Ras-related protein Rab-10

Overview
NameRas-related protein Rab-10
Smed IDSMED30014511
Length (bp)1290
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-10 (SMED30014511) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-10 (SMED30014511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-10 (SMED30014511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-10 (SMED30014511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014511SMESG000077710.1 dd_Smed_v4_3267_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014511SMESG000053119.1 SMESG000009621.1 SMESG000003158.1 SMESG000077074.1 SMESG000055143.1 SMESG000049878.1 SMESG000003715.1 dd_Smed_v4_3004_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014511SMESG000053119.1 SMESG000009621.1 SMESG000003158.1 SMESG000077074.1 SMESG000055143.1 SMESG000049878.1 SMESG000003715.1 dd_Smed_v4_3004_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30014511SMESG000053119.1 SMESG000009621.1 SMESG000003158.1 SMESG000077074.1 SMESG000055143.1 SMESG000049878.1 SMESG000003715.1 dd_Smed_v4_3004_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Match: RAB10 (RAB10, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9759])

HSP 1 Score: 229.18 bits (583), Expect = 4.476e-73
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 216.083 bits (549), Expect = 6.685e-68
Identity = 119/197 (60.41%), Postives = 147/197 (74.62%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE-DESRSYGAQKLSNVPRNNSYGT 683
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+S N+ EAF  L   I+ K  R+ ++S S GA     +  N S  T
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKT 199          
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 211.075 bits (536), Expect = 3.210e-66
Identity = 112/174 (64.37%), Postives = 137/174 (78.74%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+S N+ EAF  L   I+ K  R+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Match: RAB8A (RAB8A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:7007])

HSP 1 Score: 206.068 bits (523), Expect = 6.039e-64
Identity = 113/197 (57.36%), Postives = 143/197 (72.59%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTK 686
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GK+IKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCD+ D+R V++E G + A  + IK++ETSAKA+ N+  AF  L   I  K  ++ E          N P+ ++ G K
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE---------GNSPQGSNQGVK 190          
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Match: RAB8A (RAB8A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:7007])

HSP 1 Score: 199.519 bits (506), Expect = 1.884e-61
Identity = 103/161 (63.98%), Postives = 130/161 (80.75%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFE 578
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GK+IKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCD+ D+R V++E G + A  + IK++ETSAKA+ N+   ++
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENRYQ 163          
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 224.942 bits (572), Expect = 8.866e-72
Identity = 124/202 (61.39%), Postives = 147/202 (72.77%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MA++ YDMLFKLLLIGDSGVGKTC+L+ + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSF+NI +WL NI  HASE V  +I+ NKCDM DRR V+ E G + A  H I + ETSAK + ++  AF +L  AIL K P   + +S          R +S G  CC
Sbjct:    1 MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTDEQSRDTVNPVQPQRQSSSGG-CC 201          
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 224.942 bits (572), Expect = 8.866e-72
Identity = 124/202 (61.39%), Postives = 147/202 (72.77%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MA++ YDMLFKLLLIGDSGVGKTC+L+ + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSF+NI +WL NI  HASE V  +I+ NKCDM DRR V+ E G + A  H I + ETSAK + ++  AF +L  AIL K P   + +S          R +S G  CC
Sbjct:    1 MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTDEQSRDTVNPVQPQRQSSSGG-CC 201          
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 203.756 bits (517), Expect = 1.733e-63
Identity = 114/196 (58.16%), Postives = 146/196 (74.49%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGT 683
            K+YD LFKLLLIGDSGVGKTC+LF + D +++ ++ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGI+LVYDIT  +SFENI  W+ NI  HA+  VE +I+ NKCD+ +RR V+ + G + A  +  K++ETSAKA+ NI EAF  L   I  K   ++E R+ G+  +SN  R N  G+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKME-QNEMRAGGS--VSNTGRVNVGGS 195          
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 203.756 bits (517), Expect = 1.733e-63
Identity = 114/196 (58.16%), Postives = 146/196 (74.49%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGT 683
            K+YD LFKLLLIGDSGVGKTC+LF + D +++ ++ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGI+LVYDIT  +SFENI  W+ NI  HA+  VE +I+ NKCD+ +RR V+ + G + A  +  K++ETSAKA+ NI EAF  L   I  K   ++E R+ G+  +SN  R N  G+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKME-QNEMRAGGS--VSNTGRVNVGGS 195          
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 184.496 bits (467), Expect = 3.885e-56
Identity = 103/200 (51.50%), Postives = 136/200 (68.00%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKC---PREDESRSYGAQKLSNVPRNNSYGTKCC 692
            YD LFKLLLIGDSGVGK+C+L  + D  Y+ +YISTIG+DFKI+TIE+ GK IKLQIWDTAGQERF TIT SYYRGA GI++VYDIT +++F N+ +WL  I  +A E V  ++V NKCD+  +RAV  +  ++ A    I ++ETSAK+STN+ +AF  LTMA   K    P +    + G +   + P  +     CC
Sbjct:    8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAF--LTMASEIKSRMGPVQGAGGAPGVRITGSQPVQDKKSGGCC 205          
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 230.72 bits (587), Expect = 6.918e-74
Identity = 125/203 (61.58%), Postives = 152/203 (74.88%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYG-TKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI +WL NI  HA+E VE +I+ NKCDM D+R V +E G   A  H I+++ETSAK++ NI  AF EL  AIL K    + + +     +    +  + G +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSKCC 203          
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 205.682 bits (522), Expect = 3.867e-64
Identity = 109/179 (60.89%), Postives = 137/179 (76.54%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRS 632
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+  KKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  +AS  VE +++ NKC++ D+R V++E G + A  + IK++ETSAKAS N+ EAF  L   I  K  +  E+ +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN 181          
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 205.682 bits (522), Expect = 3.867e-64
Identity = 109/179 (60.89%), Postives = 137/179 (76.54%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRS 632
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+  KKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  +AS  VE +++ NKC++ D+R V++E G + A  + IK++ETSAKAS N+ EAF  L   I  K  +  E+ +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN 181          
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 174.866 bits (442), Expect = 2.753e-52
Identity = 94/164 (57.32%), Postives = 121/164 (73.78%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMA 593
            YD LFKLLLIGDSGVGK+C+L  + D  Y+ +YISTIG+DFKI+TIE+ GK IKLQIWDTAGQERF TIT SYYRGA GI++VYD T ++SF N+ +WL  I  +A E V  ++V NK D+  ++ V      E AA   I ++ETSAK++TN+ +AF  +TMA
Sbjct:    8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAF--MTMA 169          
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 174.866 bits (442), Expect = 4.680e-52
Identity = 90/207 (43.48%), Postives = 133/207 (64.25%), Query Frame = 3
Query:   90 AKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE---DESRSYGAQK---LSNVPRNNSYGTKCC 692
            A +++D +FKLL+IG+S VGKT  LF Y D +++  ++ST+GIDFK+KT+    K++KLQIWDTAGQER+ TIT +YYRGAMG +L+YD+T   SF ++  W+  I+T++ +  +VI+V NKCDM D+R ++ E GR+ A    +++ ETSAK + N+   FE L   I  K       D +   G QK   L++ P+        C
Sbjct:   14 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC 220          
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Match: rab10 (RAB10, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-304])

