
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005841.1 (pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-1 gene:ENSPMAG00000005266.1 transcript:ENSPMAT00000005841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.294e-14
Identity = 62/251 (24.70%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  854 LKNRKMCLIVTYDEYENE-DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN---LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIY----PELRPKCCNIFEAFSTIPGYKSFR-DDRGSLYIQQLLNAIKKDPTK-EIREYQKELQERSFDEPIEGTH-------FQIPSSYDCLTRNVYF 1555
             + +  C+I+  + +  +  +  R G   D  ++   F  L +++E +K+L   ++ E + +   E   +    V  I+SHG +   Y  DG +       I+ E     +  KPK+F  Q C G  F+      DG R        RS D++      P + P   +   AFST+PGY S+R +++GS +IQ L   + ++ ++ E+ +    +  R   + +  +         QIP     LTR  YF
Sbjct:   10 FQAKSKCIIINNENFSPQTGMNRRKGTDRDAMQLQVCFLSLGFQVESYKDLTCKQMVENLKKASSEDHGTRACFVCAILSHGEEGVLYGTDGTLPVSILADIFSEKHCPSLAGKPKLFFIQACRGSMFDEGVDQVDGLR--------RSDDTDSRGYSKPPVEP---DFLYAFSTVPGYYSWRNEEKGSWFIQSLCEELLRNSSQLELVKILVCVNRRVATQYVSCSRDITYNDKKQIPCIMSMLTREFYF 249          
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005440.1 (pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 gene:ENSPMAG00000004940.1 transcript:ENSPMAT00000005440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 8.175e-12
Identity = 58/246 (23.58%), Postives = 106/246 (43.09%), Query Frame = 2
Query:  872 CLIVTYDEY-ENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL---IYNKPKIFIYQCCLGDKFN-GKDPSN-DGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIK---------KDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHK 1561
            C+I+  + +     +  R G Q DV R+ E F  L + ++  K+L   E++  + +   E   +   +V  ++SHG     Y  DG +   +    + ++    +  KP++   Q C G   + G D    DGD D+         ++ + P +     +   AF+T+ GY S+R+   GS +IQ L + ++         K  T+  R    E    + D  +  +  QIP +   LT+ +Y  K
Sbjct:   13 CIIINNENFFPRAGMAKRNGTQMDVSRLSECFDSLGFDVKYRKDLTCEEMRTFLKEVSQENLKNCACLVCVVLSHGEDGVVYGTDGPLPLSDIVKPFADSSCPSLVGKPRLVFIQACRGTLLDKGVDKVECDGDPDV--------KEASLLPTVDLMQPDFLFAFATVSGYFSWRNPANGSCFIQLLCSELQEHGQRMELTKILTRVNRRVATEFTSNTTDADLNNSK-QIPCTVSMLTKELYLLK 249          
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008466.1 (pep scaffold:Pmarinus_7.0:GL480648:32494:50197:-1 gene:ENSPMAG00000007669.1 transcript:ENSPMAT00000008466.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 6.022e-10
Identity = 54/206 (26.21%), Postives = 94/206 (45.63%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQ--KLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIE------NLIYNKPKIFIYQCCLGDK--FNGKDPSNDGDR-DILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPTKE 1444
            ++  LI+    +  E L  R G++EDV  +  +F  L+Y   + K+    E++  V +  K+DE   S    V  +MSHG   G +   G+ +    + IY          + +KPKI I Q C  D+   +  D + D      ++D+ W +G   +     P+  ++   +ST+P   S+R   +GS  IQ L+  +K+    E
Sbjct:   25 QRQALIINNMNFTGEGLLKRNGSEEDVKYLVWLFKELDYTPIVHKDQSAEEIENLVKKFAKMDEHMHSDSTFVV-VMSHGCNRGVFG-KGKNDLLSIETIYTALNNNNCPGLKDKPKIIIVQACRADRLALSVVDIATDSAAPKEVVDANWETGGCRV-----PRESDMTCLYSTLPDDVSYRSRIKGSFLIQHLVEVMKEHACTE 223          
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005498.1 (pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 gene:ENSPMAG00000004980.1 transcript:ENSPMAT00000005498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 6.323e-10
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENE-----DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDG------QVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIKK 1429
            R +CLI+  +E+ ++      LK R G   D +++ +VF  L +KI +  NL   ++ E +         + ++ V  I++HG     +  DG      +V  Y F G   ++L+  KPK+F  Q C      G +  ++       D       S I   + P   +I    +T+ GY SFR  R GS YIQ L N +++