HSP 1 Score: 232.261 bits (591), Expect = 1.684e-74
Identity = 127/203 (62.56%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   ILKK P +E  S +        V     + TKCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVPKAKGEQIAKEHGIRFFETSAKANINIEKAFLTLAEDILKKTPVKEPNSENVDISTGGGV---TGWKTKCC 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 213.001 bits (541), Expect = 7.055e-67
Identity = 112/174 (64.37%), Postives = 138/174 (79.31%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+STN+ EAF  L   I+ +  R+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLNRK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 213.001 bits (541), Expect = 7.055e-67
Identity = 112/174 (64.37%), Postives = 138/174 (79.31%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+STN+ EAF  L   I+ +  R+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLNRK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 213.001 bits (541), Expect = 7.055e-67
Identity = 112/174 (64.37%), Postives = 138/174 (79.31%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+STN+ EAF  L   I+ +  R+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLNRK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Match: megf8 (multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-GENE-090730-1])

HSP 1 Score: 209.534 bits (532), Expect = 5.183e-66
Identity = 111/170 (65.29%), Postives = 135/170 (79.41%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 605
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT+ KSFENI  W+ NI  HAS  VE +I+ NKCDM +RR V++E G + A  + IK++ETSAK S N+ EAF  L   I+ +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVEKMILGNKCDMNERRQVSKERGEKLAIDYGIKFLETSAKTSINVEEAFFTLARDIMAR 172          
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 212.616 bits (540), Expect = 1.703e-66
Identity = 116/183 (63.39%), Postives = 142/183 (77.60%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE-DESRSYGA 641
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V+ E+G + A  + IK++ETSAK+S N+ EAF  L   I+ K  R+ +ES S G 
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKLNRKMNESISPGG 185          
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Match: clcn7 (chloride channel, voltage-sensitive 7 [Source:Xenbase;Acc:XB-GENE-995168])

HSP 1 Score: 206.453 bits (524), Expect = 4.639e-64
Identity = 113/200 (56.50%), Postives = 144/200 (72.00%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ 695
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GK+IKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCD+ ++R V++E+G + A  + IK++ETSAKA+ N+  AF  L   I  K  +  E          N P+ ++ G K  Q
Sbjct:   16 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDVNEKRQVSKEKGEKLALEYGIKFMETSAKANINVENAFFTLARDIKAKMDKRME---------GNSPQGSNQGVKITQ 206          
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 203.371 bits (516), Expect = 3.263e-63
Identity = 106/159 (66.67%), Postives = 129/159 (81.13%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEA 572
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V+ E+G + A  + IK++ETSAK+S N+ E 
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 202.986 bits (515), Expect = 5.580e-63
Identity = 106/159 (66.67%), Postives = 129/159 (81.13%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEA 572
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V+ E+G + A  + IK++ETSAK+S N+ E 
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 202.216 bits (513), Expect = 9.247e-63
Identity = 106/159 (66.67%), Postives = 129/159 (81.13%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEA 572
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V+ E+G + A  + IK++ETSAK+S N+ E 
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Match: Rab10 (RAB10, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105066])

HSP 1 Score: 229.18 bits (583), Expect = 3.073e-73
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Match: Rab8b (RAB8B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2442982])

HSP 1 Score: 216.468 bits (550), Expect = 3.183e-68
Identity = 117/183 (63.93%), Postives = 144/183 (78.69%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE-DESRSYGA 641
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK+STN+ EAF  L   I+ K  R+ ++S S GA
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGA 185          
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Match: Rab8a (RAB8A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:96960])

HSP 1 Score: 208.379 bits (529), Expect = 5.619e-65
Identity = 114/197 (57.87%), Postives = 144/197 (73.10%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTK 686
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GK+IKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCD+ D+R V++E G + A  + IK++ETSAKA+ N+  AF  L   I  K  ++ E          N P+ +S+G K
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLE---------GNSPQGSSHGVK 190          
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 197.593 bits (501), Expect = 6.980e-61
Identity = 102/170 (60.00%), Postives = 130/170 (76.47%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 605
            K+YD LFKLLLIGDSGVGKTC++  + +  ++ TYISTIGIDFKI+T++I GK+IKLQ+WDTAGQERF TIT +YYRGAMGI+LVYDIT  KSFENI  W+ +I+ +AS  VE +++ NKCDM  +R V  E+  + A  H I++ ETSAK+S N+ EAF  L   IL K
Sbjct:    3 KAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLK 172          
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 181.8 bits (460), Expect = 7.913e-55
Identity = 104/201 (51.74%), Postives = 138/201 (68.66%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQ----KLSNVPRNNSYGTKCC 692
            YD LFKLLLIGDSGVGK+C+L  + D  Y+ +YISTIG+DFKI+TIE+ GK IKLQIWDTAGQERF TIT SYYRGA GI++VYD+T ++SF N+ +WL  I  +ASE V  ++V NKCD+  ++ V     +E A S  I ++ETSAK +TN+ ++F  +TMA   K      + + GA+    K+ + P   S G  CC
Sbjct:    5 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSF--MTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQS-GGGCC 202          
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Match: sp|P22127|RAB10_DIPOM (Ras-related protein Rab-10 OS=Diplobatis ommata OX=1870830 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 8.587e-73
Identity = 126/206 (61.17%), Postives = 155/206 (75.24%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYG----TKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H+I++ ETSAKA+ NI +AF  L   IL+K P ++  R        NV  + + G     KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELHGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVLKSKGEQIAREHAIRFFETSAKANINIEKAFLTLAEDILQKTPVKEPDR-------ENVDISTTGGGTGLKKCC 199          
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Match: sp|Q5R5U1|RAB10_PONAB (Ras-related protein Rab-10 OS=Pongo abelii OX=9601 GN=RAB10 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.149e-72
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Match: sp|P61027|RAB10_MOUSE (Ras-related protein Rab-10 OS=Mus musculus OX=10090 GN=Rab10 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.149e-72
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Match: sp|P61026|RAB10_HUMAN (Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 2.149e-72
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Match: sp|P24409|RAB10_CANLF (Ras-related protein Rab-10 OS=Canis lupus familiaris OX=9615 GN=RAB10 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 8.464e-72
Identity = 124/203 (61.08%), Postives = 152/203 (74.88%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAK + NI +AF  L   IL+K P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKVNINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Match: Q5DET6 (Rab-protein 10 OS=Schistosoma japonicum OX=6182 GN=Rab10 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.045e-76
Identity = 132/202 (65.35%), Postives = 154/202 (76.24%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKKSYD LFKLLLIGDSGVGKTC+L  YVDG+YSP++ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIM++YDIT R++F+NI  W+ NI  +ASE VE ++V NKCD  +RRAV+ EEG E A  H IK++ETSA    N+ +AFEELT+AIL+K P      S   Q    V   NS    CC
Sbjct:    1 MAKKSYDALFKLLLIGDSGVGKTCLLIRYVDGSYSPSFISTIGIDFKIKTIELEGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMMIYDITNRRTFDNIQTWMKNICDYASEDVEKLVVGNKCDFDNRRAVSYEEGSEKARLHRIKFLETSAMTGENVNKAFEELTLAILRKTPTRGHEPSTVTQSHRLVDPLNSKSESCC 202          
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Match: A0A1D1V4J1 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_05573-1 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.661e-76
Identity = 129/202 (63.86%), Postives = 158/202 (78.22%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAK+SYD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSF+NI +WL NI  HA+E VE +++ NKCDM DRRA+T E G + A  H I+++ETSAKA+ N+  AF EL+ AIL K P +D+     A +  ++P+     +KCC
Sbjct:    1 MAKRSYDLLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQPKSFDNIAKWLRNIEEHANEDVEKMLLGNKCDMEDRRAITRERGEDIARQHGIRFLETSAKANINVERAFYELSEAILDKGPNKDK-----APEPQSLPKPRQELSKCC 197          
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Match: C1L706 (Rab-protein 10 OS=Schistosoma japonicum OX=6182 GN=Rab10 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.342e-75
Identity = 131/202 (64.85%), Postives = 153/202 (75.74%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKKSYD LFKLLLIGDSGVGKTC+L  YVDG+YSP++ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMG M++YDIT R++F+NI  W+ NI  +ASE VE ++V NKCD  +RRAV+ EEG E A  H IK++ETSA    N+ +AFEELT+AIL+K P      S   Q    V   NS    CC
Sbjct:    1 MAKKSYDALFKLLLIGDSGVGKTCLLIRYVDGSYSPSFISTIGIDFKIKTIELEGKKIKLQIWDTAGQERFHTITTSYYRGAMGRMMIYDITNRRTFDNIQTWMKNICDYASEDVEKLVVGNKCDFDNRRAVSYEEGSEKARLHRIKFLETSAMTGENVNKAFEELTLAILRKTPTRGHEPSTVTQSHRLVDPLNSKSESCC 202          
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Match: A0A1W0X092 (Ras-related protein Rab-10 OS=Hypsibius dujardini OX=232323 GN=BV898_05182 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.927e-75
Identity = 131/202 (64.85%), Postives = 158/202 (78.22%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAK+SYD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSF+NI +WL NI  HA+E VE +++ NKCDM DRRA++ E G + A  H I+++ETSAKA+ N+  AF EL+ AIL K P +D+     AQ L   P+  S  +KCC
Sbjct:    1 MAKRSYDLLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQPKSFDNIAKWLRNIEEHANEDVEKMLLGNKCDMEDRRAISRERGEDIARQHGIRFLETSAKANINVERAFYELSEAILDKGPNKDKIPE--AQPL---PKPRSELSKCC 197          
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Match: E9HIB2 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_301441 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.736e-74
Identity = 133/207 (64.25%), Postives = 159/207 (76.81%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAIL-KKCPREDESRSYGAQKLSNVP----RNNSYGTKCC 692
            MAKKSYD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT+ K+F+NI +WL NI  HA+E VE +I+ NKCD+ D+RAV++E+G   A  H I+++ETSAKA+ NI  AF EL  AIL K C RE       A+ L  VP    RN+    +CC
Sbjct:    1 MAKKSYDLLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITSVKTFDNIAKWLRNIDEHANEDVEKMILGNKCDVEDKRAVSKEKGEMIAREHGIRFMETSAKANINIESAFYELAQAILTKTCGREQ------AEPLDRVPLEGSRNDRQSNRCC 201          
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Match: ENSAMXT00000056277.1 (ras-related protein Rab-10-like [Source:NCBI gene;Acc:103035127])