Sbjct:  275 RGICLIINNEEFSSDFKTSPKLKKREGTHIDAEKLEKVFKYLGFKILLHNNLTVGQMIETLMSCSKMNHKNHDVFVCCILTHGEINCVFGSDGKSLLITEVTSY-FNGSACKSLL-GKPKLFFIQAC-----QGHEKQSECHLAADADIDADGPVSPISYSI-PDEADILLGMATVSGYLSFRHRREGSWYIQTLCNLLEQ 467          
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003309.1 (pep scaffold:Pmarinus_7.0:GL481868:25426:34645:-1 gene:ENSPMAG00000003018.1 transcript:ENSPMAT00000003309.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.142e-7
Identity = 56/268 (20.90%), Postives = 112/268 (41.79%), Query Frame = 2
Query:  818 VVFSTEEESSADLKNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDG-QVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCC----NIFEA------FSTIPGYKSFRDDRGSLYI-----QQLLNA------IKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            +V S  ++S  ++ +    +I       + +L+ R G+Q D   +  +   + +++++  +  +  + + + + + E   + E  V  I+SHG+   F   DG +V++ +   ++      +K K+FI Q C GD  +      +G+     +    SG+ +       + C    ++F        FST  GY S+R    S        ++L  A      + +  T+  R   ++ Q  S  E   G   Q+P     LTR+VY 
Sbjct:    1 MVLSGGDDSPLEVSSGTALIINMVHFMSSLELQDREGSQRDEQLMTRLLGKIGFEVDLLLDKTSDNIMKALQEGVAENRKNAEAFVCVILSHGWHGHFMCCDGTKVHYKDIYSLFNNKAWEHKLKLFIIQACRGDSTDSGAKLEEGEN---CEQTQESGNRDDASSSLDEACILNDDLFAPPETLTFFSTPEGYVSYRPKLSSCQFIEFVREELTRAWEQRVELVQSLTRVSRRIARDFQSNSKKEQYNGKK-QMPCLVSHLTRDVYL 264          
BLAST of Caspase-1 vs. Ensembl Nematostella
Match: EDO41263 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9])

HSP 1 Score: 82.4185 bits (202), Expect = 4.601e-17
Identity = 70/245 (28.57%), Postives = 116/245 (47.35%), Query Frame = 2
Query:  872 CLIVTYDEYE-NEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQ-VNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFR-DDRGSLYIQQLLNAIKKDPTKE------IREYQK-ELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHKN 1564
            CLI+    ++ +  LKSR G+  D   +  +F  L Y+++   +L   ++K  +         + + +V  I+SHG +   Y  DG  +N  +    F G   ++LI  KPK+F  Q C G  F      + G R   +DSP  +  S +     P   +   A++T+PGY S+R  ++GS +IQ L+   K D T E      I+  +K  L+  SF+        Q+PS    LT+ ++F+ N
Sbjct:  129 CLIINNVRFDADSGLKSRAGSDIDASNLQSLFMSLRYRVKRLNDLTMRQMKNTLFDFAKNNHKNSDSVVVCILSHGLEGRIYGVDGGLLNISDVISMFNGYQAKDLI-GKPKLFFLQACRGGDF------DHGARMEQIDSP--TDKSSL-----PSEADFLIAYATVPGYVSWRHQEKGSWFIQALVEVFKTDATTEDVLSMLIKVNRKVALEFESFNR-----KKQMPSPVVMLTKKLFFNVN 354          
BLAST of Caspase-1 vs. Ensembl Nematostella
Match: EDO34460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA7])

HSP 1 Score: 68.5514 bits (166), Expect = 4.836e-13
Identity = 51/194 (26.29%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  863 RKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDS-FEIIVTFIMSHGFQAGFYTYDG---QVN--FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAI 1423
            R +CLI++   ++  +L+ R G ++DV+ +   F  L++ +E+ ++ KT      ++++   I+ S +++ V  I+SHG     Y  D    ++N    +FKG     L + KPK+F  Q C G  F+ +    D  RD+            +     P   +    ++T PGY S+R    GS YI  L   +
Sbjct:   11 RGICLIISNQHFDKPELRKRDGNEQDVENLKRTFENLHFVVEIRQD-KTASEMYTIAREFSSIDHSAYDLFVCCILSHGMLGSIYGSDSNLIEINEISSQFKGNACPTLAH-KPKLFFIQACRGQDFD-RGIQADATRDM-------DASDAVRQNAEPNESHFLLGYATPPGYVSWRSQVHGSWYISFLCEVL 194          
BLAST of Caspase-1 vs. Ensembl Nematostella
Match: EDO41832 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364])

HSP 1 Score: 70.0922 bits (170), Expect = 5.650e-13
Identity = 45/172 (26.16%), Postives = 79/172 (45.93%), Query Frame = 2
Query:  920 RTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKF-NGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK 1429