HSP 1 Score: 229.95 bits (585), Expect = 1.333e-73
Identity = 124/206 (60.19%), Postives = 155/206 (75.24%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGT----KCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GK+IKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  KSFENI +WL NI  HA+E VE +++ NKCDM D R V + +G + A+ H+I++ ETSAKA+ NI +AF  L   IL+K P ++ +         NV  N+  G+    +CC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKRIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENITKWLRNIEEHANEDVERMLLGNKCDMEDMRVVPKAKGEQIASEHNIRFFETSAKANINIEKAFLMLAEDILRKTPGKETTN-------ENVDVNSKSGSAGGVRCC 199          
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Match: RAB10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:103045708])

HSP 1 Score: 228.794 bits (582), Expect = 3.128e-73
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDI+  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   IL+K P +E  S +        V     + TKCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRIVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISTGGGV---TGWKTKCC 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Match: rab8b (ras-related protein Rab-8B [Source:NCBI gene;Acc:103040614])

HSP 1 Score: 214.927 bits (546), Expect = 1.178e-67
Identity = 113/174 (64.94%), Postives = 140/174 (80.46%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  +SIK++ETSAK+STN+ EAF  L+  I+ +  R+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYSIKFLETSAKSSTNVEEAFFTLSRDIMTRLNRK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Match: megf8 (ras-related protein Rab-8B [Source:NCBI gene;Acc:103041748])

HSP 1 Score: 214.157 bits (544), Expect = 2.448e-67
Identity = 115/184 (62.50%), Postives = 141/184 (76.63%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE--DESRSYGA 641
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+T+E+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT+ KSFENI  W+ NI  HAS  VE +I+ NKCDM D+R V++E G + A  + IK++ETSAK S N+ EAF  L   I+ +  R+  D S S G 
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKTSVNVEEAFLTLARDIMSRLNRKMNDGSNSDGG 186          
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Match: rab8a (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:103043778])

HSP 1 Score: 205.682 bits (522), Expect = 3.825e-64
Identity = 114/197 (57.87%), Postives = 143/197 (72.59%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTK 686
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +I+ NKCD+ D+R V++E G + A  + IK++ETSAKA+ N+  AF  L   I  K   + E          N P+ +++G K
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLE---------GNNPQGSNHGVK 190          
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 213.001 bits (541), Expect = 1.395e-67
Identity = 118/193 (61.14%), Postives = 142/193 (73.58%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNS 674
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TI++ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  HAS  VE +I+ NKCDM +RR VT E G + A  + IK++ETSAKAS N+ EAF  L   I  K  R+ E         +N P +N+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEG--------NNTPDSNA 187          
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 190.66 bits (483), Expect = 5.771e-59
Identity = 106/178 (59.55%), Postives = 127/178 (71.35%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIG--IDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDE 623
            KSYD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIG         I I  KKIKLQIWDTAGQERF TIT +YYRGAMG MLVYDIT  KSFENI  W+ NI  HAS  V+  +V NKCDM DRR VT++ G + A  ++I+++ETSAKAS N+ EAF  L   I  K  ++ E
Sbjct:    3 KSYDCLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGGSRPVCQVCIRIDLKKIKLQIWDTAGQERFRTITTAYYRGAMGSMLVYDITNEKSFENIKNWIRNIEEHASADVQK-MVGNKCDMNDRRQVTKDRGEKLAEDYNIQFMETSAKASINVEEAFFTLAREIKAKMDKKME 179          
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 181.03 bits (458), Expect = 2.653e-55
Identity = 106/201 (52.74%), Postives = 138/201 (68.66%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSY----GTKCC 692
            YD LFKLLLIGDSGVGK+C+L  + D  Y+ +YISTIG+DFKI+TIE+ GK IKLQIWDTAGQERF TIT SYYRGA GI++VYD+T ++SF N+ +WL  I  +ASE V  ++V NKCD+  ++ V     +E A S  I ++ETSAK +TN+ +AF  +TMA   K      +   GA K SNV  +++     G  CC
Sbjct:    8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAF--MTMAAEIKKRMGPGATQAGAGK-SNVKIDSTPVKTGGGGCC 205          
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 172.555 bits (436), Expect = 1.217e-51
Identity = 85/172 (49.42%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   90 AKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 605
            A +++D +FKLL+IG+S VGKT  LF Y D +++  ++ST+GIDFK+KT+    K+IKLQIWDTAGQER+ TIT +YYRGAMG +L+YDIT   SF  ++ W   I+T++ +  +V++V NKCDM D R V  E+GR+ A     ++ ETSAK + N+ + FE L   I +K
Sbjct:   22 ADQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSWDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEK 193          
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Match: rab30 (RAB30, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-250])