            R G   D D + + F  L + +E+  N  T E    + +       ++  ++  I++HG +   YT DG +        +  + +  KPKIFI+Q C G ++ +GKD ++ G        P  +   ++     P   +   A+ST+PGY S+R+   GS +IQ +     K
Sbjct:  177 RNGTNVDRDSLEKTFKALQFDVEVHNNKTTYETNRIIKELGQRSYSNYNAMIFAILTHGEEGILYTTDGTIEIRSMMKAFKGDNLVGKPKIFIFQACQGHEYMDGKDATDAG--------PEDANRVQV-----PVEADFLYAYSTVPGYYSWRNSVNGSWFIQSICEVFNK 335          
BLAST of Caspase-1 vs. Ensembl Nematostella
Match: EDO31855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 65.0846 bits (157), Expect = 5.319e-12
Identity = 60/238 (25.21%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  875 LIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE-----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYP---ELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKK-DPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            LI+   E+ +     R G+ EDV ++Y++F      ++  +N  +LE+ E + +  ++    F+  +  I+SHG  +G Y  D +    E     F+G    +L   KPK+F  Q C G K             + ++S     DSE  P      P   +    +++ PGY+S+R+ + GS +I+ +++  +    T+ + +    +  R         H Q+PS    LTR VYF+
Sbjct:    6 LIINNQEFPSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQNKTSLEMLELLEETSEKDFTKFDCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSL-QGKPKVFFLQACRGAK----------KELVAVES-----DSEPVPIRHSGLPSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEHLMDLMLRVNHRVASLNSNLGHKQMPSEVCMLTRKVYFN 227          
BLAST of Caspase-1 vs. Ensembl Nematostella
Match: EDO42564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 65.0846 bits (157), Expect = 5.319e-12
Identity = 60/238 (25.21%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  875 LIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE-----FKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYP---ELRPKCCNIFEAFSTIPGYKSFRD-DRGSLYIQQLLNAIKK-DPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            LI+   E+ +     R G+ EDV ++Y++F      ++  +N  +LE+ E + +  ++    F+  +  I+SHG  +G Y  D +    E     F+G    +L   KPK+F  Q C G K             + ++S     DSE  P      P   +    +++ PGY+S+R+ + GS +I+ +++  +    T+ + +    +  R         H Q+PS    LTR VYF+
Sbjct:    6 LIINNQEFPSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQNKTSLEMLELLEETSEKDFTKFDCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSL-QGKPKVFFLQACRGAK----------KELVAVES-----DSEPVPIRHSGLPSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEHLMDLMLRVNHRVASLNSNLGHKQMPSEVCMLTRKVYFN 227          
BLAST of Caspase-1 vs. Ensembl Medaka
Match: casp9 (caspase 9 [Source:NCBI gene;Acc:101157857])

HSP 1 Score: 76.6406 bits (187), Expect = 1.129e-14
Identity = 66/266 (24.81%), Postives = 122/266 (45.86%), Query Frame = 2
Query:  851 DLKNRKMCLIVTYDEYE-NEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL-----------IYNKPKIFIYQCCLGDKF--------NGKDPSNDGDRDILLDSPW--------RSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPT-KEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            D +   +CLI+   E+E   +L  R G+  D D++ + F  LN+ +E+  NLK  ++K ++S    +    ++  V  I+SHG +     + G V   +   + ++ +           + +KPKIF  Q C G +         +   PS  GD D     P+         S +++  P L P   +I  ++ST PGY S+R    GS Y++ L N +++     ++      + ++      +G + Q+P S++ L ++VYF 
Sbjct:  122 DARPCGLCLIINNVEFEPKTELSIRKGSNVDCDKLEKRFKSLNFVVEVRTNLKQRQIKSELSALSRKDHSIYDCCVVVILSHGTEVSHNRFPGAVYGVDGNHVSVQEITNYLNGQNCPSLQSKPKIFFIQACGGGEKDIGFEVSPDEAKPSIGGDGDQTDAIPFSSSSESLSTSDETDAIPTL-PTPSDILVSYSTFPGYVSWRATVSGSWYVEVLDNILEEHAATLDLTTMLTLVNDKVSQNSAKGLYKQMPGSFNFLRKHVYFQ 386          
BLAST of Caspase-1 vs. Ensembl Medaka
Match: casp9 (caspase 9 [Source:NCBI gene;Acc:101157857])

HSP 1 Score: 76.6406 bits (187), Expect = 1.540e-14