HSP 1 Score: 160.999 bits (406), Expect = 1.504e-47
Identity = 89/204 (43.63%), Postives = 123/204 (60.29%), Query Frame = 3
Query:  105 DMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAI--------LKKCPREDESRSYGAQKLSNVPRNNSYGTKCC 692
            D+LFK++LIG++GVGKTC++  +  G + P   +TIG+DF IKT+E+ G KIKLQIWDTAGQERF +IT SYYR A  ++L YD+++ ++F  +  WL  +  HAS  V  ++V NK D+ D R VT E+    A  H ++Y+ETSAK + N+   F EL   +        L   P    S S G   L    +  SY T CC
Sbjct:    7 DLLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVDGTKIKLQIWDTAGQERFRSITQSYYRSAHALVLTYDVSSEETFACLPAWLREMEQHASAHVPRVLVGNKLDLADVRQVTREQAEAFARLHGLRYLETSAKEAENVERLFVELARRLALDARQPALGDAPGPPRSHSCGPGGLPGDGKPVSYFTSCC 210          
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 174.096 bits (440), Expect = 9.473e-53
Identity = 90/170 (52.94%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 605
            KSYD + K+LLIGDSGVGK+C+L  +V+  ++P++I+TIGIDFKIKT++I GKK+KLQ+WDTAGQERF TIT +YYRGAMGI+LVYD+T  ++F NI +W   +  HA++  ++++V NK DM + R VT ++G   A    I +IE+SAK   N+ E F  L   I +K
Sbjct:   15 KSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEK 183          
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 173.326 bits (438), Expect = 1.617e-52
Identity = 92/164 (56.10%), Postives = 123/164 (75.00%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMA 593
            YD LFKLLLIG+SGVGK+C+L  + D  Y+  YISTIG+DFKIKT+E+ GK +KLQIWDTAGQERF TIT SYYRG+ GI++VYD+T ++SF  +  WL  I  +A+ TV  ++V NKCD+ D+R V  +  +E A ++ + ++ETSA  STN+ +AF  LTMA
Sbjct:    5 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAF--LTMA 166          
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 152.525 bits (384), Expect = 2.092e-44
Identity = 90/214 (42.06%), Postives = 127/214 (59.35%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE-----DESRSYGAQ----------KLSNVPRNN--SYGTKCC 692
            YD+LFK++LIGDSGVGK+ +L  +    ++    STIG++F  +T+EI GK+IK QIWDTAGQER+  IT +YYRGA+G ++VYDI+   S+EN N WL  +R +A + V V ++ NK D+   RAV  EE +  A  + + + ETSA  S N+ +AFEEL   I +K  +      D S +  A            L+  P  N  + G  CC
Sbjct:   10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC 223          
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 147.517 bits (371), Expect = 1.864e-42
Identity = 79/167 (47.31%), Postives = 112/167 (67.07%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILK 602
            YD LFK++LIGDSGVGK+ +L  +    ++    STIG++F  +TIE+  KKIK QIWDTAGQER+  IT +YYRGA+G ++VYDI+   S+EN N WL  +R +A + V V ++ NK D+   RAV  +E +  A  + + + ETSA  S N+ +AF EL +AI +
Sbjct:   10 YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQ 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 124.79 bits (312), Expect = 4.855e-34
Identity = 71/179 (39.66%), Postives = 108/179 (60.34%), Query Frame = 3
Query:  111 LFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXX-XXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHAS----ETVEVIIVANKCDMID-RRAVTEEEGREAAAS-HSIKYIETSAKASTNITEAFEELTMAILKKCPREDES 626
            + K++++GDSGVGKT ++  YV+  YS  Y +TIG DF  K + +   K   +Q+WDTAGQERF ++ +++YRGA   +LVYD+T   SFENI  W      HA+    ET   +I+ NK D  + ++ V+E+  +E A S   I    TSAK + N+  AFEE+  + L++   + E+
Sbjct:    8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEA 186          
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 231.491 bits (589), Expect = 1.050e-74
Identity = 126/195 (64.62%), Postives = 148/195 (75.90%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNN 671
            MAKKSYD LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKTIE+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDIT  K+F+NI++WL NI  HA+E VE +I+ NKCDM DRR V+ E G + A  H I+++ETSAK + NI +AF+ L   ILKK   +D          S  P NN
Sbjct:    1 MAKKSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKKELNKD----------SEEPSNN 185          
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 214.927 bits (546), Expect = 3.504e-68
Identity = 118/190 (62.11%), Postives = 146/190 (76.84%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESR---SYGAQKLSN 656
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+TIE+ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  HAS+ VE +++ NKCDM DRR V++E G + A  + IK++ETSAKAS N+ EAF  L   I  K  ++ E+    S GA K+++
Sbjct:    3 KTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENSNPASTGAVKITH 192          
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 210.69 bits (535), Expect = 9.101e-67
Identity = 108/176 (61.36%), Postives = 140/176 (79.55%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK-CP 611
            MA K  D+ FKLLLIGDSGVGKTC++F + D  ++P++ISTIGIDFKIKT+E+GGKKIKLQIWDTAGQERFHTIT +YYRGAMGIMLVYD+T  KSF NI++WL  I  HA+E V+ ++V NKCDM D+R +++ +G + A+S+ I +IETSA ++ N+ ++F  LT  IL   CP
Sbjct:    1 MANKKSDLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDILNAVCP 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Match: EDO43129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN1])