Identity = 66/266 (24.81%), Postives = 122/266 (45.86%), Query Frame = 2
Query:  851 DLKNRKMCLIVTYDEYE-NEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENL-----------IYNKPKIFIYQCCLGDKF--------NGKDPSNDGDRDILLDSPW--------RSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPT-KEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFH 1558
            D +   +CLI+   E+E   +L  R G+  D D++ + F  LN+ +E+  NLK  ++K ++S    +    ++  V  I+SHG +     + G V   +   + ++ +           + +KPKIF  Q C G +         +   PS  GD D     P+         S +++  P L P   +I  ++ST PGY S+R    GS Y++ L N +++     ++      + ++      +G + Q+P S++ L ++VYF 
Sbjct:  154 DARPCGLCLIINNVEFEPKTELSIRKGSNVDCDKLEKRFKSLNFVVEVRTNLKQRQIKSELSALSRKDHSIYDCCVVVILSHGTEVSHNRFPGAVYGVDGNHVSVQEITNYLNGQNCPSLQSKPKIFFIQACGGGEKDIGFEVSPDEAKPSIGGDGDQTDAIPFSSSSESLSTSDETDAIPTL-PTPSDILVSYSTFPGYVSWRATVSGSWYVEVLDNILEEHAATLDLTTMLTLVNDKVSQNSAKGLYKQMPGSFNFLRKHVYFQ 418          
BLAST of Caspase-1 vs. Ensembl Medaka
Match: ENSORLT00000023702.2 (pep primary_assembly:ASM223467v1:1:16288164:16289686:-1 gene:ENSORLG00000019606.2 transcript:ENSORLT00000023702.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 4.156e-13
Identity = 55/216 (25.46%), Postives = 101/216 (46.76%), Query Frame = 2
Query:  971 LNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDK------FNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK-----DPTKEIREYQKELQERSF---DEPIEGTHFQIPSSYDCLTRNVYFHK 1561
            LN+ +  + + K  E+ +++ +  +E     +  +   +SHG     YTYDG +N  +    F+G    +L+  KPKIFI+Q C G+K            +++ + ++++D+      S I  +  P   +    +S   G+ SFRD  +GS YIQ L   ++K     + T+ +    ++L  RS     +P      Q+P     LT+ +YF +
Sbjct:    2 LNFDVRSYDDAKQTEVLDRIHEAAEEDHSDADCFLLVFLSHGENNCVYTYDGMINIQDITAAFRGDNCPSLV-GKPKIFIFQACRGNKCDTSVVITAASANDEVNNEVVVDA------SAI--KTLPAAADFIMCYSVAEGFYSFRDPIKGSWYIQDLCELLEKCGSRLEFTELLTLVNRKLAMRSVRMRSDPNGSEKKQVPCFASMLTKKLYFRQ 208          
BLAST of Caspase-1 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 70.0922 bits (170), Expect = 6.234e-13
Identity = 64/254 (25.20%), Postives = 105/254 (41.34%), Query Frame = 2
Query:  845 SADLKNRKMCLIVTYDEYENED-LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFN---GKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK-DPTKEIREYQKELQ-------ERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            S D     +CLI+    +  +  +  R G   D    ++ F  L Y+I+M+ +    ++K+   Q  ++    F      I+SHG +   Y  DG V+F +     KG    +L+  KPK+F  Q C G  F+     D  +D    I L++                  +   A+ST+ GY S+R    GS +IQ L   ++K   T ++ +    +        E S + P      QIP     LT++ YF
Sbjct:   51 SMDYPKMGICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSKFASFACVILSHGEEGVIYGTDGPVSFNKLIECLKGRSCLSLV-GKPKLFFIQACRGTLFDEGIEHDAKDDTSEKIPLEA------------------DFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKTLDLMQIMTRVNHKVATHFESSSNAPGFSGKKQIPCIVSMLTKDFYF 285          
BLAST of Caspase-1 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 70.0922 bits (170), Expect = 6.747e-13
Identity = 64/254 (25.20%), Postives = 105/254 (41.34%), Query Frame = 2
Query:  845 SADLKNRKMCLIVTYDEYENED-LKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYE----FKGIYIENLIYNKPKIFIYQCCLGDKFN---GKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKK-DPTKEIREYQKELQ-------ERSFDEPIEGTHFQIPSSYDCLTRNVYF 1555
            S D     +CLI+    +  +  +  R G   D    ++ F  L Y+I+M+ +    ++K+   Q  ++    F      I+SHG +   Y  DG V+F +     KG    +L+  KPK+F  Q C G  F+     D  +D    I L++                  +   A+ST+ GY S+R    GS +IQ L   ++K   T ++ +    +        E S + P      QIP     LT++ YF
Sbjct:   49 SMDYPKMGICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSKFASFACVILSHGEEGVIYGTDGPVSFNKLIECLKGRSCLSLV-GKPKLFFIQACRGTLFDEGIEHDAKDDTSEKIPLEA------------------DFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKTLDLMQIMTRVNHKVATHFESSSNAPGFSGKKQIPCIVSMLTKDFYF 283          
BLAST of Caspase-1 vs. Planmine SMEST
Match: SMESG000002751.1 (SMESG000002751.1)

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 506/507 (99.80%), Postives = 507/507 (100.00%), Query Frame = 2
Query:   44 MKFLNTKPTLVXXXXXXXXXXXPLFPDEINSIKFQEHHLNQVSVIHIWDPINESLHNKLELVLELVSDDKLESKPLIYKDTVVFEIKNLEVKLDFIGIRFLVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFEISPEILVSGVKKSNNNGIITLKHYIPYFPFEIQVFSPTNKKFMPRNLGGFPVKELSFSLKKEKIDLRMLTIKCEEFQKFYIPETFNKNIQERKMKEIDCQLTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHKN 1564
            MKFLNTKPTLVNFNNFEENKFFPLFPDEINSIKFQEHHLNQVSVIHIWDPINESLHNKLELVLELVSDDKLESKPLIYKDTVVFEIKNLEVKLDFIGIRFLVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFEISPEILVSGVKKSNNNGIITLKHYIPYFPFEIQVFSPTNKKFMPRNLGGFPVKELSFSLKKEKIDLRMLTIKCEEFQKFYIPETFNKNIQERKMKEIDCQLTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYEN+DLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHKN
Sbjct:    1 MKFLNTKPTLVNFNNFEENKFFPLFPDEINSIKFQEHHLNQVSVIHIWDPINESLHNKLELVLELVSDDKLESKPLIYKDTVVFEIKNLEVKLDFIGIRFLVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFEISPEILVSGVKKSNNNGIITLKHYIPYFPFEIQVFSPTNKKFMPRNLGGFPVKELSFSLKKEKIDLRMLTIKCEEFQKFYIPETFNKNIQERKMKEIDCQLTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYENKDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGSLYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTRNVYFHKN 507          
BLAST of Caspase-1 vs. Planmine SMEST
Match: SMESG000053166.1 (SMESG000053166.1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.567e-19
Identity = 61/195 (31.28%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  866 KMCLIVTYDEYE-NEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQ--KLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVN----FYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDR-GSLYIQQLLNAIK 1426
            K+C I+  +E++ N ++ +R G   D  R+ +VFT L +K+E +KN K+ E+   + Q  +  E++D   ++V  I+SHG +   Y  DG V+    F  FKG     L+  KPK+F+ Q C GDK+         D  ++ D    +   +I     P   +    +ST+ GY S+R+ + GS YIQ L + ++
Sbjct:   33 KLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKD-ISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGDKCRGLL-GKPKVFLIQACRGDKY---------DHGVIADDFLSNSIEKI-----PIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELE 211          
BLAST of Caspase-1 vs. Planmine SMEST
Match: SMESG000007756.1 (SMESG000007756.1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.591e-17
Identity = 63/221 (28.51%), Postives = 113/221 (51.13%), Query Frame = 2
Query:  851 DLKNRK-MCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN--------LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRS--GDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPTKEIREYQKELQER 1477
            D+ N K +CL+++ + +E  +   R G + DV +I ++FT L +++E+ ++L    + +K+      I +  ++++ F++SHG      T D +     FK   I N         +  KPK+F + CC G+ +N +   +     I  DS   +   DS+   +  P+  + F  ++T   YKSFR+  +G+ YIQ LL  I ++P K I +   ELQ+R
Sbjct:  181 DIPNEKGICLVISNENFEEPNFPKREGTEIDVTQITKLFTNLGFRVEIERDLTYDIMGKKLEDIKFLIREEHKMLIVFLLSHGENKRIITSDCK----RFKFADISNKFTSSKCIAMMGKPKLFFFVCCQGNDYNAE--VSKEKLKIYSDSNEVTLEFDSKSERKSHPEVSDFFFGYATYKKYKSFRNPLKGTFYIQYLLRIINENPKKSISQIHVELQKR 395          
BLAST of Caspase-1 vs. Planmine SMEST
Match: SMESG000007756.1 (SMESG000007756.1)

HSP 1 Score: 83.1889 bits (204), Expect = 9.200e-17
Identity = 63/221 (28.51%), Postives = 113/221 (51.13%), Query Frame = 2
Query:  851 DLKNRK-MCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN--------LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRS--GDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPTKEIREYQKELQER 1477