HSP 1 Score: 181.415 bits (459), Expect = 3.255e-55
Identity = 92/172 (53.49%), Postives = 126/172 (73.26%), Query Frame = 3
Query:   99 SYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPR 614
             YD LFK+LLIGDSGVGK+C+L  +VD ++  +Y +TIG+DFKIKT+ + GK +KLQIWDTAGQERF TIT SYYRGA G+M+VYDIT R+S+ N+++WL  + T+ASE V +I+V NK D+   R V  +  +E AA H + ++ETSAK + N+ EAF  L+  + K   +
Sbjct:   12 QYDYLFKILLIGDSGVGKSCLLLRFVDDSHRESYQTTIGVDFKIKTMRVDGKVVKLQIWDTAGQERFRTITSSYYRGAHGVMIVYDITKRESYNNLHKWLMEVETYASEGVHMILVGNKIDLDTDREVQPDAAQEWAALHDMPFVETSAKGAKNVKEAFLVLSRLLTKHIAK 183          
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 178.718 bits (452), Expect = 3.326e-54
Identity = 105/202 (51.98%), Postives = 135/202 (66.83%), Query Frame = 3
Query:  102 YDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSY-----GTKCC 692
            YD LFKLLLIGDSGVGK+C+L  + D  Y+ +YISTIG+DFKI+TIE+ GK IKLQIWDTAGQERF TIT SYYRGA GI++VYD+T ++SF N+ +WL  I  +A E V  ++V NKCD+  ++ V     +E A S  + ++ETSAK +TN+ +AF  +TMA   K          GA   SNV  N+S      G  CC
Sbjct:    8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAF--MTMAAEIKNRMGPSPAPQGAG--SNVKINSSTPVKQGGGGCC 205          
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Match: rab10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:101173671])

HSP 1 Score: 229.565 bits (584), Expect = 1.872e-73
Identity = 125/203 (61.58%), Postives = 153/203 (75.37%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCP-REDESRSYGAQKLSNVPRNNSYGTKCC 692
            MAKK+YD+LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKIKT+E+ GKKIKLQIWDTAGQERFHTIT SYYRGAMGIMLVYDI+  KSFENI++WL NI  HA+E VE +++ NKCDM D+R V + +G + A  H I++ ETSAKA+ NI +AF  L   ILKK P +E  S +        V     + +KCC
Sbjct:    1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNTKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRVVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILKKTPVKEPNSENVDISTGGGV---TGWKSKCC 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 212.231 bits (539), Expect = 1.276e-66
Identity = 115/198 (58.08%), Postives = 145/198 (73.23%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESR----SYGAQKLSNVPRNNSY 677
            K+YD LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKI+TI++ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  HAS  VE +++ NKCD+ DRR V++E G + A  + IK++ETSAKA+ N+  AF  L   I  K  ++ E      S    K++  P+ +S+
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKKLEGNNPQGSNQGVKITEQPKKSSF 200          
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Match: ENSORLT00000044845.1 (ras-related protein Rab-8B [Source:NCBI gene;Acc:101162740])

HSP 1 Score: 213.386 bits (542), Expect = 2.783e-66
Identity = 116/201 (57.71%), Postives = 146/201 (72.64%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE---DESRSYGAQKLSNVPRNNSYGTKC 689
            K+YD LFKLLLIGDSGVGKTC+LF + + A++ T+ISTIGIDFKI+T+++ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSF+NI  W+ NI  HAS  VE +++ NKCDM DRR V++E G + A  +SIK++ETSAK+S N+ EAF  L   I+ +  R+   D S   G       PR+     +C
Sbjct:   60 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVERMVLGNKCDMNDRRQVSKERGEKLAIDYSIKFLETSAKSSINVEEAFLTLARDIMSRLNRKMHNDSSAGGGGAIQIKEPRSKKSLFRC 260          
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 209.534 bits (532), Expect = 7.757e-66
Identity = 110/174 (63.22%), Postives = 135/174 (77.59%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPRE 617
            K+YD LFKLLLIGDSGVGKTC+LF + D A++ T+ISTIGIDFKI+TI++ GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYDIT  KSFENI  W+ NI  HAS  VE +++ NKCD+ DRR V++E G + A  + IK++ETSAKA+ N+  AF  L   I  K  ++
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKK 176          
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Match: megf8 (RAB8B, member RAS oncogene family [Source:NCBI gene;Acc:101174994])

HSP 1 Score: 206.838 bits (525), Expect = 1.385e-64
Identity = 109/194 (56.19%), Postives = 143/194 (73.71%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSY 677
            K+YD LFKLLLIGDSGVGKTC+LF + + +++ T+ISTIGIDFKI+TIE+ GK++KLQIWDTAGQERF TIT +YYRGAMGIMLVYDI   KSF+NI  W+ NI  HAS  VE +I+ NKCDM DRR V+++ G + A  + +K++ETSAK+S N+ EAF  +   IL        S++  +Q+   +  NN +
Sbjct:    3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDSFNTTFISTIGIDFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDICNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDMTDRRQVSKDRGEKLAIDYRVKFLETSAKSSLNVEEAFYTMARDILHNL----NSKAVSSQQYMCIFTNNGF 192          
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 393.66 bits (1010), Expect = 5.714e-138
Identity = 203/203 (100.00%), Postives = 203/203 (100.00%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ 695
            MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ
Sbjct:    1 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ 203          
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 379.022 bits (972), Expect = 3.044e-132
Identity = 196/196 (100.00%), Postives = 196/196 (100.00%), Query Frame = 3
Query:  108 MLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ 695
            MLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ
Sbjct:    1 MLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTKCCQ 196          
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Match: SMESG000035214.1 (SMESG000035214.1)