            D+ N K +CL+++ + +E  +   R G + DV +I ++FT L +++E+ ++L    + +K+      I +  ++++ F++SHG      T D +     FK   I N         +  KPK+F + CC G+ +N +   +     I  DS   +   DS+   +  P+  + F  ++T   YKSFR+  +G+ YIQ LL  I ++P K I +   ELQ+R
Sbjct:  186 DIPNEKGICLVISNENFEEPNFPKREGTEIDVTQITKLFTNLGFRVEIERDLTYDIMGKKLEDIKFLIREEHKMLIVFLLSHGENKRIITSDCK----RFKFADISNKFTSSKCIAMMGKPKLFFFVCCQGNDYNAE--VSKEKLKIYSDSNEVTLEFDSKSERKSHPEVSDFFFGYATYKKYKSFRNPLKGTFYIQYLLRIINENPKKSISQIHVELQKR 400          
BLAST of Caspase-1 vs. Planmine SMEST
Match: SMESG000007756.1 (SMESG000007756.1)

HSP 1 Score: 82.8037 bits (203), Expect = 9.396e-17
Identity = 63/221 (28.51%), Postives = 113/221 (51.13%), Query Frame = 2
Query:  851 DLKNRK-MCLIVTYDEYENEDLKSRTGAQEDVDRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSHGFQAGFYTYDGQVNFYEFKGIYIEN--------LIYNKPKIFIYQCCLGDKFNGKDPSNDGDRDILLDSPWRS--GDSEIYPELRPKCCNIFEAFSTIPGYKSFRDD-RGSLYIQQLLNAIKKDPTKEIREYQKELQER 1477
            D+ N K +CL+++ + +E  +   R G + DV +I ++FT L +++E+ ++L    + +K+      I +  ++++ F++SHG      T D +     FK   I N         +  KPK+F + CC G+ +N +   +     I  DS   +   DS+   +  P+  + F  ++T   YKSFR+  +G+ YIQ LL  I ++P K I +   ELQ+R
Sbjct:  185 DIPNEKGICLVISNENFEEPNFPKREGTEIDVTQITKLFTNLGFRVEIERDLTYDIMGKKLEDIKFLIREEHKMLIVFLLSHGENKRIITSDCK----RFKFADISNKFTSSKCIAMMGKPKLFFFVCCQGNDYNAE--VSKEKLKIYSDSNEVTLEFDSKSERKSHPEVSDFFFGYATYKKYKSFRNPLKGTFYIQYLLRIINENPKKSISQIHVELQKR 399          
The following BLAST results are available for this feature:
BLAST of Caspase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASP141.872e-1226.19caspase 14 [Source:HGNC Symbol;Acc:HGNC:1502][more]
CASP92.135e-1224.22caspase 9 [Source:HGNC Symbol;Acc:HGNC:1511][more]
CASP33.939e-1225.81caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504][more]
CASP33.939e-1225.81caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504][more]
CASP97.613e-1224.22caspase 9 [Source:HGNC Symbol;Acc:HGNC:1511][more]
back to top
BLAST of Caspase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csp-13.893e-928.00Caspase A Caspase A subunit p16 Caspase A subunit ... [more]
csp-28.879e-929.38Putative inactive caspase B Putative inactive casp... [more]
csp-12.570e-828.00Caspase A Caspase A subunit p16 Caspase A subunit ... [more]
csp-24.404e-827.96Putative inactive caspase B Putative inactive casp... [more]
csp-25.252e-827.96Putative inactive caspase B Putative inactive casp... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drice6.268e-1626.98gene:FBgn0019972 transcript:FBtr0085482[more]
Dcp-12.026e-1426.37gene:FBgn0010501 transcript:FBtr0072062[more]
Dredd3.708e-1329.41gene:FBgn0020381 transcript:FBtr0340083[more]
Dredd6.104e-1329.41gene:FBgn0020381 transcript:FBtr0114559[more]
Dredd6.147e-1329.41gene:FBgn0020381 transcript:FBtr0114560[more]
back to top
BLAST of Caspase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp6a1.289e-1328.97caspase 6, apoptosis-related cysteine peptidase a ... [more]
casp6a1.440e-1328.97caspase 6, apoptosis-related cysteine peptidase a ... [more]
CU467905.12.434e-1326.45caspase 17, apoptosis-related cysteine peptidase [... [more]
casp6b.22.935e-1326.59caspase 6b.2, apoptosis-related cysteine peptidase... [more]
casp91.078e-1222.92caspase 9, apoptosis-related cysteine peptidase [S... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calb21.034e-1526.32calbindin 2 [Source:Xenbase;Acc:XB-GENE-960001][more]
casp3.22.526e-1229.52caspase 3, gene 2 [Source:NCBI gene;Acc:100151728][more]
bcr6.836e-1123.86BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr6.879e-1123.86BCR, RhoGEF and GTPase activating protein [Source:... [more]
lrrc383.718e-1023.81leucine rich repeat containing 38 [Source:Xenbase;... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Casp31.122e-1427.42caspase 3 [Source:MGI Symbol;Acc:MGI:107739][more]
Casp31.122e-1427.42caspase 3 [Source:MGI Symbol;Acc:MGI:107739][more]
Casp93.281e-1225.69caspase 9 [Source:MGI Symbol;Acc:MGI:1277950][more]
Casp61.023e-1124.44caspase 6 [Source:MGI Symbol;Acc:MGI:1312921][more]
Casp71.137e-922.53caspase 7 [Source:MGI Symbol;Acc:MGI:109383][more]
back to top
BLAST of Caspase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P89116|CASP1_SPOFR6.466e-1725.30Caspase-1 OS=Spodoptera frugiperda OX=7108 PE=1 SV... [more]
sp|Q08DY9|CASP3_BOVIN2.120e-1526.36Caspase-3 OS=Bos taurus OX=9913 GN=CASP3 PE=2 SV=1[more]
sp|O01382|DRICE_DROME6.283e-1526.98Caspase OS=Drosophila melanogaster OX=7227 GN=Dric... [more]
sp|Q8MJU1|CASP3_FELCA5.557e-1426.61Caspase-3 OS=Felis catus OX=9685 GN=CASP3 PE=2 SV=... [more]
sp|P70677|CASP3_MOUSE7.849e-1427.42Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 S... [more]
back to top
BLAST of Caspase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y6I2B12.330e-5232.05Caspase-1 OS=Dugesia japonica OX=6161 GN=cas-1 PE=... [more]
A0A221C9L02.183e-4131.15Caspase 10-like protein OS=Dugesia japonica OX=616... [more]
C3ZY211.987e-1827.75Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A493QY721.165e-1632.02Caspase-7 OS=Dugesia japonica OX=6161 GN=CASP-7 PE... [more]
A0A4Y6I1I16.761e-1628.81Caspase-3A OS=Dugesia japonica OX=6161 GN=cas-3A P... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010543.23.828e-1427.17caspase-6-like [Source:NCBI gene;Acc:103035747][more]
ENSAMXT00000030336.13.846e-1426.77caspase-6-like [Source:NCBI gene;Acc:103035747][more]
ENSAMXT00000051450.14.206e-1426.77caspase-6-like [Source:NCBI gene;Acc:103035747][more]
ENSAMXT00000042915.18.776e-1426.32caspase-6-like [Source:NCBI gene;Acc:103035747][more]
ENSAMXT00000039856.16.599e-1324.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005841.11.294e-1424.70pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-... [more]
ENSPMAT00000005440.18.175e-1223.58pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 ge... [more]
ENSPMAT00000008466.16.022e-1026.21pep scaffold:Pmarinus_7.0:GL480648:32494:50197:-1 ... [more]
ENSPMAT00000005498.16.323e-1027.36pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 ge... [more]
ENSPMAT00000003309.11.142e-720.90pep scaffold:Pmarinus_7.0:GL481868:25426:34645:-1 ... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caspase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412634.601e-1728.57Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9][more]
EDO344604.836e-1326.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418325.650e-1326.16Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364][more]
EDO318555.319e-1225.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425645.319e-1225.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Caspase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp91.129e-1424.81caspase 9 [Source:NCBI gene;Acc:101157857][more]
casp91.540e-1424.81caspase 9 [Source:NCBI gene;Acc:101157857][more]
ENSORLT00000023702.24.156e-1325.46pep primary_assembly:ASM223467v1:1:16288164:162896... [more]
casp36.234e-1325.20caspase 3 [Source:NCBI gene;Acc:100049215][more]
casp36.747e-1325.20caspase 3 [Source:NCBI gene;Acc:100049215][more]
back to top
BLAST of Caspase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002751.10.000e+099.80SMESG000002751.1[more]
SMESG000053166.14.567e-1931.28SMESG000053166.1[more]
SMESG000007756.17.591e-1728.51SMESG000007756.1[more]
SMESG000007756.19.200e-1728.51SMESG000007756.1[more]