HSP 1 Score: 249.98 bits (637), Expect = 2.204e-81
Identity = 132/211 (62.56%), Postives = 164/211 (77.73%), Query Frame = 3
Query:   87 MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDES----RSYGAQKLSNVPRNNSYGTK----CCQ 695
            MAKKSYD+LFKLLLIGDSGVGKTC+LF Y D  +S T+ISTIGIDFKIKTIE+ GK+IKLQIWDTAGQERFHTITMSYYRGAMGIMLVYD+T +KSF+NI++WL NI++HASE+VE +IVANK DM ++R VT++ G   A ++ + ++E SAK   N+ +AFE+LTMAIL K P   ES    ++     LS    N+S G+K    CC+
Sbjct:    1 MAKKSYDLLFKLLLIGDSGVGKTCLLFRYADDTFSTTFISTIGIDFKIKTIEMNGKRIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDVTNKKSFDNISKWLTNIQSHASESVEKLIVANKIDMEEKRVVTKDIGENIAVANKVSFLEVSAKTGVNVPQAFEKLTMAILAKVPNTKESAESQQTERGHHLSPHSTNDSSGSKNSLSCCK 211          
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 206.453 bits (524), Expect = 1.751e-64
Identity = 107/176 (60.80%), Postives = 134/176 (76.14%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDE 623
            K YD LFKLLLIGDSGVGKT +LF + +  ++ T+I+TIGIDFKI+TI+I GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYD+T+ KSF NIN+W+ NI  HA+  VE +++ NK DM D+R V  + GRE A SH IK++ETSAK   N+ EAF +L + I  K  +  +
Sbjct:    3 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 178          
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 197.978 bits (502), Expect = 2.644e-61
Identity = 102/170 (60.00%), Postives = 129/170 (75.88%), Query Frame = 3
Query:   96 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFXXXXXXXXXXXXXLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKK 605
            K YD LFKLLLIGDSGVGKT +L  + D  +S ++I+TIGIDFKIKT+++ GKK+KLQ+WDTAGQERF TIT SYYRGA GIMLVYD+T+  SF NIN+W+ NI  HA+  VE +++ NK D+ DRR ++ E G + A  H I + ETSAK+S N+ +AF  LTM I KK
Sbjct:    3 KDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKK 172          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB104.476e-7361.58RAB10, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B6.685e-6860.41RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B3.210e-6664.37RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8A6.039e-6457.36RAB8A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8A1.884e-6163.98RAB8A, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-108.866e-7261.39Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-108.866e-7261.39Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-81.733e-6358.16RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-81.733e-6358.16RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-13.885e-5651.50RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab106.918e-7461.58gene:FBgn0015789 transcript:FBtr0077337[more]
Rab83.867e-6460.89gene:FBgn0262518 transcript:FBtr0308833[more]
Rab83.867e-6460.89gene:FBgn0262518 transcript:FBtr0074921[more]
Rab12.753e-5257.32gene:FBgn0285937 transcript:FBtr0084104[more]
Rab34.680e-5243.48gene:FBgn0005586 transcript:FBtr0473383[more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab101.684e-7462.56RAB10, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b7.055e-6764.37RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b7.055e-6764.37RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b7.055e-6764.37RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
megf85.183e-6665.29multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox21.703e-6663.39PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
clcn74.639e-6456.50chloride channel, voltage-sensitive 7 [Source:Xenb... [more]
pknox23.263e-6366.67PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox25.580e-6366.67PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox29.247e-6366.67PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab103.073e-7361.58RAB10, member RAS oncogene family [Source:MGI Symb... [more]
Rab8b3.183e-6863.93RAB8B, member RAS oncogene family [Source:MGI Symb... [more]
Rab8a5.619e-6557.87RAB8A, member RAS oncogene family [Source:MGI Symb... [more]
Rab136.980e-6160.00RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a7.913e-5551.74RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22127|RAB10_DIPOM8.587e-7361.17Ras-related protein Rab-10 OS=Diplobatis ommata OX... [more]
sp|Q5R5U1|RAB10_PONAB2.149e-7261.58Ras-related protein Rab-10 OS=Pongo abelii OX=9601... [more]
sp|P61027|RAB10_MOUSE2.149e-7261.58Ras-related protein Rab-10 OS=Mus musculus OX=1009... [more]
sp|P61026|RAB10_HUMAN2.149e-7261.58Ras-related protein Rab-10 OS=Homo sapiens OX=9606... [more]
sp|P24409|RAB10_CANLF8.464e-7261.08Ras-related protein Rab-10 OS=Canis lupus familiar... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DET61.045e-7665.35Rab-protein 10 OS=Schistosoma japonicum OX=6182 GN... [more]
A0A1D1V4J12.661e-7663.86Uncharacterized protein OS=Ramazzottius varieornat... [more]
C1L7061.342e-7564.85Rab-protein 10 OS=Schistosoma japonicum OX=6182 GN... [more]
A0A1W0X0921.927e-7564.85Ras-related protein Rab-10 OS=Hypsibius dujardini ... [more]
E9HIB21.736e-7464.25Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056277.11.333e-7360.19ras-related protein Rab-10-like [Source:NCBI gene;... [more]
RAB103.128e-7361.58RAB10, member RAS oncogene family [Source:NCBI gen... [more]
rab8b1.178e-6764.94ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
megf82.448e-6762.50ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
rab8a3.825e-6457.87RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a1.395e-6761.14RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a5.771e-5959.55RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa2.653e-5552.74RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab3c1.217e-5149.42RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab301.504e-4743.63RAB30, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC49.473e-5352.94Rab family GTPase; essential for vesicle-mediated ... [more]
YPT11.617e-5256.10Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT312.092e-4442.06Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.864e-4247.31Rab family GTPase involved in the exocytic pathway... [more]
YPT74.855e-3439.66Rab family GTPase; GTP-binding protein of the rab ... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474711.050e-7464.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410183.504e-6862.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408459.101e-6761.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431293.255e-5553.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401673.326e-5451.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab101.872e-7361.58RAB10, member RAS oncogene family [Source:NCBI gen... [more]
RAB8A1.276e-6658.08RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
ENSORLT00000044845.12.783e-6657.71ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
RAB8A7.757e-6663.22RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
megf81.385e-6456.19RAB8B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077710.15.714e-138100.00SMESG000077710.1[more]
SMESG000077710.13.044e-132100.00SMESG000077710.1[more]
SMESG000035214.12.204e-8162.56SMESG000035214.1[more]
SMESG000026178.11.751e-6460.80SMESG000026178.1[more]
SMESG000030619.12.644e-6160.00SMESG000030619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014511 ID=SMED30014511|Name=Ras-related protein Rab-10|organism=Schmidtea mediterranea sexual|type=transcript|length=1290bp
CGCTAATAAAATAAAAAAAATAACTAAGTGTATGTTTTATATTTCCGACT
TTATAATTTTATTATTAGACTTGAATCTTTATTAAAATGGCTAAAAAATC
ATATGATATGCTCTTTAAATTATTACTCATAGGAGACTCAGGTGTTGGTA
AAACTTGTATGCTATTTTCTTATGTTGATGGAGCATATTCTCCAACATAT
ATTTCTACTATAGGAATTGATTTTAAAATAAAAACAATTGAAATTGGTGG
CAAAAAAATTAAACTCCAAATATGGGATACTGCTGGTCAAGAGAGATTTC
ATACTATAACTATGTCATACTATAGAGGTGCAATGGGTATAATGCTAGTT
TATGATATCACAGCGAGAAAAAGTTTTGAAAACATTAACAGATGGTTAGG
AAATATTAGGACGCATGCATCAGAAACTGTGGAAGTTATTATAGTTGCCA
ATAAATGTGACATGATTGATAGAAGAGCTGTGACAGAGGAAGAGGGAAGA
GAGGCTGCCGCGAGTCATTCGATAAAGTATATTGAAACAAGTGCAAAAGC
AAGTACGAATATAACCGAGGCCTTTGAAGAATTAACTATGGCAATTCTGA
AAAAATGCCCTCGAGAGGATGAATCTCGGTCTTATGGTGCTCAAAAATTA
TCAAATGTTCCTCGTAATAATTCCTATGGAACGAAGTGCTGCCAATAATA
ACATTTCATAATATTCGAATCTTTGTATCGTAATGTTCAAATGCGATTTC
TCAAGTCTCCTTTTTCTGCTAATACTTGATTAAAATTTCAGTCTGACTTT
GATTTATTATTTTCTTATATGCGGGACAAGTTTTGTTGGACGTTCATGAA
TTTGTCTTTCGTATGATCTGCATGGTTTATTATTATTATATATTCATTAT
TATTATATTAATTATTATTATATTGATTATTATTATTATATTTATTATTC
ACCGTGCAGATTGATCCGATCCGTGTGTAAATTAAATTCATTAAATCATT
GCACTGAATCCGTTGCATTTCCTTCATTTCCAGATAGCACTGATCCGGAG
GCGGAGCATTCTCCTATCGTTTGGTGTTACATGTATAAATATCGTTGTTT
TTCATTGGTGGGCTTGGCATCAGTTCATTCATTTATAAGCAATTAAAATC
TGATAACAAAATGCAGTTCCAAAAATTTATTTTAAATAGGAAAATAATAA
AGTTGAACTCAATTTCTAATTTAGGGAAATGAAATTATCATTTTATTATC
ATATTATGAACCGATCGTTCCGTTACTCACTATTTCTCTC
back to top

protein sequence of SMED30014511-orf-1

>SMED30014511-orf-1 ID=SMED30014511-orf-1|Name=SMED30014511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MAKKSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKT
IEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENI
NRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIE
TSAKASTNITEAFEELTMAILKKCPREDESRSYGAQKLSNVPRNNSYGTK
CCQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0019003GDP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006893Golgi to plasma membrane transport
GO:0007409axonogenesis
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0016197endosomal transport
GO:0030859polarized epithelial cell differentiation
GO:0032869cellular response to insulin stimulus
GO:0043001Golgi to plasma membrane protein transport
GO:0045200establishment of neuroblast polarity
GO:0061467basolateral protein localization
GO:0071786endoplasmic reticulum tubular network organization
GO:0072659protein localization to plasma membrane
GO:0097051establishment of protein localization to endoplasmic reticulum membrane
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0005929cilium
GO:0010008endosome membrane
GO:0016020membrane
GO:0030659cytoplasmic vesicle membrane
GO:0030670phagocytic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0032593insulin-responsive compartment
GO:0042995cell projection
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
GO:0071782endoplasmic reticulum tubular network
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 10..31
score: 48.64
coord: 113..126
score: 36.87
coord: 148..170
score: 40.05
coord: 51..73
score: 54.32
coord: 33..49
score: 32.38
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 12..173
e-value: 1.2E-16
score: 71.3
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 15..196
e-value: 1.4E-4
score: 16.1
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 7..173
e-value: 9.1E-34
score: 128.2
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 10..173
e-value: 2.2E-97
score: 339.5
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..174
e-value: 5.2E-4
score: 10.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 3..202
e-value: 1.1E-68
score: 232.5
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 2..192
NoneNo IPR availablePANTHERPTHR24073:SF483RAS-RELATED PROTEIN RAB-10coord: 2..192
NoneNo IPR availablePROSITEPS51419RABcoord: 5..203
score: 35.761
NoneNo IPR availableCDDcd01867Rab8_Rab10_Rab13_likecoord: 7..173
e-value: 2.66821E-104
score: 295.331
IPR001806Small GTPasePFAMPF00071Rascoord: 11..171
e-value: 5.3E-63
score: 211.4
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 10..165
e-value: 4.4E-32
score: 109.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..180