SMESG000007756.19.396e-1728.51SMESG000007756.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014519 ID=SMED30014519|Name=Caspase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1635bp
GGCATTTACATGATTTTAAATTTACTATTTAATAATATTTTTTATGAAGT
TTTTGAATACAAAACCAACATTGGTTAATTTCAACAACTTTGAGGAAAAT
AAATTTTTTCCCTTATTTCCTGACGAAATTAACTCTATAAAGTTCCAAGA
ACATCATTTAAATCAGGTGTCTGTAATACATATTTGGGATCCCATAAACG
AGTCATTACATAATAAATTGGAATTAGTGTTGGAATTAGTATCTGATGAT
AAACTCGAAAGTAAACCTCTTATTTATAAAGACACAGTTGTGTTTGAAAT
AAAAAATCTGGAGGTGAAATTGGATTTTATTGGAATTCGGTTTTTAGTCG
ATCCAAATTCTGTAACAGACTGTGCGGATTTATATCATGTTCATACCGCA
CGTTTATGTATCCAAATCCAAGATCGCCACGGAAAAAACTTATGTACAAA
TACTTCCGGCATTCTTCGAAACAAAAACGTGCCTGGTTTCGAGATTTCAC
CAGAAATTTTAGTCTCTGGAGTAAAAAAATCAAATAATAATGGAATAATA
ACATTAAAACATTATATTCCATATTTCCCATTTGAAATTCAAGTGTTCAG
CCCGACAAATAAAAAATTTATGCCTAGAAATTTGGGTGGGTTTCCTGTTA
AAGAATTATCTTTTTCTCTTAAAAAAGAAAAAATAGATTTAAGAATGTTA
ACAATTAAATGTGAAGAATTTCAGAAGTTTTATATTCCAGAAACATTTAA
TAAAAATATACAGGAAAGAAAGATGAAAGAAATAGACTGCCAATTGACCG
AAGGACCATTAACAAATGTTGTTTTTTCGACGGAAGAAGAAAGTTCTGCA
GACTTAAAGAATAGAAAAATGTGCCTAATAGTAACATACGACGAGTATGA
AAATGAGGATTTGAAGAGTAGAACGGGAGCTCAGGAAGATGTAGATAGAA
TTTATGAGGTTTTTACCCCATTGAATTACAAAATAGAAATGTTTAAAAAT
TTAAAAACACTTGAATTGAAAGAAAAAGTTTCGCAGAAATTGGATGAAAT
TGAAGATTCGTTTGAAATTATTGTTACTTTTATTATGAGCCATGGATTTC
AAGCAGGGTTCTATACATACGATGGGCAAGTAAACTTTTACGAGTTTAAA
GGGATATATATCGAGAATCTAATATATAACAAACCCAAGATATTCATTTA
TCAATGTTGTCTCGGGGATAAGTTTAATGGAAAAGACCCTTCAAATGATG
GTGATCGAGACATTTTGCTTGACTCACCATGGAGATCTGGAGACTCAGAA
ATCTATCCAGAACTCCGTCCAAAATGCTGTAATATTTTTGAAGCGTTTTC
AACTATTCCTGGTTATAAAAGTTTTCGAGATGACAGAGGTAGTTTATACA
TACAACAGTTATTAAATGCTATTAAGAAGGATCCTACAAAAGAGATTCGT
GAGTATCAAAAAGAATTACAAGAACGTTCTTTTGATGAACCAATTGAAGG
TACTCACTTTCAAATTCCGTCATCCTATGATTGCTTAACCCGAAATGTTT
ACTTTCATAAAAATTAGCTAAACATTAAAAAAACGTACTAGTTTGCTGTT
ATTACAAATTTTATTCATTTTATTCATCGTGTTTA
back to top

protein sequence of SMED30014519-orf-1

>SMED30014519-orf-1 ID=SMED30014519-orf-1|Name=SMED30014519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=508bp
MKFLNTKPTLVNFNNFEENKFFPLFPDEINSIKFQEHHLNQVSVIHIWDP
INESLHNKLELVLELVSDDKLESKPLIYKDTVVFEIKNLEVKLDFIGIRF
LVDPNSVTDCADLYHVHTARLCIQIQDRHGKNLCTNTSGILRNKNVPGFE
ISPEILVSGVKKSNNNGIITLKHYIPYFPFEIQVFSPTNKKFMPRNLGGF
PVKELSFSLKKEKIDLRMLTIKCEEFQKFYIPETFNKNIQERKMKEIDCQ
LTEGPLTNVVFSTEEESSADLKNRKMCLIVTYDEYENEDLKSRTGAQEDV
DRIYEVFTPLNYKIEMFKNLKTLELKEKVSQKLDEIEDSFEIIVTFIMSH
GFQAGFYTYDGQVNFYEFKGIYIENLIYNKPKIFIYQCCLGDKFNGKDPS
NDGDRDILLDSPWRSGDSEIYPELRPKCCNIFEAFSTIPGYKSFRDDRGS
LYIQQLLNAIKKDPTKEIREYQKELQERSFDEPIEGTHFQIPSSYDCLTR
NVYFHKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR002398Pept_C14
IPR015917Pept_C14A
IPR029030Caspase-like_dom_sf
IPR001309Pept_C14_p20
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0004197cysteine-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015917Peptidase C14A, caspase catalytic domainPRINTSPR00376IL1BCENZYMEcoord: 273..286
score: 19.7
coord: 496..505
score: 33.64
coord: 343..351
score: 43.1
coord: 293..311
score: 28.87
coord: 374..392
score: 41.79
coord: 311..329
score: 17.07
IPR015917Peptidase C14A, caspase catalytic domainSMARTSM00115caspase_2coord: 270..506
e-value: 8.0E-10
score: 25.6
NoneNo IPR availablePFAMPF00656Peptidase_C14coord: 275..504
e-value: 5.9E-12
score: 46.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.1460coord: 262..507
e-value: 8.3E-41
score: 141.6
NoneNo IPR availablePANTHERPTHR10454:SF216AT03047P-RELATEDcoord: 264..506
IPR002398Peptidase C14 familyPANTHERPTHR10454CASPASEcoord: 264..506
IPR001309Peptidase C14, p20 domainPROSITEPS50208CASPASE_P20coord: 273..393
score: 21.317
IPR029030Caspase-like domain superfamilySUPERFAMILYSSF52129Caspase-likecoord: 271..504